2YRKA

Solution structure of the zf-c2h2 domain in zinc finger homeodomain 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
GSSGSSGGTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger homeobox protein 4
publication title Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4
rcsb
source organism Mus musculus
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yrkA01
2EL6A 2DGCA 2EMKA 2EPPA 1G2FC 1X6HA 2GLIA 2A25A 3MHHC 2DLQA 1YSAC 2EN3A 2VRDA 2LO3A 2ELYA 3EPKA 2JP9A 5KL2A 1RMDA 4R2EA 2YTJA 2EOXA 4FK5C 5KL5A 1WJPA 5KL3A 5KL7A 3M99B 2EM2A 1UBDC 2WBSA 3EPHA 3EPJA 2CSHA 2YRHA 2LV2A 2EMHA 2JPAA 2EOSA 2MDGA 2BB8A 2E72A 4IJDA 1JK1A 1TN9A 2EL5A 1X6FA 2D9HA 2YTIA 2MKDA 2EM4A 1BBOA 2EMIA 4R2PA 4F2JC 4GZNC 1A1LA 2EMXA 2YTPA 2EORA 2DLKA 1B69A 1BB8A 2YTOA 4R2DA 1NCSA 2EMCA 2EPCA 2EQ3A 1TF6A 2EM5A 2YTFA 1A1FA 2GHFA 2EJ4A 1A1IA 2EQ1A 2CTDA 2ELZA 2EMAA 2DRPA 2EE8A 4R2AA 2EN2A 2EM0A 2ENAA 2NABA 4R2RA 2EOQA 1A1HA 2EQ0A 2RSIA 2EN4A 2EOEA 2J7JA 2R1FA 4WSGA 4IS1C 4F6NA 4X9JA 1A1KA 4R2CA 2M9AA 2EOFA 1YUJA 2EPRA 2HGHA 1UN6B 2LT7A 2EPAA 1AAYA 2EN7A 5KL4A 2YTEA 1LLMC 2DMIA 2EM8A 2YTGA 2EM9A 3UK3C 2I13A 1ZU1A 2EOMA 2YRMA 4M9VC 1X3CA 2YSPA 2MKNA 2WBUA 1Z1BA 2EMWA 1A1JA 2EM7A 2LCEA 2WCC3 3EPLA 4R2SA 2EL4A 3VHTB 2EOZA 2EMYA 2EOOA 2ENHA 2EN6A 1KJKA 1MEYC 2YSOA 2EMFA 2EN8A 2LVHA 1DGCA 2EMZA 2EOHA 2EN1A 2YTDA 2YRKA 5KL6A 4R2QA 2ENCA 2EPZA 1P47A 1A1GA 2YTQA 2EOIA 2RPCA 3MHSC 2EM3A 2EOYA 2WBTA 2YU5A 1G2DC 1ZAAC 1X5WA 1X6EA 2PRTA 2ADRA 2EPXA 4F6MA 2EMLA 2EP3A 2EMBA 2EMGA 1TF3A 2YTNA 2CT1A 1YUIA 1F2IG 2EPUA 1JK2A 1ZR9A 2YU8A 2EM6A 2EOJA
chains in the Genus database with same CATH superfamily
2V85A 2DGCA 2EMKA 2EPPA 2LRSA 1G2FC 1X6HA 2GLIA 2A25A 2L2KB 2ZM6E 2V83A 3ADJA 1PKPA 3EPKA 2UUCE 2UXBE 5KL2A 1T38A 4R2EA 2YTJA 4LF9E 5A6BA 2EM2A 1XMQE 1UBDC 4O43A 2HHHE 2EZ6A 2LUPB 1N33E 1TN9A 1I94E 2YTIA 2L2NA 3HXLA 3JTZA 2EMIA 2RS6A 4GZNC 4WXCA 1A1LA 5DNYA 3J80C 4WXDA 1BB8A 5A6JA 2EPCA 2MC6A 1TF6A 5A6KA 2EM5A 4RH8A 2EJ4A 2YPNA 2VF1A 3F6HA 5A6BD 1T39A 4R2AA 5IV8B 2L8TA 2KOUA 3JAMC 5AC4A 2B3TB 2NA2A 3HPZA 1YZ9A 5A2QC 2DB2A 3BIDA 2RSIA 2EN4A 2R1FA 4O5GA 4M30A 2RSMA 2HGHA 1IQOA 2V87A 4LTYA 3J7Yp 5KL4A 2YTEA 4DKKA 2G7HA 3UK3C 3MSWA 4DV5E 5CFFE 2FTXB 2LCEA 4LFAE 2WCC3 2L6MA 1PJTA 4R2SA 1EH7A 2BBGA 3ADGA 4DV0E 2EOOA 2ENHA 4ZYGA 1KJKA 2VQEE 4WFTA 2IHR1 3ADIA 1UILA 1ZBQA 2YTDA 1GZ6A 3ADLA 2YZTA 3LMLA 3C4TA 4R2QA 4OX9E 2EPMX 1STUA 2YTQA 2RPCA 2EOYA 3LLHA 2MC5A 1PDAA 1ZAAC 4O4KA 1X5WA 2PRTA 2ADRA 1TF3A 2EMGA 2CT1A 4X64E 2L33A 3VYYA 2F8BA 4DV4E 1WRJA 1KYQA 2JOXA 4JI0E 1IBKE 2EOXA 3AUZA 2V89A 1AH5A 2JY9A 4JI5E 2WBSA 3EPHA 4WSPA 2M4IA 2CSHA 1GQEA 3JU0A 2EMHA 5A6AA 2BB8A 4HTGA 3BF2A 1N34E 2NUEA 4LU9A 4DR6E 5LLQA 2EMXA 4MLVA 2EORA 4X66E 4Q35B 1WXRA 4HEIA 2M1SA 2GHFA 1T4LB 1A1IA 1SFEA 2EQ1A 4DR3E 4YHHE 2CTDA 2EMAA 4MLQA 4B3SE 1XNRE 2ENAA 4F9CB 1T4OA 4F6NA 2J7JA 2N3HA 2M9AA 2Q8UA 2EOFA 1YUJA 2UUBE 4BBYA 4JI1E 3HPSA 2EPAA 5ADZA 1AAYA 1J5EE 4OOGC 1ZU1A 2YRMA 4M9VC 1X3CA 4LF5E 2UUAE 1QNTA 1ZBTA 1Z1BA 2EMWA 2JYAA 2K4VA 2EL4A 4L5NC 5LMUE 3K6QA 1X47A 2EN6A 1XNQE 1XMOE 5AE1A 4JI4E 2JVAA 1HR0E 4TUGA 2EMZA 3L00A 2EOHA 4B3TE 2EN1A 4NHRA 4BC9A 5AC5A 4LF7E 3IWBA 4DR7E 4F9BB 1YPNA 2V8QB 5T6JA 2EOIA 1P47A 2YU5A 2M7QA 4ZYEA 4NXNE 1X49A 3VK6A 5IWAE 2EMLA 4F9AB 3BGHA 1YYOA 1PJSA 2EPUA 4JV5E 4N4RB 2LTRA 2EM6A 2YSOA 2FV4B 2LJUA 2ODRC 1L4SA 3MHHC 1YSAC 2VRDA 5IXMB 2LO3A 4K0KE 3P1XA 1PJQA 4FK5C 4DV7E 4DR4E 5KL7A 2LBSB 3M99B 1N32E 4GEQB 4LF4E 2YRHA 2LV2A 2JPAA 2EOSA 1JK1A 2EL5A 4J8ZA 3F6GA 2D9HA 5A69A 2L2MA 2LUQA 1YFHA 2MKDA 2UXCE 4WPYA 1BBOA 1YYKA 4AQYE 4KHPE 2LJHA 4F2JC 3C6KA 1FJGE 2YTPA 2N8XA 2N3GA 2YTOA 3THNA 3ZOQB 5BR8E 4LF6E 1GTKA 2EPOA 4LF8E 1EH6A 1J26A 2YTFA 1BBGA 5TSEA 3T1YE 2JWOA 4DR5E 1EH8A 4WYQB 3HTXA 3H09A 3TQMA 2ELZA 5LMNE 5IT9C 3AV0A 2EPKX 1WHQA 3HQ1A 1SR9A 2NABA 4R2RA 4JYAE 4IS1C 2EOEA 4WSGA 3C6MA 1A1KA 4R2CA 2EPRA 2LT7A 4DMIA 2K7IA 3DF6A 2F4VE 2L3CA 2YTGA 2EM9A 2NUFA 1QU6A 2EOMA 2DIXA 2LTSA 2WBUA 4JI3E 1A1JA 2UU9E 2EM7A 2KONA 2V88A 4DV2E 3IWDA 3VHTB 2EOZA 4BCAA 3DJWA 1MEYC 4B3RE 4ZYHA 4KWYA 2EMFA 4KZSA 5AE3A 1IBME 2YRKA 4JI6E 4GKJE 2ENCA 2NUGA 2RTXA 3OMLA 2EM3A 2WBTA 1G2DC 5FLXC 1X6EA 4DV6E 1X48A 2EPXA 2YTNA 1HNZE 2DSYA 2VQFE 4DR2E 2YU8A 1UN6B 2EL6A 2V86A 1DQ3A 2DMYA 2DLQA 2EN3A 2ELYA 5AASA 4DV1E 2JP9A 1RMDA 2WZOA 4O24A 5KL5A 1WJPA 5KL3A 1N3GA 4DV3E 1RC7A 3IWCA 3EPJA 3KZZA 2L3JA 2MDGA 4IJDA 2E72A 4B3ME 3J7AG 3OTOE 1X6FA 1YYWA 2L92A 3KWRA 2UXDE 2EM4A 4R2PA 2LMZA 4X65E 4LFCE 2I9IA 4Q28A 4BMJA 2DLKA 4TUIA 4ZYDA 1B69A 3VYXA 4R2DA 5F3WA 1NCSA 2EMCA 2EQ3A 2ODRD 1N36E 4R8OA 1IBLE 1A1FA 4BHBA 2MDRA 1IMUA 3EQ1A 2EWLA 2B9DA 2E1MA 2DRPA 2YT4A 2EE8A 4L8NA 1T4NA 2EN2A 2B7TA 4NZVA 2EM0A 4DR1E 2KHXA 2EOQA 1A1HA 2VE7C 4M0VA 2EQ0A 1EKZA 3QG5C 1RQ0A 4X9JA 1UHZA 3KZYA 2CPNA 2FGGA 2GPIA 3BBGA 4X62E 2EN7A 4JI8E 4NXME 2JR1A 1LLMC 2DMIA 2EM8A 5AE2A 2I13A 3C4BA 2MKNA 2YSPA 4LFBE 1MGTA 3RMPA 4JI2E 1FKAE 2B7VA 1WHNA 4F54A 4DUZE 4YY3E 2JXPA 2RQLA 4GKKE 3EPLA 4BC7A 4P78A 1NEIA 2YWQA 1HNWE 2HC5A 2EMYA 3FIGA 2JOBA 2RS7A 2EPNA 3J81C 1O0WA 3ECRA 4RHBB 2EN8A 4BHCA 2LVHA 1DGCA 1HNXE 4R03A 4WX9A 2H36X 2E5LE 3THOB 4X8WA 4M2ZA 5KL6A 2EPZA 4P7DA 2EPLX 1A1GA 4BS9A 3MHSC 2R76A 3T1HE 2LE2A 4JI7E 5LL6R 1IQSA 2HJJA 4F6MA 4I8OA 2EP3A 2EMBA 1DI2A 1YUIA 1F2IG 4DUYE 1JK2A 1ZR9A 2EOJA
chains in the Genus database with same CATH topology
2EL6A 2DGCA 2EMKA 2EPPA 1G2FC 1X6HA 2GLIA 2A25A 3MHHC 2DLQA 1YSAC 2EN3A 2VRDA 2LO3A 2ELYA 3EPKA 2JP9A 5KL2A 1RMDA 4R2EA 2YTJA 2EOXA 4FK5C 5KL5A 1WJPA 5KL3A 5KL7A 3M99B 2EM2A 1UBDC 2WBSA 3EPHA 3EPJA 2CSHA 2YRHA 2LV2A 2EMHA 2JPAA 2EOSA 2MDGA 2BB8A 2E72A 4IJDA 1JK1A 1TN9A 2EL5A 1X6FA 2D9HA 2YTIA 2MKDA 2EM4A 1BBOA 2EMIA 4R2PA 4F2JC 4GZNC 1A1LA 2EMXA 2YTPA 2EORA 2DLKA 1B69A 1BB8A 2YTOA 4R2DA 1NCSA 2EMCA 2EPCA 2EQ3A 1TF6A 2EM5A 2YTFA 1A1FA 2GHFA 2EJ4A 1A1IA 2EQ1A 2CTDA 2ELZA 2EMAA 2DRPA 2EE8A 4R2AA 2EN2A 2EM0A 2ENAA 2NABA 4R2RA 2EOQA 1A1HA 2EQ0A 2RSIA 2EN4A 2EOEA 2J7JA 2R1FA 4WSGA 4IS1C 4F6NA 4X9JA 1A1KA 4R2CA 2M9AA 2EOFA 1YUJA 2EPRA 2HGHA 1UN6B 2LT7A 2EPAA 1AAYA 2EN7A 5KL4A 2YTEA 1LLMC 2DMIA 2EM8A 2YTGA 2EM9A 3UK3C 2I13A 1ZU1A 2EOMA 2YRMA 4M9VC 1X3CA 2YSPA 2MKNA 2WBUA 1Z1BA 2EMWA 1A1JA 2EM7A 2LCEA 2WCC3 3EPLA 4R2SA 2EL4A 3VHTB 2EOZA 2EMYA 2EOOA 2ENHA 2EN6A 1KJKA 1MEYC 2YSOA 2EMFA 2EN8A 2LVHA 1DGCA 2EMZA 2EOHA 2EN1A 2YTDA 2YRKA 5KL6A 4R2QA 2ENCA 2EPZA 1P47A 1A1GA 2YTQA 2EOIA 2RPCA 3MHSC 2EM3A 2EOYA 2WBTA 2YU5A 1G2DC 1ZAAC 1X5WA 1X6EA 2PRTA 2ADRA 2EPXA 4F6MA 2EMLA 2EP3A 2EMBA 2EMGA 1TF3A 2YTNA 2CT1A 1YUIA 1F2IG 2EPUA 1JK2A 1ZR9A 2YU8A 2EM6A 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL6 A;  2DGC A;  2EMK A;  2EPP A;  1G2F C;  1X6H A;  2GLI A;  2A25 A;  3MHH C;  2DLQ A;  1YSA C;  2EN3 A;  2VRD A;  2LO3 A;  2ELY A;  3EPK A;  2JP9 A;  5KL2 A;  1RMD A;  4R2E A;  2YTJ A;  2EOX A;  4FK5 C;  5KL5 A;  1WJP A;  5KL3 A;  5KL7 A;  3M99 B;  2EM2 A;  1UBD C;  2WBS A;  3EPH A;  3EPJ A;  2CSH A;  2YRH A;  2LV2 A;  2EMH A;  2JPA A;  2EOS A;  2MDG A;  2BB8 A;  2E72 A;  4IJD A;  1JK1 A;  1TN9 A;  2EL5 A;  1X6F A;  2D9H A;  2YTI A;  2MKD A;  2EM4 A;  1BBO A;  2EMI A;  4R2P A;  4F2J C;  4GZN C;  1A1L A;  2EMX A;  2YTP A;  2EOR A;  2DLK A;  1B69 A;  1BB8 A;  2YTO A;  4R2D A;  1NCS A;  2EMC A;  2EPC A;  2EQ3 A;  1TF6 A;  2EM5 A;  2YTF A;  1A1F A;  2GHF A;  2EJ4 A;  1A1I A;  2EQ1 A;  2CTD A;  2ELZ A;  2EMA A;  2DRP A;  2EE8 A;  4R2A A;  2EN2 A;  2EM0 A;  2ENA A;  2NAB A;  4R2R A;  2EOQ A;  1A1H A;  2EQ0 A;  2RSI A;  2EN4 A;  2EOE A;  2J7J A;  2R1F A;  4WSG A;  4IS1 C;  4F6N A;  4X9J A;  1A1K A;  4R2C A;  2M9A A;  2EOF A;  1YUJ A;  2EPR A;  2HGH A;  1UN6 B;  2LT7 A;  2EPA A;  1AAY A;  2EN7 A;  5KL4 A;  2YTE A;  1LLM C;  2DMI A;  2EM8 A;  2YTG A;  2EM9 A;  3UK3 C;  2I13 A;  1ZU1 A;  2EOM A;  2YRM A;  4M9V C;  1X3C A;  2YSP A;  2MKN A;  2WBU A;  1Z1B A;  2EMW A;  1A1J A;  2EM7 A;  2LCE A;  2WCC 3;  3EPL A;  4R2S A;  2EL4 A;  3VHT B;  2EOZ A;  2EMY A;  2EOO A;  2ENH A;  2EN6 A;  1KJK A;  1MEY C;  2YSO A;  2EMF A;  2EN8 A;  2LVH A;  1DGC A;  2EMZ A;  2EOH A;  2EN1 A;  2YTD A;  2YRK A;  5KL6 A;  4R2Q A;  2ENC A;  2EPZ A;  1P47 A;  1A1G A;  2YTQ A;  2EOI A;  2RPC A;  3MHS C;  2EM3 A;  2EOY A;  2WBT A;  2YU5 A;  1G2D C;  1ZAA C;  1X5W A;  1X6E A;  2PRT A;  2ADR A;  2EPX A;  4F6M A;  2EML A;  2EP3 A;  2EMB A;  2EMG A;  1TF3 A;  2YTN A;  2CT1 A;  1YUI A;  1F2I G;  2EPU A;  1JK2 A;  1ZR9 A;  2YU8 A;  2EM6 A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 2V85 A;  2DGC A;  2EMK A;  2EPP A;  2LRS A;  1G2F C;  1X6H A;  2GLI A;  2A25 A;  2L2K B;  2ZM6 E;  2V83 A;  3ADJ A;  1PKP A;  3EPK A;  2UUC E;  2UXB E;  5KL2 A;  1T38 A;  4R2E A;  2YTJ A;  4LF9 E;  5A6B A;  2EM2 A;  1XMQ E;  1UBD C;  4O43 A;  2HHH E;  2EZ6 A;  2LUP B;  1N33 E;  1TN9 A;  1I94 E;  2YTI A;  2L2N A;  3HXL A;  3JTZ A;  2EMI A;  2RS6 A;  4GZN C;  4WXC A;  1A1L A;  5DNY A;  3J80 C;  4WXD A;  1BB8 A;  5A6J A;  2EPC A;  2MC6 A;  1TF6 A;  5A6K A;  2EM5 A;  4RH8 A;  2EJ4 A;  2YPN A;  2VF1 A;  3F6H A;  5A6B D;  1T39 A;  4R2A A;  5IV8 B;  2L8T A;  2KOU A;  3JAM C;  5AC4 A;  2B3T B;  2NA2 A;  3HPZ A;  1YZ9 A;  5A2Q C;  2DB2 A;  3BID A;  2RSI A;  2EN4 A;  2R1F A;  4O5G A;  4M30 A;  2RSM A;  2HGH A;  1IQO A;  2V87 A;  4LTY A;  3J7Y p;  5KL4 A;  2YTE A;  4DKK A;  2G7H A;  3UK3 C;  3MSW A;  4DV5 E;  5CFF E;  2FTX B;  2LCE A;  4LFA E;  2WCC 3;  2L6M A;  1PJT A;  4R2S A;  1EH7 A;  2BBG A;  3ADG A;  4DV0 E;  2EOO A;  2ENH A;  4ZYG A;  1KJK A;  2VQE E;  4WFT A;  2IHR 1;  3ADI A;  1UIL A;  1ZBQ A;  2YTD A;  1GZ6 A;  3ADL A;  2YZT A;  3LML A;  3C4T A;  4R2Q A;  4OX9 E;  2EPM X;  1STU A;  2YTQ A;  2RPC A;  2EOY A;  3LLH A;  2MC5 A;  1PDA A;  1ZAA C;  4O4K A;  1X5W A;  2PRT A;  2ADR A;  1TF3 A;  2EMG A;  2CT1 A;  4X64 E;  2L33 A;  3VYY A;  2F8B A;  4DV4 E;  1WRJ A;  1KYQ A;  2JOX A;  4JI0 E;  1IBK E;  2EOX A;  3AUZ A;  2V89 A;  1AH5 A;  2JY9 A;  4JI5 E;  2WBS A;  3EPH A;  4WSP A;  2M4I A;  2CSH A;  1GQE A;  3JU0 A;  2EMH A;  5A6A A;  2BB8 A;  4HTG A;  3BF2 A;  1N34 E;  2NUE A;  4LU9 A;  4DR6 E;  5LLQ A;  2EMX A;  4MLV A;  2EOR A;  4X66 E;  4Q35 B;  1WXR A;  4HEI A;  2M1S A;  2GHF A;  1T4L B;  1A1I A;  1SFE A;  2EQ1 A;  4DR3 E;  4YHH E;  2CTD A;  2EMA A;  4MLQ A;  4B3S E;  1XNR E;  2ENA A;  4F9C B;  1T4O A;  4F6N A;  2J7J A;  2N3H A;  2M9A A;  2Q8U A;  2EOF A;  1YUJ A;  2UUB E;  4BBY A;  4JI1 E;  3HPS A;  2EPA A;  5ADZ A;  1AAY A;  1J5E E;  4OOG C;  1ZU1 A;  2YRM A;  4M9V C;  1X3C A;  4LF5 E;  2UUA E;  1QNT A;  1ZBT A;  1Z1B A;  2EMW A;  2JYA A;  2K4V A;  2EL4 A;  4L5N C;  5LMU E;  3K6Q A;  1X47 A;  2EN6 A;  1XNQ E;  1XMO E;  5AE1 A;  4JI4 E;  2JVA A;  1HR0 E;  4TUG A;  2EMZ A;  3L00 A;  2EOH A;  4B3T E;  2EN1 A;  4NHR A;  4BC9 A;  5AC5 A;  4LF7 E;  3IWB A;  4DR7 E;  4F9B B;  1YPN A;  2V8Q B;  5T6J A;  2EOI A;  1P47 A;  2YU5 A;  2M7Q A;  4ZYE A;  4NXN E;  1X49 A;  3VK6 A;  5IWA E;  2EML A;  4F9A B;  3BGH A;  1YYO A;  1PJS A;  2EPU A;  4JV5 E;  4N4R B;  2LTR A;  2EM6 A;  2YSO A;  2FV4 B;  2LJU A;  2ODR C;  1L4S A;  3MHH C;  1YSA C;  2VRD A;  5IXM B;  2LO3 A;  4K0K E;  3P1X A;  1PJQ A;  4FK5 C;  4DV7 E;  4DR4 E;  5KL7 A;  2LBS B;  3M99 B;  1N32 E;  4GEQ B;  4LF4 E;  2YRH A;  2LV2 A;  2JPA A;  2EOS A;  1JK1 A;  2EL5 A;  4J8Z A;  3F6G A;  2D9H A;  5A69 A;  2L2M A;  2LUQ A;  1YFH A;  2MKD A;  2UXC E;  4WPY A;  1BBO A;  1YYK A;  4AQY E;  4KHP E;  2LJH A;  4F2J C;  3C6K A;  1FJG E;  2YTP A;  2N8X A;  2N3G A;  2YTO A;  3THN A;  3ZOQ B;  5BR8 E;  4LF6 E;  1GTK A;  2EPO A;  4LF8 E;  1EH6 A;  1J26 A;  2YTF A;  1BBG A;  5TSE A;  3T1Y E;  2JWO A;  4DR5 E;  1EH8 A;  4WYQ B;  3HTX A;  3H09 A;  3TQM A;  2ELZ A;  5LMN E;  5IT9 C;  3AV0 A;  2EPK X;  1WHQ A;  3HQ1 A;  1SR9 A;  2NAB A;  4R2R A;  4JYA E;  4IS1 C;  2EOE A;  4WSG A;  3C6M A;  1A1K A;  4R2C A;  2EPR A;  2LT7 A;  4DMI A;  2K7I A;  3DF6 A;  2F4V E;  2L3C A;  2YTG A;  2EM9 A;  2NUF A;  1QU6 A;  2EOM A;  2DIX A;  2LTS A;  2WBU A;  4JI3 E;  1A1J A;  2UU9 E;  2EM7 A;  2KON A;  2V88 A;  4DV2 E;  3IWD A;  3VHT B;  2EOZ A;  4BCA A;  3DJW A;  1MEY C;  4B3R E;  4ZYH A;  4KWY A;  2EMF A;  4KZS A;  5AE3 A;  1IBM E;  2YRK A;  4JI6 E;  4GKJ E;  2ENC A;  2NUG A;  2RTX A;  3OML A;  2EM3 A;  2WBT A;  1G2D C;  5FLX C;  1X6E A;  4DV6 E;  1X48 A;  2EPX A;  2YTN A;  1HNZ E;  2DSY A;  2VQF E;  4DR2 E;  2YU8 A;  1UN6 B;  2EL6 A;  2V86 A;  1DQ3 A;  2DMY A;  2DLQ A;  2EN3 A;  2ELY A;  5AAS A;  4DV1 E;  2JP9 A;  1RMD A;  2WZO A;  4O24 A;  5KL5 A;  1WJP A;  5KL3 A;  1N3G A;  4DV3 E;  1RC7 A;  3IWC A;  3EPJ A;  3KZZ A;  2L3J A;  2MDG A;  4IJD A;  2E72 A;  4B3M E;  3J7A G;  3OTO E;  1X6F A;  1YYW A;  2L92 A;  3KWR A;  2UXD E;  2EM4 A;  4R2P A;  2LMZ A;  4X65 E;  4LFC E;  2I9I A;  4Q28 A;  4BMJ A;  2DLK A;  4TUI A;  4ZYD A;  1B69 A;  3VYX A;  4R2D A;  5F3W A;  1NCS A;  2EMC A;  2EQ3 A;  2ODR D;  1N36 E;  4R8O A;  1IBL E;  1A1F A;  4BHB A;  2MDR A;  1IMU A;  3EQ1 A;  2EWL A;  2B9D A;  2E1M A;  2DRP A;  2YT4 A;  2EE8 A;  4L8N A;  1T4N A;  2EN2 A;  2B7T A;  4NZV A;  2EM0 A;  4DR1 E;  2KHX A;  2EOQ A;  1A1H A;  2VE7 C;  4M0V A;  2EQ0 A;  1EKZ A;  3QG5 C;  1RQ0 A;  4X9J A;  1UHZ A;  3KZY A;  2CPN A;  2FGG A;  2GPI A;  3BBG A;  4X62 E;  2EN7 A;  4JI8 E;  4NXM E;  2JR1 A;  1LLM C;  2DMI A;  2EM8 A;  5AE2 A;  2I13 A;  3C4B A;  2MKN A;  2YSP A;  4LFB E;  1MGT A;  3RMP A;  4JI2 E;  1FKA E;  2B7V A;  1WHN A;  4F54 A;  4DUZ E;  4YY3 E;  2JXP A;  2RQL A;  4GKK E;  3EPL A;  4BC7 A;  4P78 A;  1NEI A;  2YWQ A;  1HNW E;  2HC5 A;  2EMY A;  3FIG A;  2JOB A;  2RS7 A;  2EPN A;  3J81 C;  1O0W A;  3ECR A;  4RHB B;  2EN8 A;  4BHC A;  2LVH A;  1DGC A;  1HNX E;  4R03 A;  4WX9 A;  2H36 X;  2E5L E;  3THO B;  4X8W A;  4M2Z A;  5KL6 A;  2EPZ A;  4P7D A;  2EPL X;  1A1G A;  4BS9 A;  3MHS C;  2R76 A;  3T1H E;  2LE2 A;  4JI7 E;  5LL6 R;  1IQS A;  2HJJ A;  4F6M A;  4I8O A;  2EP3 A;  2EMB A;  1DI2 A;  1YUI A;  1F2I G;  4DUY E;  1JK2 A;  1ZR9 A;  2EOJ A; 
#chains in the Genus database with same CATH homology
 2EL6 A;  2DGC A;  2EMK A;  2EPP A;  1G2F C;  1X6H A;  2GLI A;  2A25 A;  3MHH C;  2DLQ A;  1YSA C;  2EN3 A;  2VRD A;  2LO3 A;  2ELY A;  3EPK A;  2JP9 A;  5KL2 A;  1RMD A;  4R2E A;  2YTJ A;  2EOX A;  4FK5 C;  5KL5 A;  1WJP A;  5KL3 A;  5KL7 A;  3M99 B;  2EM2 A;  1UBD C;  2WBS A;  3EPH A;  3EPJ A;  2CSH A;  2YRH A;  2LV2 A;  2EMH A;  2JPA A;  2EOS A;  2MDG A;  2BB8 A;  2E72 A;  4IJD A;  1JK1 A;  1TN9 A;  2EL5 A;  1X6F A;  2D9H A;  2YTI A;  2MKD A;  2EM4 A;  1BBO A;  2EMI A;  4R2P A;  4F2J C;  4GZN C;  1A1L A;  2EMX A;  2YTP A;  2EOR A;  2DLK A;  1B69 A;  1BB8 A;  2YTO A;  4R2D A;  1NCS A;  2EMC A;  2EPC A;  2EQ3 A;  1TF6 A;  2EM5 A;  2YTF A;  1A1F A;  2GHF A;  2EJ4 A;  1A1I A;  2EQ1 A;  2CTD A;  2ELZ A;  2EMA A;  2DRP A;  2EE8 A;  4R2A A;  2EN2 A;  2EM0 A;  2ENA A;  2NAB A;  4R2R A;  2EOQ A;  1A1H A;  2EQ0 A;  2RSI A;  2EN4 A;  2EOE A;  2J7J A;  2R1F A;  4WSG A;  4IS1 C;  4F6N A;  4X9J A;  1A1K A;  4R2C A;  2M9A A;  2EOF A;  1YUJ A;  2EPR A;  2HGH A;  1UN6 B;  2LT7 A;  2EPA A;  1AAY A;  2EN7 A;  5KL4 A;  2YTE A;  1LLM C;  2DMI A;  2EM8 A;  2YTG A;  2EM9 A;  3UK3 C;  2I13 A;  1ZU1 A;  2EOM A;  2YRM A;  4M9V C;  1X3C A;  2YSP A;  2MKN A;  2WBU A;  1Z1B A;  2EMW A;  1A1J A;  2EM7 A;  2LCE A;  2WCC 3;  3EPL A;  4R2S A;  2EL4 A;  3VHT B;  2EOZ A;  2EMY A;  2EOO A;  2ENH A;  2EN6 A;  1KJK A;  1MEY C;  2YSO A;  2EMF A;  2EN8 A;  2LVH A;  1DGC A;  2EMZ A;  2EOH A;  2EN1 A;  2YTD A;  2YRK A;  5KL6 A;  4R2Q A;  2ENC A;  2EPZ A;  1P47 A;  1A1G A;  2YTQ A;  2EOI A;  2RPC A;  3MHS C;  2EM3 A;  2EOY A;  2WBT A;  2YU5 A;  1G2D C;  1ZAA C;  1X5W A;  1X6E A;  2PRT A;  2ADR A;  2EPX A;  4F6M A;  2EML A;  2EP3 A;  2EMB A;  2EMG A;  1TF3 A;  2YTN A;  2CT1 A;  1YUI A;  1F2I G;  2EPU A;  1JK2 A;  1ZR9 A;  2YU8 A;  2EM6 A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...