2YRKA

Solution structure of the zf-c2h2 domain in zinc finger homeodomain 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
GSSGSSGGTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger homeobox protein 4
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yrkA01
2EMWA 2LVHA 2EOSA 2EMCA 2A25A 1JK2A 1BB8A 2EN7A 1A1LA 2EOQA 2EN2A 2LV2A 4F2JC 5KL7A 2EPAA 2DMIA 2EM8A 4R2AA 2ELZA 4R2CA 2ENAA 2ELYA 1LLMC 2YU5A 4R2PA 2EMLA 2EPZA 2EM9A 4R2DA 5KL6A 1P47A 3VHTB 2CT1A 4R2SA 2EM0A 2YTQA 1TN9A 3M99B 2EMKA 2DLKA 2LCEA 2CTDA 2CSHA 2WBTA 2BB8A 2D9HA 1A1HA 1UN6B 1X6FA 2YTNA 2YTPA 2RPCA 4R2EA 2VRDA 2EMYA 2EPUA 2R1FA 2YTJA 3MHHC 5KL3A 2YTIA 2J7JA 1YUJA 1NCSA 1G2DC 2EOXA 1X6HA 2EN8A 4FK5C 2EM5A 1TF3A 2YTDA 2YSOA 2EN1A 3EPKA 2EMHA 2EPCA 2YRKA 2ENCA 2EOYA 5KL5A 2YRHA 1B69A 2EMAA 2YTOA 2EN4A 2JPAA 2EMBA 2NABA 2DGCA 2EOIA 2EM3A 1DGCA 1WJPA 1ZAAC 4R2QA 2EP3A 2ADRA 2WBUA 2I13A 4F6MA 1YSAC 2M9AA 2HGHA 2LO3A 1A1JA 2EPXA 2RSIA 5KL2A 1AAYA 1ZU1A 1X5WA 3UK3C 4GZNC 2EL4A 3EPLA 2PRTA 2EL6A 2MKDA 2EPPA 1RMDA 1G2FC 2EPRA 5KL4A 2EL5A 1Z1BA 1X6EA 2EJ4A 2MDGA 1A1FA 2DRPA 1A1KA 2EM7A 4M9VC 2EORA 2EN6A 2EOJA 1JK1A 2EOMA 2YTFA 2EM6A 2EOZA 2YTGA 2EQ3A 2GLIA 4IJDA 1KJKA 2EMZA 4WSGA 1TF6A 2EN3A 2DLQA 2YTEA 2MKNA 1YUIA 2EMGA 2YRMA 4R2RA 4X9JA 2JP9A 2EMXA 4F6NA 2EM2A 2ENHA 1X3CA 2YSPA 2EMIA 2E72A 2EQ1A 1F2IG 4IS1C 3EPHA 3EPJA 2WBSA 1A1GA 3MHSC 2WCC3 2EOOA 2EMFA 1UBDC 1A1IA 1BBOA 2GHFA 2LT7A 2EM4A 2YU8A 2EOFA 2EOEA 1MEYC 1ZR9A 2EE8A 2EOHA 2EQ0A
chains in the Genus database with same CATH superfamily
2HHHE 2EPKX 2LUPB 2EMCA 1BB8A 1A1LA 4F2JC 3VYYA 4N4RB 2E5LE 2EM8A 2EM9A 5KL6A 1P47A 4BS9A 2V8QB 2GPIA 3JTZA 3HTXA 1EKZA 4JI8E 2EMKA 2B3TB 2LCEA 2CSHA 4LF5E 4DV5E 4X64E 2V86A 2YTPA 2VRDA 2EMYA 2EPUA 2M7QA 2L6MA 2L3JA 1J5EE 5KL3A 2L2KB 4WX9A 3DJWA 1X49A 2V88A 1WHQA 4WFTA 2FV4B 4LFBE 4JI3E 3OMLA 1HNWE 2N3GA 1DI2A 3AV0A 4FK5C 3ADLA 4HEIA 2EM5A 2YSOA 2EPCA 4HTGA 2YPNA 1XMOE 3J7AG 2NUEA 2EOYA 2EPNA 5CFFE 5KL5A 2YRHA 1B69A 2EMAA 4NZVA 2UXCE 1N3GA 1X47A 2VQEE 4DMIA 3C6KA 2H36X 1ZBQA 5A69A 2JXPA 1DGCA 1WJPA 4R2QA 4F9AB 2I13A 2ODRC 1YSAC 2E1MA 2M9AA 1L4SA 2DMYA 2EPXA 3BBGA 1AAYA 1ZU1A 2NUFA 1HNXE 2EL6A 4B3TE 2MKDA 1G2FC 2EPRA 1YYWA 1Z1BA 1X6EA 3F6GA 4R8OA 1N33E 5F3WA 3ADGA 2JR1A 3F6HA 1MGTA 2EM7A 2EOJA 2EOMA 4WXCA 2YTGA 2EQ3A 4Q28A 1TF6A 3LMLA 3DF6A 2KONA 1GQEA 1PKPA 2JWOA 1PJTA 3LLHA 4Q35B 4DV4E 4I8OA 4L5NC 2FGGA 2E72A 1WHNA 4X8WA 3EPHA 1N36E 1DQ3A 3MHSC 1XMQE 1EH6A 2EOOA 4DR3E 1WXRA 1A1GA 2L2MA 2EMFA 4O4KA 2GHFA 4LF8E 2EM4A 2YU8A 1IQOA 1ZR9A 2EE8A 2EOHA 1X48A 3ZOQB 2EQ1A 2EMWA 3KWRA 4DR5E 2EOSA 4LF4E 4JV5E 4DV7E 4BHCA 2EN7A 2N8XA 2LV2A 2BBGA 4ZYGA 5IT9C 4R2CA 2YU5A 4R2PA 2EPZA 4R2DA 4RHBB 2CT1A 3IWCA 1STUA 1TN9A 2DLKA 2DSYA 5A6AA 4WYQB 2YTNA 4X62E 4GEQB 4F9CB 5A6JA 1NCSA 2EOXA 2EN8A 3VYXA 3KZZA 1TF3A 2YTDA 1N32E 2M1SA 4OX9E 2EN1A 2EMHA 2B7TA 4DV6E 4O5GA 2UUAE 1YZ9A 4B3SE 1T38A 5AE2A 3ADJA 2MC6A 2R76A 2JPAA 4F9BB 2UUCE 2EPLX 1EH7A 3HPZA 1ZAAC 2K7IA 4L8NA 1YFHA 2RS7A 1FKAE 2LO3A 3T1YE 2K4VA 5AE3A 2UXDE 2EPOA 3P1XA 1RQ0A 1AH5A 2JY9A 5A6BD 2EPMX 2NA2A 4BMJA 1PDAA 2LUQA 2EPPA 4GKKE 5ADZA 2KHXA 2EJ4A 3RMPA 1YPNA 3ADIA 4DR7E 4M9VC 1T4LB 1FJGE 2EOZA 2RQLA 2EMZA 3THOB 5A6BA 2M4IA 5IV8B 2EMGA 1BBGA 2IHR1 3FIGA 4R2RA 4YHHE 1QNTA 4LU9A 2EMXA 4WSPA 4F6NA 1I94E 2ENHA 4NXME 2EMIA 3C4TA 4DV2E 5T6JA 4IS1C 5IXMB 4KZSA 4DUZE 4R03A 3EQ1A 4JI4E 5AASA 1A1IA 1BBOA 2V85A 2Q8UA 4BHBA 2B7VA 2N3HA 2A25A 1GTKA 2EOQA 2EN2A 4JI0E 4TUIA 2EPAA 1LLMC 2JOBA 4NHRA 1NEIA 2RS6A 4BBYA 2JOXA 4OOGC 2LTRA 4R2SA 2DB2A 5BR8E 1SFEA 2UXBE 4M30A 1T39A 2WBTA 3JU0A 5A2QC 1T4NA 2BB8A 2D9HA 3MSWA 1A1HA 4DR1E 1X6FA 1UN6B 2V83A 4R2EA 3BIDA 2R1FA 2NUGA 4LF6E 2ODRD 2YTIA 2J7JA 1YUJA 1G2DC 3HPSA 4JI6E 3VK6A 3AUZA 1T4OA 4TUGA 2MC5A 2L8TA 2ENCA 5DNYA 2YTOA 2F4VE 2EN4A 2RTXA 4LTYA 2NABA 2DGCA 1YYOA 1N34E 2EP3A 1UILA 2ADRA 2L33A 4DV3E 4F6MA 2YWQA 2L2NA 2HGHA 2G7HA 2RSIA 2VF1A 1IBLE 1X5WA 3UK3C 4GZNC 2YT4A 4BC7A 4LF9E 3EPLA 2PRTA 5AC5A 4DR4E 1SR9A 1RMDA 1PJQA 5KL4A 2YZTA 1A1FA 2CPNA 2DRPA 3BF2A 3BGHA 2EN6A 2HJJA 3IWDA 2EM6A 4BC9A 4O43A 2FTXB 5LMUE 2GLIA 4IJDA 4DKKA 4JI2E 2LRSA 1YUIA 2MKNA 4ZYEA 2YRMA 3C4BA 5AC4A 1PJSA 4JYAE 4JI7E 2UUBE 4DR2E 2JVAA 4LFCE 3HXLA 1IMUA 1XNQE 3EPJA 2RSMA 1UBDC 3J81C 1IBME 2V87A 2LT7A 2EOFA 2EQ0A 2UU9E 5AE1A 1YYKA 4K0KE 2LVHA 3L00A 2VQFE 2LMZA 1JK2A 4X65E 4DR6E 2LE2A 5KL7A 1UHZA 2DMIA 4R2AA 2ELZA 2ENAA 2ELYA 4KWYA 4J8ZA 2EMLA 1IQSA 2LJHA 3T1HE 4P78A 3VHTB 2EM0A 4MLQA 3IWBA 2YTQA 4M0VA 4RH8A 3M99B 1RC7A 2CTDA 1KYQA 2RPCA 1GZ6A 2YTJA 3MHHC 2DIXA 4LF7E 5A6KA 4DUYE 1ZBTA 4LFAE 1X6HA 4DV1E 4WXDA 3H09A 2ZM6E 2L92A 3EPKA 5FLXC 2JYAA 2LBSB 2YRKA 1WRJA 4GKJE 2KOUA 2LTSA 3K6QA 5IWAE 2WZOA 1IBKE 4DV0E 2F8BA 2EMBA 2EOIA 2EM3A 4F54A 4MLVA 3TQMA 4JI1E 3QG5C 2WBUA 4P7DA 3OTOE 1A1JA 3HQ1A 4ZYDA 5KL2A 4B3ME 1EH8A 3C6MA 1HR0E 4X66E 4BCAA 1J26A 4WPYA 2EL4A 5LMNE 2L3CA 2EWLA 3KZYA 2EL5A 4AQYE 2MDGA 5TSEA 4ZYHA 4YY3E 2EZ6A 4KHPE 1A1KA 2VE7C 2EORA 4NXNE 1O0WA 1JK1A 2YTFA 2I9IA 1KJKA 5LLQA 4WSGA 2EN3A 2DLQA 2YTEA 3J7Yp 1XNRE 4X9JA 4JI5E 2JP9A 3THNA 1HNZE 2EM2A 3JAMC 4B3RE 1X3CA 2YSPA 1QU6A 1F2IG 4M2ZA 2WBSA 2B9DA 5LL6R 2WCC3 2HC5A 2LJUA 2MDRA 3ECRA 2V89A 4O24A 2EOEA 1MEYC 3J80C
chains in the Genus database with same CATH topology
2EMWA 2LVHA 2EOSA 2EMCA 2A25A 1JK2A 1BB8A 2EN7A 1A1LA 2EOQA 2EN2A 2LV2A 4F2JC 5KL7A 2EPAA 2DMIA 2EM8A 4R2AA 2ELZA 4R2CA 2ENAA 2ELYA 1LLMC 2YU5A 4R2PA 2EMLA 2EPZA 2EM9A 4R2DA 5KL6A 1P47A 3VHTB 2CT1A 4R2SA 2EM0A 2YTQA 1TN9A 3M99B 2EMKA 2DLKA 2LCEA 2CTDA 2CSHA 2WBTA 2BB8A 2D9HA 1A1HA 1UN6B 1X6FA 2YTNA 2YTPA 2RPCA 4R2EA 2VRDA 2EMYA 2EPUA 2R1FA 2YTJA 3MHHC 5KL3A 2YTIA 2J7JA 1YUJA 1NCSA 1G2DC 2EOXA 1X6HA 2EN8A 4FK5C 2EM5A 1TF3A 2YTDA 2YSOA 2EN1A 3EPKA 2EMHA 2EPCA 2YRKA 2ENCA 2EOYA 5KL5A 2YRHA 1B69A 2EMAA 2YTOA 2EN4A 2JPAA 2EMBA 2NABA 2DGCA 2EOIA 2EM3A 1DGCA 1WJPA 1ZAAC 4R2QA 2EP3A 2ADRA 2WBUA 2I13A 4F6MA 1YSAC 2M9AA 2HGHA 2LO3A 1A1JA 2EPXA 2RSIA 5KL2A 1AAYA 1ZU1A 1X5WA 3UK3C 4GZNC 2EL4A 3EPLA 2PRTA 2EL6A 2MKDA 2EPPA 1RMDA 1G2FC 2EPRA 5KL4A 2EL5A 1Z1BA 1X6EA 2EJ4A 2MDGA 1A1FA 2DRPA 1A1KA 2EM7A 4M9VC 2EORA 2EN6A 2EOJA 1JK1A 2EOMA 2YTFA 2EM6A 2EOZA 2YTGA 2EQ3A 2GLIA 4IJDA 1KJKA 2EMZA 4WSGA 1TF6A 2EN3A 2DLQA 2YTEA 2MKNA 1YUIA 2EMGA 2YRMA 4R2RA 4X9JA 2JP9A 2EMXA 4F6NA 2EM2A 2ENHA 1X3CA 2YSPA 2EMIA 2E72A 2EQ1A 1F2IG 4IS1C 3EPHA 3EPJA 2WBSA 1A1GA 3MHSC 2WCC3 2EOOA 2EMFA 1UBDC 1A1IA 1BBOA 2GHFA 2LT7A 2EM4A 2YU8A 2EOFA 2EOEA 1MEYC 1ZR9A 2EE8A 2EOHA 2EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  2LVH A;  2EOS A;  2EMC A;  2A25 A;  1JK2 A;  1BB8 A;  2EN7 A;  1A1L A;  2EOQ A;  2EN2 A;  2LV2 A;  4F2J C;  5KL7 A;  2EPA A;  2DMI A;  2EM8 A;  4R2A A;  2ELZ A;  4R2C A;  2ENA A;  2ELY A;  1LLM C;  2YU5 A;  4R2P A;  2EML A;  2EPZ A;  2EM9 A;  4R2D A;  5KL6 A;  1P47 A;  3VHT B;  2CT1 A;  4R2S A;  2EM0 A;  2YTQ A;  1TN9 A;  3M99 B;  2EMK A;  2DLK A;  2LCE A;  2CTD A;  2CSH A;  2WBT A;  2BB8 A;  2D9H A;  1A1H A;  1UN6 B;  1X6F A;  2YTN A;  2YTP A;  2RPC A;  4R2E A;  2VRD A;  2EMY A;  2EPU A;  2R1F A;  2YTJ A;  3MHH C;  5KL3 A;  2YTI A;  2J7J A;  1YUJ A;  1NCS A;  1G2D C;  2EOX A;  1X6H A;  2EN8 A;  4FK5 C;  2EM5 A;  1TF3 A;  2YTD A;  2YSO A;  2EN1 A;  3EPK A;  2EMH A;  2EPC A;  2YRK A;  2ENC A;  2EOY A;  5KL5 A;  2YRH A;  1B69 A;  2EMA A;  2YTO A;  2EN4 A;  2JPA A;  2EMB A;  2NAB A;  2DGC A;  2EOI A;  2EM3 A;  1DGC A;  1WJP A;  1ZAA C;  4R2Q A;  2EP3 A;  2ADR A;  2WBU A;  2I13 A;  4F6M A;  1YSA C;  2M9A A;  2HGH A;  2LO3 A;  1A1J A;  2EPX A;  2RSI A;  5KL2 A;  1AAY A;  1ZU1 A;  1X5W A;  3UK3 C;  4GZN C;  2EL4 A;  3EPL A;  2PRT A;  2EL6 A;  2MKD A;  2EPP A;  1RMD A;  1G2F C;  2EPR A;  5KL4 A;  2EL5 A;  1Z1B A;  1X6E A;  2EJ4 A;  2MDG A;  1A1F A;  2DRP A;  1A1K A;  2EM7 A;  4M9V C;  2EOR A;  2EN6 A;  2EOJ A;  1JK1 A;  2EOM A;  2YTF A;  2EM6 A;  2EOZ A;  2YTG A;  2EQ3 A;  2GLI A;  4IJD A;  1KJK A;  2EMZ A;  4WSG A;  1TF6 A;  2EN3 A;  2DLQ A;  2YTE A;  2MKN A;  1YUI A;  2EMG A;  2YRM A;  4R2R A;  4X9J A;  2JP9 A;  2EMX A;  4F6N A;  2EM2 A;  2ENH A;  1X3C A;  2YSP A;  2EMI A;  2E72 A;  2EQ1 A;  1F2I G;  4IS1 C;  3EPH A;  3EPJ A;  2WBS A;  1A1G A;  3MHS C;  2WCC 3;  2EOO A;  2EMF A;  1UBD C;  1A1I A;  1BBO A;  2GHF A;  2LT7 A;  2EM4 A;  2YU8 A;  2EOF A;  2EOE A;  1MEY C;  1ZR9 A;  2EE8 A;  2EOH A;  2EQ0 A; 
#chains in the Genus database with same CATH topology
 2HHH E;  2EPK X;  2LUP B;  2EMC A;  1BB8 A;  1A1L A;  4F2J C;  3VYY A;  4N4R B;  2E5L E;  2EM8 A;  2EM9 A;  5KL6 A;  1P47 A;  4BS9 A;  2V8Q B;  2GPI A;  3JTZ A;  3HTX A;  1EKZ A;  4JI8 E;  2EMK A;  2B3T B;  2LCE A;  2CSH A;  4LF5 E;  4DV5 E;  4X64 E;  2V86 A;  2YTP A;  2VRD A;  2EMY A;  2EPU A;  2M7Q A;  2L6M A;  2L3J A;  1J5E E;  5KL3 A;  2L2K B;  4WX9 A;  3DJW A;  1X49 A;  2V88 A;  1WHQ A;  4WFT A;  2FV4 B;  4LFB E;  4JI3 E;  3OML A;  1HNW E;  2N3G A;  1DI2 A;  3AV0 A;  4FK5 C;  3ADL A;  4HEI A;  2EM5 A;  2YSO A;  2EPC A;  4HTG A;  2YPN A;  1XMO E;  3J7A G;  2NUE A;  2EOY A;  2EPN A;  5CFF E;  5KL5 A;  2YRH A;  1B69 A;  2EMA A;  4NZV A;  2UXC E;  1N3G A;  1X47 A;  2VQE E;  4DMI A;  3C6K A;  2H36 X;  1ZBQ A;  5A69 A;  2JXP A;  1DGC A;  1WJP A;  4R2Q A;  4F9A B;  2I13 A;  2ODR C;  1YSA C;  2E1M A;  2M9A A;  1L4S A;  2DMY A;  2EPX A;  3BBG A;  1AAY A;  1ZU1 A;  2NUF A;  1HNX E;  2EL6 A;  4B3T E;  2MKD A;  1G2F C;  2EPR A;  1YYW A;  1Z1B A;  1X6E A;  3F6G A;  4R8O A;  1N33 E;  5F3W A;  3ADG A;  2JR1 A;  3F6H A;  1MGT A;  2EM7 A;  2EOJ A;  2EOM A;  4WXC A;  2YTG A;  2EQ3 A;  4Q28 A;  1TF6 A;  3LML A;  3DF6 A;  2KON A;  1GQE A;  1PKP A;  2JWO A;  1PJT A;  3LLH A;  4Q35 B;  4DV4 E;  4I8O A;  4L5N C;  2FGG A;  2E72 A;  1WHN A;  4X8W A;  3EPH A;  1N36 E;  1DQ3 A;  3MHS C;  1XMQ E;  1EH6 A;  2EOO A;  4DR3 E;  1WXR A;  1A1G A;  2L2M A;  2EMF A;  4O4K A;  2GHF A;  4LF8 E;  2EM4 A;  2YU8 A;  1IQO A;  1ZR9 A;  2EE8 A;  2EOH A;  1X48 A;  3ZOQ B;  2EQ1 A;  2EMW A;  3KWR A;  4DR5 E;  2EOS A;  4LF4 E;  4JV5 E;  4DV7 E;  4BHC A;  2EN7 A;  2N8X A;  2LV2 A;  2BBG A;  4ZYG A;  5IT9 C;  4R2C A;  2YU5 A;  4R2P A;  2EPZ A;  4R2D A;  4RHB B;  2CT1 A;  3IWC A;  1STU A;  1TN9 A;  2DLK A;  2DSY A;  5A6A A;  4WYQ B;  2YTN A;  4X62 E;  4GEQ B;  4F9C B;  5A6J A;  1NCS A;  2EOX A;  2EN8 A;  3VYX A;  3KZZ A;  1TF3 A;  2YTD A;  1N32 E;  2M1S A;  4OX9 E;  2EN1 A;  2EMH A;  2B7T A;  4DV6 E;  4O5G A;  2UUA E;  1YZ9 A;  4B3S E;  1T38 A;  5AE2 A;  3ADJ A;  2MC6 A;  2R76 A;  2JPA A;  4F9B B;  2UUC E;  2EPL X;  1EH7 A;  3HPZ A;  1ZAA C;  2K7I A;  4L8N A;  1YFH A;  2RS7 A;  1FKA E;  2LO3 A;  3T1Y E;  2K4V A;  5AE3 A;  2UXD E;  2EPO A;  3P1X A;  1RQ0 A;  1AH5 A;  2JY9 A;  5A6B D;  2EPM X;  2NA2 A;  4BMJ A;  1PDA A;  2LUQ A;  2EPP A;  4GKK E;  5ADZ A;  2KHX A;  2EJ4 A;  3RMP A;  1YPN A;  3ADI A;  4DR7 E;  4M9V C;  1T4L B;  1FJG E;  2EOZ A;  2RQL A;  2EMZ A;  3THO B;  5A6B A;  2M4I A;  5IV8 B;  2EMG A;  1BBG A;  2IHR 1;  3FIG A;  4R2R A;  4YHH E;  1QNT A;  4LU9 A;  2EMX A;  4WSP A;  4F6N A;  1I94 E;  2ENH A;  4NXM E;  2EMI A;  3C4T A;  4DV2 E;  5T6J A;  4IS1 C;  5IXM B;  4KZS A;  4DUZ E;  4R03 A;  3EQ1 A;  4JI4 E;  5AAS A;  1A1I A;  1BBO A;  2V85 A;  2Q8U A;  4BHB A;  2B7V A;  2N3H A;  2A25 A;  1GTK A;  2EOQ A;  2EN2 A;  4JI0 E;  4TUI A;  2EPA A;  1LLM C;  2JOB A;  4NHR A;  1NEI A;  2RS6 A;  4BBY A;  2JOX A;  4OOG C;  2LTR A;  4R2S A;  2DB2 A;  5BR8 E;  1SFE A;  2UXB E;  4M30 A;  1T39 A;  2WBT A;  3JU0 A;  5A2Q C;  1T4N A;  2BB8 A;  2D9H A;  3MSW A;  1A1H A;  4DR1 E;  1X6F A;  1UN6 B;  2V83 A;  4R2E A;  3BID A;  2R1F A;  2NUG A;  4LF6 E;  2ODR D;  2YTI A;  2J7J A;  1YUJ A;  1G2D C;  3HPS A;  4JI6 E;  3VK6 A;  3AUZ A;  1T4O A;  4TUG A;  2MC5 A;  2L8T A;  2ENC A;  5DNY A;  2YTO A;  2F4V E;  2EN4 A;  2RTX A;  4LTY A;  2NAB A;  2DGC A;  1YYO A;  1N34 E;  2EP3 A;  1UIL A;  2ADR A;  2L33 A;  4DV3 E;  4F6M A;  2YWQ A;  2L2N A;  2HGH A;  2G7H A;  2RSI A;  2VF1 A;  1IBL E;  1X5W A;  3UK3 C;  4GZN C;  2YT4 A;  4BC7 A;  4LF9 E;  3EPL A;  2PRT A;  5AC5 A;  4DR4 E;  1SR9 A;  1RMD A;  1PJQ A;  5KL4 A;  2YZT A;  1A1F A;  2CPN A;  2DRP A;  3BF2 A;  3BGH A;  2EN6 A;  2HJJ A;  3IWD A;  2EM6 A;  4BC9 A;  4O43 A;  2FTX B;  5LMU E;  2GLI A;  4IJD A;  4DKK A;  4JI2 E;  2LRS A;  1YUI A;  2MKN A;  4ZYE A;  2YRM A;  3C4B A;  5AC4 A;  1PJS A;  4JYA E;  4JI7 E;  2UUB E;  4DR2 E;  2JVA A;  4LFC E;  3HXL A;  1IMU A;  1XNQ E;  3EPJ A;  2RSM A;  1UBD C;  3J81 C;  1IBM E;  2V87 A;  2LT7 A;  2EOF A;  2EQ0 A;  2UU9 E;  5AE1 A;  1YYK A;  4K0K E;  2LVH A;  3L00 A;  2VQF E;  2LMZ A;  1JK2 A;  4X65 E;  4DR6 E;  2LE2 A;  5KL7 A;  1UHZ A;  2DMI A;  4R2A A;  2ELZ A;  2ENA A;  2ELY A;  4KWY A;  4J8Z A;  2EML A;  1IQS A;  2LJH A;  3T1H E;  4P78 A;  3VHT B;  2EM0 A;  4MLQ A;  3IWB A;  2YTQ A;  4M0V A;  4RH8 A;  3M99 B;  1RC7 A;  2CTD A;  1KYQ A;  2RPC A;  1GZ6 A;  2YTJ A;  3MHH C;  2DIX A;  4LF7 E;  5A6K A;  4DUY E;  1ZBT A;  4LFA E;  1X6H A;  4DV1 E;  4WXD A;  3H09 A;  2ZM6 E;  2L92 A;  3EPK A;  5FLX C;  2JYA A;  2LBS B;  2YRK A;  1WRJ A;  4GKJ E;  2KOU A;  2LTS A;  3K6Q A;  5IWA E;  2WZO A;  1IBK E;  4DV0 E;  2F8B A;  2EMB A;  2EOI A;  2EM3 A;  4F54 A;  4MLV A;  3TQM A;  4JI1 E;  3QG5 C;  2WBU A;  4P7D A;  3OTO E;  1A1J A;  3HQ1 A;  4ZYD A;  5KL2 A;  4B3M E;  1EH8 A;  3C6M A;  1HR0 E;  4X66 E;  4BCA A;  1J26 A;  4WPY A;  2EL4 A;  5LMN E;  2L3C A;  2EWL A;  3KZY A;  2EL5 A;  4AQY E;  2MDG A;  5TSE A;  4ZYH A;  4YY3 E;  2EZ6 A;  4KHP E;  1A1K A;  2VE7 C;  2EOR A;  4NXN E;  1O0W A;  1JK1 A;  2YTF A;  2I9I A;  1KJK A;  5LLQ A;  4WSG A;  2EN3 A;  2DLQ A;  2YTE A;  3J7Y p;  1XNR E;  4X9J A;  4JI5 E;  2JP9 A;  3THN A;  1HNZ E;  2EM2 A;  3JAM C;  4B3R E;  1X3C A;  2YSP A;  1QU6 A;  1F2I G;  4M2Z A;  2WBS A;  2B9D A;  5LL6 R;  2WCC 3;  2HC5 A;  2LJU A;  2MDR A;  3ECR A;  2V89 A;  4O24 A;  2EOE A;  1MEY C;  3J80 C; 
#chains in the Genus database with same CATH homology
 2EMW A;  2LVH A;  2EOS A;  2EMC A;  2A25 A;  1JK2 A;  1BB8 A;  2EN7 A;  1A1L A;  2EOQ A;  2EN2 A;  2LV2 A;  4F2J C;  5KL7 A;  2EPA A;  2DMI A;  2EM8 A;  4R2A A;  2ELZ A;  4R2C A;  2ENA A;  2ELY A;  1LLM C;  2YU5 A;  4R2P A;  2EML A;  2EPZ A;  2EM9 A;  4R2D A;  5KL6 A;  1P47 A;  3VHT B;  2CT1 A;  4R2S A;  2EM0 A;  2YTQ A;  1TN9 A;  3M99 B;  2EMK A;  2DLK A;  2LCE A;  2CTD A;  2CSH A;  2WBT A;  2BB8 A;  2D9H A;  1A1H A;  1UN6 B;  1X6F A;  2YTN A;  2YTP A;  2RPC A;  4R2E A;  2VRD A;  2EMY A;  2EPU A;  2R1F A;  2YTJ A;  3MHH C;  5KL3 A;  2YTI A;  2J7J A;  1YUJ A;  1NCS A;  1G2D C;  2EOX A;  1X6H A;  2EN8 A;  4FK5 C;  2EM5 A;  1TF3 A;  2YTD A;  2YSO A;  2EN1 A;  3EPK A;  2EMH A;  2EPC A;  2YRK A;  2ENC A;  2EOY A;  5KL5 A;  2YRH A;  1B69 A;  2EMA A;  2YTO A;  2EN4 A;  2JPA A;  2EMB A;  2NAB A;  2DGC A;  2EOI A;  2EM3 A;  1DGC A;  1WJP A;  1ZAA C;  4R2Q A;  2EP3 A;  2ADR A;  2WBU A;  2I13 A;  4F6M A;  1YSA C;  2M9A A;  2HGH A;  2LO3 A;  1A1J A;  2EPX A;  2RSI A;  5KL2 A;  1AAY A;  1ZU1 A;  1X5W A;  3UK3 C;  4GZN C;  2EL4 A;  3EPL A;  2PRT A;  2EL6 A;  2MKD A;  2EPP A;  1RMD A;  1G2F C;  2EPR A;  5KL4 A;  2EL5 A;  1Z1B A;  1X6E A;  2EJ4 A;  2MDG A;  1A1F A;  2DRP A;  1A1K A;  2EM7 A;  4M9V C;  2EOR A;  2EN6 A;  2EOJ A;  1JK1 A;  2EOM A;  2YTF A;  2EM6 A;  2EOZ A;  2YTG A;  2EQ3 A;  2GLI A;  4IJD A;  1KJK A;  2EMZ A;  4WSG A;  1TF6 A;  2EN3 A;  2DLQ A;  2YTE A;  2MKN A;  1YUI A;  2EMG A;  2YRM A;  4R2R A;  4X9J A;  2JP9 A;  2EMX A;  4F6N A;  2EM2 A;  2ENH A;  1X3C A;  2YSP A;  2EMI A;  2E72 A;  2EQ1 A;  1F2I G;  4IS1 C;  3EPH A;  3EPJ A;  2WBS A;  1A1G A;  3MHS C;  2WCC 3;  2EOO A;  2EMF A;  1UBD C;  1A1I A;  1BBO A;  2GHF A;  2LT7 A;  2EM4 A;  2YU8 A;  2EOF A;  2EOE A;  1MEY C;  1ZR9 A;  2EE8 A;  2EOH A;  2EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...