2YRKA

Solution structure of the zf-c2h2 domain in zinc finger homeodomain 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
GSSGSSGGTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger homeobox protein 4
publication title Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yrkA01
2A25A 2GHFA 2EL6A 2EQ3A 2EN8A 2EPRA 1X3CA 2EPXA 5KL2A 1A1JA 2YRKA 2EMFA 2R1FA 2GLIA 4F2JC 2E72A 2EMZA 2EMAA 2EN3A 2EL5A 5KL3A 2EM0A 2ENHA 4FK5C 2CTDA 2LVHA 5KL7A 1KJKA 4F6NA 1JK2A 2VRDA 2EJ4A 2I13A 1ZR9A 1X5WA 2EL4A 2EN7A 2EQ0A 2MDGA 4R2CA 2YTDA 2YTIA 4R2EA 2YSPA 1ZAAC 2NABA 2EMBA 2PRTA 3M99B 1ZU1A 2EOOA 5KL6A 2D9HA 4R2SA 2EN2A 2EPCA 2LO3A 2EOXA 2EOYA 1X6EA 2WBUA 2EOMA 1JK1A 2EMHA 1LLMC 2EOQA 2YTPA 2EM9A 4R2AA 1NCSA 1YSAC 2YTQA 1YUJA 1F2IG 1YUIA 2EM3A 2EPPA 2EN4A 2ENCA 1TF6A 2YTGA 2EOHA 2RSIA 1B69A 2BB8A 4R2DA 1AAYA 4R2RA 2EPUA 2HGHA 3UK3C 2EOFA 2EMKA 3EPJA 2YTOA 2EOEA 2EOZA 2ENAA 2JP9A 2EM4A 1X6FA 2YRHA 1A1GA 2EQ1A 2RPCA 1UN6B 1TN9A 2WBSA 2EMIA 2YTFA 2YRMA 1A1FA 2EOSA 4X9JA 2EORA 2YTNA 4IJDA 2EPZA 1A1IA 1TF3A 2EMXA 1X6HA 1A1HA 2EMGA 3MHHC 5KL4A 4R2QA 4IS1C 2J7JA 2EMLA 3EPLA 2LV2A 2JPAA 4M9VC 2DLQA 2EM5A 1G2DC 2EE8A 2MKDA 4F6MA 2YU5A 5KL5A 2WCC3 2EMWA 1UBDC 2EOIA 2EN1A 2DLKA 2LCEA 1RMDA 2YSOA 1A1LA 4WSGA 2EM7A 1BBOA 2EPAA 2EP3A 2LT7A 2ADRA 2M9AA 2YTEA 2EN6A 2YU8A 2CSHA 1G2FC 2EMYA 2EM2A 1BB8A 1WJPA 2EM6A 4GZNC 2MKNA 3VHTB 1DGCA 2EMCA 2ELZA 2ELYA 2EOJA 2YTJA 2DMIA 1MEYC 2CT1A 2EM8A 1P47A 3EPKA 1A1KA 4R2PA 2DGCA 1Z1BA 2DRPA 3MHSC 2WBTA 3EPHA
chains in the Genus database with same CATH superfamily
2GHFA 2F8BA 1A1JA 2YRKA 4WFTA 3J80C 4LF5E 4LF8E 2RQLA 5KL3A 3ZOQB 4KZSA 4YY3E 2LBSB 4LU9A 4BHCA 4L8NA 4FK5C 4JI0E 4GKKE 2I9IA 2E1MA 3OTOE 2G7HA 2VRDA 2UUBE 2NA2A 3DJWA 1UILA 1ZR9A 2EN7A 2MC5A 2MDGA 4R2CA 4R2EA 4M30A 2YSPA 5IXMB 3VYXA 1GQEA 2HC5A 5A6JA 1SR9A 1YYOA 2EOMA 4O24A 5CFFE 2YTPA 4DR5E 1XNRE 4DR7E 5LMUE 4JI6E 2NUFA 1YUJA 4RHBB 2JR1A 2YT4A 5AASA 2RSIA 2B7TA 4R2DA 2L2NA 1AAYA 3BF2A 4JI5E 4DV0E 3UK3C 2EOEA 4NXNE 2JP9A 4Q35B 1A1GA 2M4IA 1EKZA 2KOUA 1YFHA 2V8QB 4WX9A 1T4NA 4R03A 4TUIA 4DUYE 3TQMA 4B3RE 4IJDA 1A1IA 1TF3A 2EMXA 2EMGA 3MHHC 4DUZE 2EMLA 3EPLA 3KZYA 1X48A 3JTZA 4JI4E 2EMWA 2DLKA 2LUQA 3HPZA 2EPAA 2LT7A 3ADGA 1IBLE 2YU8A 4I8OA 1G2FC 4LFAE 2L3JA 1WJPA 4B3TE 3J7Yp 3ADJA 4L5NC 3VHTB 2MDRA 3ADLA 2EPOA 3C4TA 2EOJA 3VK6A 2DMIA 4F9CB 2UUAE 2LE2A 1A1KA 2MC6A 2DRPA 4F54A 4DV2E 2N8XA 2F4VE 3EPHA 2A25A 4HTGA 2LJHA 4BS9A 5IV8B 2EL6A 1WHNA 4DV1E 4YHHE 2RS7A 1XNQE 2VQEE 2DB2A 2EMAA 3DF6A 1T38A 5AE3A 2LMZA 2EL5A 2IHR1 2CPNA 2EM0A 2CTDA 2JVAA 2JXPA 2JY9A 3HTXA 3C6KA 2HHHE 2I13A 4DKKA 4DR2E 1AH5A 2EQ0A 2L2MA 2ODRC 4X62E 4BC9A 2K4VA 3ECRA 2D9HA 1DQ3A 5LLQA 2EMHA 1LLMC 1JK1A 3J81C 2LTRA 2E5LE 5IT9C 2EM3A 2EPPA 4X8WA 2ENCA 5A69A 4F9BB 4BCAA 4P78A 1B69A 1YYKA 4R2RA 2LTSA 4R8OA 2V87A 3KZZA 2EPUA 1N34E 2ENAA 5A6KA 1PJSA 2EQ1A 2RPCA 1UN6B 1WHQA 1TN9A 2WBSA 2EMIA 3F6HA 5ADZA 2YZTA 4JI7E 1KYQA 2L8TA 2EOSA 2EORA 1A1HA 2JWOA 5KL4A 1IMUA 2J7JA 3EQ1A 4BC7A 1XMQE 2LV2A 4O43A 1G2DC 4P7DA 2WZOA 2B7VA 2MKDA 2K7IA 2EWLA 2LUPB 4LF6E 1WXRA 2EOIA 4DMIA 1A1LA 1RMDA 3HPSA 5LMNE 1QU6A 2EP3A 3IWBA 3VYYA 3OMLA 1N32E 3AUZA 4GZNC 2R76A 4HEIA 1DGCA 2EMCA 2ELZA 1HNZE 4DV4E 2CT1A 1MEYC 1O0WA 5TSEA 1RC7A 3EPKA 2DGCA 1Z1BA 2WBTA 2L2KB 2B9DA 4NHRA 1PDAA 3BGHA 2EQ3A 3KWRA 4BBYA 5BR8E 4WXCA 2EN8A 5KL2A 3T1HE 2EPXA 3T1YE 1N36E 2EMFA 2GLIA 2UUCE 4F2JC 4M0VA 4NZVA 4DV5E 4GEQB 2EN3A 2KONA 1GZ6A 2ENHA 2LVHA 2L3CA 5KL7A 4N4RB 3THNA 1KJKA 4F6NA 2EJ4A 2YTDA 2YTIA 1ZAAC 1FKAE 1HNXE 2EMBA 1PJQA 2JOXA 1MGTA 3M99B 2EOOA 5KL6A 4R2SA 1RQ0A 2EN2A 2EPCA 2L6MA 2LO3A 2EZ6A 2EPMX 2EOXA 2EOYA 2WBUA 1WRJA 2V89A 2N3GA 2EM9A 1YSAC 1NCSA 4LFCE 1NEIA 4DV3E 1YYWA 5AE1A 4JI3E 1TF6A 2EOHA 4DR6E 5A6BD 3P1XA 2UU9E 4LF4E 2HGHA 4DR1E 3H09A 2YTOA 5AE2A 2EOZA 4BMJA 2DMYA 2UXDE 2EM4A 2DSYA 5A6AA 2YRHA 3F6GA 2B3TB 1J5EE 1T4OA 1L4SA 4B3ME 2YRMA 2EPLX 3RMPA 3IWDA 4LF9E 4F9AB 2EPZA 3BBGA 4R2QA 4ZYHA 4ZYEA 1N33E 2UXBE 4IS1C 2EM5A 5T6JA 4JI8E 2ZM6E 2EE8A 3JAMC 4F6MA 1J26A 2YU5A 2WCC3 3C4BA 5A6BA 4JV5E 1UBDC 1STUA 2YSOA 4WSGA 3MSWA 4ZYDA 1BBOA 3L00A 1IBKE 2ADRA 2Q8UA 2M9AA 2YTEA 2EN6A 2V88A 2LRSA 2EM6A 2UXCE 2MKNA 1T39A 2ELYA 2L33A 2YWQA 5FLXC 2JOBA 2M7QA 2EM8A 2RSMA 2LJUA 2KHXA 2FV4B 4R2PA 2L92A 3MHSC 4WXDA 2V86A 1EH6A 1SFEA 1ZBQA 2V85A 2FTXB 2EPRA 1X3CA 1N3GA 2R1FA 3LMLA 2E72A 2EMZA 4JI1E 1EH7A 4DV6E 2NUGA 2HJJA 2YPNA 4KWYA 4X66E 2M1SA 3LLHA 1BBGA 1JK2A 4B3SE 4WSPA 4JI2E 4TUGA 2FGGA 1X5WA 2EL4A 2NABA 2PRTA 4BHBA 4OX9E 1X47A 1ZU1A 4J8ZA 1EH8A 4O5GA 1X6EA 1HR0E 2EOQA 2VF1A 4DR3E 2NUEA 4R2AA 1UHZA 2YTQA 3ADIA 1F2IG 1FJGE 1YUIA 2EN4A 2EPKX 3C6MA 2YTGA 4WYQB 1X49A 2VQFE 2BB8A 2RS6A 3JU0A 4LF7E 2JYAA 1T4LB 5DNYA 2EOFA 2EMKA 3QG5C 3EPJA 2VE7C 1X6FA 2GPIA 2N3HA 4X65E 2V83A 3AV0A 3THOB 1DI2A 4NXME 1IQSA 2ODRD 2YTFA 1QNTA 4ZYGA 3J7AG 3K6QA 1A1FA 1GTKA 3HQ1A 4DV7E 4X9JA 1XMOE 2YTNA 2BBGA 3IWCA 1X6HA 4K0KE 4LTYA 5AC5A 2JPAA 4M9VC 2DLQA 1ZBTA 4O4KA 1YPNA 5IWAE 2RTXA 5KL5A 1I94E 4MLVA 2EN1A 2LCEA 5F3WA 2EPNA 1IBME 4KHPE 4OOGC 2EM7A 4MLQA 4GKJE 4JYAE 5LL6R 5AC4A 4X64E 3HXLA 4RH8A 1YZ9A 5A2QC 2CSHA 2EMYA 2EM2A 1HNWE 1BB8A 2H36X 4M2ZA 2YTJA 3BIDA 2DIXA 3FIGA 4LFBE 1P47A 4DR4E 4AQYE 1PKPA 4WPYA 1PJTA 4Q28A 1IQOA
chains in the Genus database with same CATH topology
2A25A 2GHFA 2EL6A 2EQ3A 2EN8A 2EPRA 1X3CA 2EPXA 5KL2A 1A1JA 2YRKA 2EMFA 2R1FA 2GLIA 4F2JC 2E72A 2EMZA 2EMAA 2EN3A 2EL5A 5KL3A 2EM0A 2ENHA 4FK5C 2CTDA 2LVHA 5KL7A 1KJKA 4F6NA 1JK2A 2VRDA 2EJ4A 2I13A 1ZR9A 1X5WA 2EL4A 2EN7A 2EQ0A 2MDGA 4R2CA 2YTDA 2YTIA 4R2EA 2YSPA 1ZAAC 2NABA 2EMBA 2PRTA 3M99B 1ZU1A 2EOOA 5KL6A 2D9HA 4R2SA 2EN2A 2EPCA 2LO3A 2EOXA 2EOYA 1X6EA 2WBUA 2EOMA 1JK1A 2EMHA 1LLMC 2EOQA 2YTPA 2EM9A 4R2AA 1NCSA 1YSAC 2YTQA 1YUJA 1F2IG 1YUIA 2EM3A 2EPPA 2EN4A 2ENCA 1TF6A 2YTGA 2EOHA 2RSIA 1B69A 2BB8A 4R2DA 1AAYA 4R2RA 2EPUA 2HGHA 3UK3C 2EOFA 2EMKA 3EPJA 2YTOA 2EOEA 2EOZA 2ENAA 2JP9A 2EM4A 1X6FA 2YRHA 1A1GA 2EQ1A 2RPCA 1UN6B 1TN9A 2WBSA 2EMIA 2YTFA 2YRMA 1A1FA 2EOSA 4X9JA 2EORA 2YTNA 4IJDA 2EPZA 1A1IA 1TF3A 2EMXA 1X6HA 1A1HA 2EMGA 3MHHC 5KL4A 4R2QA 4IS1C 2J7JA 2EMLA 3EPLA 2LV2A 2JPAA 4M9VC 2DLQA 2EM5A 1G2DC 2EE8A 2MKDA 4F6MA 2YU5A 5KL5A 2WCC3 2EMWA 1UBDC 2EOIA 2EN1A 2DLKA 2LCEA 1RMDA 2YSOA 1A1LA 4WSGA 2EM7A 1BBOA 2EPAA 2EP3A 2LT7A 2ADRA 2M9AA 2YTEA 2EN6A 2YU8A 2CSHA 1G2FC 2EMYA 2EM2A 1BB8A 1WJPA 2EM6A 4GZNC 2MKNA 3VHTB 1DGCA 2EMCA 2ELZA 2ELYA 2EOJA 2YTJA 2DMIA 1MEYC 2CT1A 2EM8A 1P47A 3EPKA 1A1KA 4R2PA 2DGCA 1Z1BA 2DRPA 3MHSC 2WBTA 3EPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A25 A;  2GHF A;  2EL6 A;  2EQ3 A;  2EN8 A;  2EPR A;  1X3C A;  2EPX A;  5KL2 A;  1A1J A;  2YRK A;  2EMF A;  2R1F A;  2GLI A;  4F2J C;  2E72 A;  2EMZ A;  2EMA A;  2EN3 A;  2EL5 A;  5KL3 A;  2EM0 A;  2ENH A;  4FK5 C;  2CTD A;  2LVH A;  5KL7 A;  1KJK A;  4F6N A;  1JK2 A;  2VRD A;  2EJ4 A;  2I13 A;  1ZR9 A;  1X5W A;  2EL4 A;  2EN7 A;  2EQ0 A;  2MDG A;  4R2C A;  2YTD A;  2YTI A;  4R2E A;  2YSP A;  1ZAA C;  2NAB A;  2EMB A;  2PRT A;  3M99 B;  1ZU1 A;  2EOO A;  5KL6 A;  2D9H A;  4R2S A;  2EN2 A;  2EPC A;  2LO3 A;  2EOX A;  2EOY A;  1X6E A;  2WBU A;  2EOM A;  1JK1 A;  2EMH A;  1LLM C;  2EOQ A;  2YTP A;  2EM9 A;  4R2A A;  1NCS A;  1YSA C;  2YTQ A;  1YUJ A;  1F2I G;  1YUI A;  2EM3 A;  2EPP A;  2EN4 A;  2ENC A;  1TF6 A;  2YTG A;  2EOH A;  2RSI A;  1B69 A;  2BB8 A;  4R2D A;  1AAY A;  4R2R A;  2EPU A;  2HGH A;  3UK3 C;  2EOF A;  2EMK A;  3EPJ A;  2YTO A;  2EOE A;  2EOZ A;  2ENA A;  2JP9 A;  2EM4 A;  1X6F A;  2YRH A;  1A1G A;  2EQ1 A;  2RPC A;  1UN6 B;  1TN9 A;  2WBS A;  2EMI A;  2YTF A;  2YRM A;  1A1F A;  2EOS A;  4X9J A;  2EOR A;  2YTN A;  4IJD A;  2EPZ A;  1A1I A;  1TF3 A;  2EMX A;  1X6H A;  1A1H A;  2EMG A;  3MHH C;  5KL4 A;  4R2Q A;  4IS1 C;  2J7J A;  2EML A;  3EPL A;  2LV2 A;  2JPA A;  4M9V C;  2DLQ A;  2EM5 A;  1G2D C;  2EE8 A;  2MKD A;  4F6M A;  2YU5 A;  5KL5 A;  2WCC 3;  2EMW A;  1UBD C;  2EOI A;  2EN1 A;  2DLK A;  2LCE A;  1RMD A;  2YSO A;  1A1L A;  4WSG A;  2EM7 A;  1BBO A;  2EPA A;  2EP3 A;  2LT7 A;  2ADR A;  2M9A A;  2YTE A;  2EN6 A;  2YU8 A;  2CSH A;  1G2F C;  2EMY A;  2EM2 A;  1BB8 A;  1WJP A;  2EM6 A;  4GZN C;  2MKN A;  3VHT B;  1DGC A;  2EMC A;  2ELZ A;  2ELY A;  2EOJ A;  2YTJ A;  2DMI A;  1MEY C;  2CT1 A;  2EM8 A;  1P47 A;  3EPK A;  1A1K A;  4R2P A;  2DGC A;  1Z1B A;  2DRP A;  3MHS C;  2WBT A;  3EPH A; 
#chains in the Genus database with same CATH topology
 2GHF A;  2F8B A;  1A1J A;  2YRK A;  4WFT A;  3J80 C;  4LF5 E;  4LF8 E;  2RQL A;  5KL3 A;  3ZOQ B;  4KZS A;  4YY3 E;  2LBS B;  4LU9 A;  4BHC A;  4L8N A;  4FK5 C;  4JI0 E;  4GKK E;  2I9I A;  2E1M A;  3OTO E;  2G7H A;  2VRD A;  2UUB E;  2NA2 A;  3DJW A;  1UIL A;  1ZR9 A;  2EN7 A;  2MC5 A;  2MDG A;  4R2C A;  4R2E A;  4M30 A;  2YSP A;  5IXM B;  3VYX A;  1GQE A;  2HC5 A;  5A6J A;  1SR9 A;  1YYO A;  2EOM A;  4O24 A;  5CFF E;  2YTP A;  4DR5 E;  1XNR E;  4DR7 E;  5LMU E;  4JI6 E;  2NUF A;  1YUJ A;  4RHB B;  2JR1 A;  2YT4 A;  5AAS A;  2RSI A;  2B7T A;  4R2D A;  2L2N A;  1AAY A;  3BF2 A;  4JI5 E;  4DV0 E;  3UK3 C;  2EOE A;  4NXN E;  2JP9 A;  4Q35 B;  1A1G A;  2M4I A;  1EKZ A;  2KOU A;  1YFH A;  2V8Q B;  4WX9 A;  1T4N A;  4R03 A;  4TUI A;  4DUY E;  3TQM A;  4B3R E;  4IJD A;  1A1I A;  1TF3 A;  2EMX A;  2EMG A;  3MHH C;  4DUZ E;  2EML A;  3EPL A;  3KZY A;  1X48 A;  3JTZ A;  4JI4 E;  2EMW A;  2DLK A;  2LUQ A;  3HPZ A;  2EPA A;  2LT7 A;  3ADG A;  1IBL E;  2YU8 A;  4I8O A;  1G2F C;  4LFA E;  2L3J A;  1WJP A;  4B3T E;  3J7Y p;  3ADJ A;  4L5N C;  3VHT B;  2MDR A;  3ADL A;  2EPO A;  3C4T A;  2EOJ A;  3VK6 A;  2DMI A;  4F9C B;  2UUA E;  2LE2 A;  1A1K A;  2MC6 A;  2DRP A;  4F54 A;  4DV2 E;  2N8X A;  2F4V E;  3EPH A;  2A25 A;  4HTG A;  2LJH A;  4BS9 A;  5IV8 B;  2EL6 A;  1WHN A;  4DV1 E;  4YHH E;  2RS7 A;  1XNQ E;  2VQE E;  2DB2 A;  2EMA A;  3DF6 A;  1T38 A;  5AE3 A;  2LMZ A;  2EL5 A;  2IHR 1;  2CPN A;  2EM0 A;  2CTD A;  2JVA A;  2JXP A;  2JY9 A;  3HTX A;  3C6K A;  2HHH E;  2I13 A;  4DKK A;  4DR2 E;  1AH5 A;  2EQ0 A;  2L2M A;  2ODR C;  4X62 E;  4BC9 A;  2K4V A;  3ECR A;  2D9H A;  1DQ3 A;  5LLQ A;  2EMH A;  1LLM C;  1JK1 A;  3J81 C;  2LTR A;  2E5L E;  5IT9 C;  2EM3 A;  2EPP A;  4X8W A;  2ENC A;  5A69 A;  4F9B B;  4BCA A;  4P78 A;  1B69 A;  1YYK A;  4R2R A;  2LTS A;  4R8O A;  2V87 A;  3KZZ A;  2EPU A;  1N34 E;  2ENA A;  5A6K A;  1PJS A;  2EQ1 A;  2RPC A;  1UN6 B;  1WHQ A;  1TN9 A;  2WBS A;  2EMI A;  3F6H A;  5ADZ A;  2YZT A;  4JI7 E;  1KYQ A;  2L8T A;  2EOS A;  2EOR A;  1A1H A;  2JWO A;  5KL4 A;  1IMU A;  2J7J A;  3EQ1 A;  4BC7 A;  1XMQ E;  2LV2 A;  4O43 A;  1G2D C;  4P7D A;  2WZO A;  2B7V A;  2MKD A;  2K7I A;  2EWL A;  2LUP B;  4LF6 E;  1WXR A;  2EOI A;  4DMI A;  1A1L A;  1RMD A;  3HPS A;  5LMN E;  1QU6 A;  2EP3 A;  3IWB A;  3VYY A;  3OML A;  1N32 E;  3AUZ A;  4GZN C;  2R76 A;  4HEI A;  1DGC A;  2EMC A;  2ELZ A;  1HNZ E;  4DV4 E;  2CT1 A;  1MEY C;  1O0W A;  5TSE A;  1RC7 A;  3EPK A;  2DGC A;  1Z1B A;  2WBT A;  2L2K B;  2B9D A;  4NHR A;  1PDA A;  3BGH A;  2EQ3 A;  3KWR A;  4BBY A;  5BR8 E;  4WXC A;  2EN8 A;  5KL2 A;  3T1H E;  2EPX A;  3T1Y E;  1N36 E;  2EMF A;  2GLI A;  2UUC E;  4F2J C;  4M0V A;  4NZV A;  4DV5 E;  4GEQ B;  2EN3 A;  2KON A;  1GZ6 A;  2ENH A;  2LVH A;  2L3C A;  5KL7 A;  4N4R B;  3THN A;  1KJK A;  4F6N A;  2EJ4 A;  2YTD A;  2YTI A;  1ZAA C;  1FKA E;  1HNX E;  2EMB A;  1PJQ A;  2JOX A;  1MGT A;  3M99 B;  2EOO A;  5KL6 A;  4R2S A;  1RQ0 A;  2EN2 A;  2EPC A;  2L6M A;  2LO3 A;  2EZ6 A;  2EPM X;  2EOX A;  2EOY A;  2WBU A;  1WRJ A;  2V89 A;  2N3G A;  2EM9 A;  1YSA C;  1NCS A;  4LFC E;  1NEI A;  4DV3 E;  1YYW A;  5AE1 A;  4JI3 E;  1TF6 A;  2EOH A;  4DR6 E;  5A6B D;  3P1X A;  2UU9 E;  4LF4 E;  2HGH A;  4DR1 E;  3H09 A;  2YTO A;  5AE2 A;  2EOZ A;  4BMJ A;  2DMY A;  2UXD E;  2EM4 A;  2DSY A;  5A6A A;  2YRH A;  3F6G A;  2B3T B;  1J5E E;  1T4O A;  1L4S A;  4B3M E;  2YRM A;  2EPL X;  3RMP A;  3IWD A;  4LF9 E;  4F9A B;  2EPZ A;  3BBG A;  4R2Q A;  4ZYH A;  4ZYE A;  1N33 E;  2UXB E;  4IS1 C;  2EM5 A;  5T6J A;  4JI8 E;  2ZM6 E;  2EE8 A;  3JAM C;  4F6M A;  1J26 A;  2YU5 A;  2WCC 3;  3C4B A;  5A6B A;  4JV5 E;  1UBD C;  1STU A;  2YSO A;  4WSG A;  3MSW A;  4ZYD A;  1BBO A;  3L00 A;  1IBK E;  2ADR A;  2Q8U A;  2M9A A;  2YTE A;  2EN6 A;  2V88 A;  2LRS A;  2EM6 A;  2UXC E;  2MKN A;  1T39 A;  2ELY A;  2L33 A;  2YWQ A;  5FLX C;  2JOB A;  2M7Q A;  2EM8 A;  2RSM A;  2LJU A;  2KHX A;  2FV4 B;  4R2P A;  2L92 A;  3MHS C;  4WXD A;  2V86 A;  1EH6 A;  1SFE A;  1ZBQ A;  2V85 A;  2FTX B;  2EPR A;  1X3C A;  1N3G A;  2R1F A;  3LML A;  2E72 A;  2EMZ A;  4JI1 E;  1EH7 A;  4DV6 E;  2NUG A;  2HJJ A;  2YPN A;  4KWY A;  4X66 E;  2M1S A;  3LLH A;  1BBG A;  1JK2 A;  4B3S E;  4WSP A;  4JI2 E;  4TUG A;  2FGG A;  1X5W A;  2EL4 A;  2NAB A;  2PRT A;  4BHB A;  4OX9 E;  1X47 A;  1ZU1 A;  4J8Z A;  1EH8 A;  4O5G A;  1X6E A;  1HR0 E;  2EOQ A;  2VF1 A;  4DR3 E;  2NUE A;  4R2A A;  1UHZ A;  2YTQ A;  3ADI A;  1F2I G;  1FJG E;  1YUI A;  2EN4 A;  2EPK X;  3C6M A;  2YTG A;  4WYQ B;  1X49 A;  2VQF E;  2BB8 A;  2RS6 A;  3JU0 A;  4LF7 E;  2JYA A;  1T4L B;  5DNY A;  2EOF A;  2EMK A;  3QG5 C;  3EPJ A;  2VE7 C;  1X6F A;  2GPI A;  2N3H A;  4X65 E;  2V83 A;  3AV0 A;  3THO B;  1DI2 A;  4NXM E;  1IQS A;  2ODR D;  2YTF A;  1QNT A;  4ZYG A;  3J7A G;  3K6Q A;  1A1F A;  1GTK A;  3HQ1 A;  4DV7 E;  4X9J A;  1XMO E;  2YTN A;  2BBG A;  3IWC A;  1X6H A;  4K0K E;  4LTY A;  5AC5 A;  2JPA A;  4M9V C;  2DLQ A;  1ZBT A;  4O4K A;  1YPN A;  5IWA E;  2RTX A;  5KL5 A;  1I94 E;  4MLV A;  2EN1 A;  2LCE A;  5F3W A;  2EPN A;  1IBM E;  4KHP E;  4OOG C;  2EM7 A;  4MLQ A;  4GKJ E;  4JYA E;  5LL6 R;  5AC4 A;  4X64 E;  3HXL A;  4RH8 A;  1YZ9 A;  5A2Q C;  2CSH A;  2EMY A;  2EM2 A;  1HNW E;  1BB8 A;  2H36 X;  4M2Z A;  2YTJ A;  3BID A;  2DIX A;  3FIG A;  4LFB E;  1P47 A;  4DR4 E;  4AQY E;  1PKP A;  4WPY A;  1PJT A;  4Q28 A;  1IQO A; 
#chains in the Genus database with same CATH homology
 2A25 A;  2GHF A;  2EL6 A;  2EQ3 A;  2EN8 A;  2EPR A;  1X3C A;  2EPX A;  5KL2 A;  1A1J A;  2YRK A;  2EMF A;  2R1F A;  2GLI A;  4F2J C;  2E72 A;  2EMZ A;  2EMA A;  2EN3 A;  2EL5 A;  5KL3 A;  2EM0 A;  2ENH A;  4FK5 C;  2CTD A;  2LVH A;  5KL7 A;  1KJK A;  4F6N A;  1JK2 A;  2VRD A;  2EJ4 A;  2I13 A;  1ZR9 A;  1X5W A;  2EL4 A;  2EN7 A;  2EQ0 A;  2MDG A;  4R2C A;  2YTD A;  2YTI A;  4R2E A;  2YSP A;  1ZAA C;  2NAB A;  2EMB A;  2PRT A;  3M99 B;  1ZU1 A;  2EOO A;  5KL6 A;  2D9H A;  4R2S A;  2EN2 A;  2EPC A;  2LO3 A;  2EOX A;  2EOY A;  1X6E A;  2WBU A;  2EOM A;  1JK1 A;  2EMH A;  1LLM C;  2EOQ A;  2YTP A;  2EM9 A;  4R2A A;  1NCS A;  1YSA C;  2YTQ A;  1YUJ A;  1F2I G;  1YUI A;  2EM3 A;  2EPP A;  2EN4 A;  2ENC A;  1TF6 A;  2YTG A;  2EOH A;  2RSI A;  1B69 A;  2BB8 A;  4R2D A;  1AAY A;  4R2R A;  2EPU A;  2HGH A;  3UK3 C;  2EOF A;  2EMK A;  3EPJ A;  2YTO A;  2EOE A;  2EOZ A;  2ENA A;  2JP9 A;  2EM4 A;  1X6F A;  2YRH A;  1A1G A;  2EQ1 A;  2RPC A;  1UN6 B;  1TN9 A;  2WBS A;  2EMI A;  2YTF A;  2YRM A;  1A1F A;  2EOS A;  4X9J A;  2EOR A;  2YTN A;  4IJD A;  2EPZ A;  1A1I A;  1TF3 A;  2EMX A;  1X6H A;  1A1H A;  2EMG A;  3MHH C;  5KL4 A;  4R2Q A;  4IS1 C;  2J7J A;  2EML A;  3EPL A;  2LV2 A;  2JPA A;  4M9V C;  2DLQ A;  2EM5 A;  1G2D C;  2EE8 A;  2MKD A;  4F6M A;  2YU5 A;  5KL5 A;  2WCC 3;  2EMW A;  1UBD C;  2EOI A;  2EN1 A;  2DLK A;  2LCE A;  1RMD A;  2YSO A;  1A1L A;  4WSG A;  2EM7 A;  1BBO A;  2EPA A;  2EP3 A;  2LT7 A;  2ADR A;  2M9A A;  2YTE A;  2EN6 A;  2YU8 A;  2CSH A;  1G2F C;  2EMY A;  2EM2 A;  1BB8 A;  1WJP A;  2EM6 A;  4GZN C;  2MKN A;  3VHT B;  1DGC A;  2EMC A;  2ELZ A;  2ELY A;  2EOJ A;  2YTJ A;  2DMI A;  1MEY C;  2CT1 A;  2EM8 A;  1P47 A;  3EPK A;  1A1K A;  4R2P A;  2DGC A;  1Z1B A;  2DRP A;  3MHS C;  2WBT A;  3EPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...