2YRKA

Solution structure of the zf-c2h2 domain in zinc finger homeodomain 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
55
structure length
55
Chain Sequence
b'GSSGSSGGTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger homeobox protein 4
publication title Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 6
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2yrkA01
3UK3C 3EPKA 1NCSA 2EOXA 2ELYA 2ADRA 2WBSA 4R2PA 2LT7A 2YTEA 2YTJA 3M99B 2YTNA 2YTGA 2EOMA 1A1JA 2EMIA 5KL2A 5KL5A 5KL6A 2EMWA 2YSPA 1ZR9A 1X3CA 4F6MA 1A1FA 1F2IG 1A1KA 2EN2A 2EM8A 2ENHA 2EQ0A 4F6NA 2HGHA 1WJPA 2EPZA 2EN6A 2EL5A 2BB8A 1YSAC 2EL6A 2EE8A 2EOQA 3EPLA 2JPAA 2EN4A 1TF6A 2EMLA 2EM6A 2EMZA 2EMHA 2EMKA 2EN1A 2VRDA 2YTQA 1B69A 2M9AA 2LO3A 5KL3A 1BBOA 2EOYA 2R1FA 1UBDC 1ZU1A 4M9VC 3MHSC 2YRHA 1Z1BA 2CT1A 2A25A 2LCEA 2YU8A 2YU5A 1RMDA 1G2DC 2RSIA 2MDGA 1DGCA 2EOSA 1X6EA 4R2SA 2EOHA 1G2FC 2EN8A 2MKDA 2EN7A 2GHFA 4R2CA 2LV2A 2EMCA 2EORA 1YUJA 2J7JA 1KJKA 2EM7A 2EM0A 2EM2A 2EP3A 1JK1A 2EL4A 4R2QA 4R2DA 1A1IA 3EPHA 2ELZA 2DLKA 1YUIA 1X6FA 2YSOA 1A1GA 1X6HA 2EM3A 2EPCA 2EMAA 4X9JA 1TF3A 2EPRA 2EQ3A 2CTDA 2YTOA 1TN9A 2DLQA 1MEYC 2YTPA 1P47A 1JK2A 1LLMC 2EPAA 1BB8A 2EPXA 2DMIA 2EPPA 2LVHA 2YRMA 2EM5A 5KL7A 2ENAA 2EPUA 4IS1C 2EMYA 5KL4A 2EJ4A 2EN3A 3EPJA 2DRPA 2I13A 2CSHA 4F2JC 4R2RA 1A1LA 2EQ1A 1X5WA 2EOZA 1AAYA 2GLIA 1A1HA 1UN6B 2E72A 4IJDA 2PRTA 4GZNC 2EOEA 2YTIA 2DGCA 2EMBA 2JP9A 2EOIA 2WBTA 2EM9A 4R2EA 2ENCA 4FK5C 2WBUA 2YTFA 2EM4A 2D9HA 4WSGA 2EOOA 2EMXA 2MKNA 3VHTB 2WCC3 2EMFA 2EMGA 2EOFA 2RPCA 2EOJA 2YTDA 2NABA 1ZAAC 4R2AA 2YRKA 3MHHC
chains in the Genus database with same CATH superfamily
1WHNA 2DB2A 1FKAE 5A69A 5LL6R 3M99B 2UXDE 2EOMA 4LFCE 2IHR1 3HPZA 2B7TA 4MLQA 5KL2A 3J81C 5KL5A 3F6HA 5F3WA 2EMWA 4DR2E 2N8XA 4F6MA 1A1FA 2L2KB 2N3GA 2ENHA 4F6NA 5AASA 4R8OA 2HGHA 1XMQE 4BC9A 2EN4A 5DNYA 1NEIA 2EM6A 1DI2A 4N4RB 2M9AA 2LO3A 4KHPE 1N36E 3JTZA 2LTSA 2R1FA 4KWYA 1XMOE 3ADIA 1UBDC 3MHSC 4R03A 5BR8E 4DKKA 4B3SE 2ZM6E 2FV4B 2EOHA 2NUEA 2MKDA 5IT9C 1IQOA 2YPNA 2N3HA 4HEIA 2LTRA 4X8WA 4DV6E 5AE2A 1JK1A 2JY9A 1O0WA 2Q8UA 3IWDA 4DV1E 5IV8B 2JOXA 3EPHA 2LE2A 5TSEA 2E5LE 1WXRA 4DV2E 3C6KA 1HNXE 3KZYA 2CPNA 4OOGC 2CTDA 2L2MA 1TN9A 4L8NA 4DMIA 2YTPA 4DUZE 2KONA 4JI5E 1BB8A 3JU0A 4JI0E 4WPYA 4JV5E 2BBGA 4B3TE 3ADJA 2R76A 1X47A 2ENAA 4DR7E 5A2QC 1QNTA 2CSHA 1WHQA 4LF5E 2EQ1A 1AAYA 1QU6A 2VQFE 2EPOA 1YZ9A 2YTIA 2VQEE 2JP9A 4OX9E 4JI2E 1FJGE 2ENCA 4FK5C 3RMPA 2YTFA 1T4OA 2D9HA 2EOFA 3KWRA 5LMUE 4LF8E 3BGHA 3UK3C 4AQYE 4NXNE 2EZ6A 2ADRA 2M7QA 4R2PA 5A6KA 3C4BA 2B7VA 4GKJE 4DR4E 2NA2A 2H36X 1PJTA 2EPLX 1F2IG 3BIDA 2EN2A 2EM8A 4F54A 1GTKA 2KOUA 3C6MA 1WJPA 2EPZA 2JXPA 2LJUA 1YSAC 3EPLA 2M1SA 2JPAA 1TF6A 1YYKA 2EPMX 4TUIA 2VRDA 2NUGA 1YYWA 4ZYEA 4X65E 2GPIA 4P78A 2I9IA 4M9VC 1PJSA 1SFEA 2YRHA 4ZYDA 1EKZA 4Q28A 2YU8A 3L00A 2LCEA 2V8QB 2YT4A 4JI7E 3VK6A 4BS9A 1PDAA 1RMDA 4LTYA 1RC7A 3J80C 1RQ0A 1ZBTA 2RSIA 4L5NC 4ZYGA 2EOSA 1X6EA 1G2FC 2EN8A 1HNZE 1XNRE 3OMLA 3THOB 2LV2A 2EORA 2UU9E 2J7JA 1KJKA 4J8ZA 1J5EE 3ADLA 2EM0A 5IXMB 2EP3A 5CFFE 2DLKA 1X6FA 4X64E 4DUYE 2F4VE 2EMAA 2V87A 5AC5A 4F9BB 3IWBA 4X66E 4X9JA 3LLHA 2LBSB 2YTOA 4NHRA 1MEYC 1WRJA 4LU9A 1P47A 4NZVA 3THNA 1JK2A 1LLMC 2L92A 2F8BA 4O5GA 2K7IA 3HTXA 2EPXA 2EM5A 2EPUA 4IS1C 1T39A 2EJ4A 4GEQB 5A6AA 4GKKE 3C4TA 2V83A 2EOZA 2L3JA 2GLIA 1EH6A 2E72A 2DIXA 2LMZA 4BCAA 4GZNC 2DGCA 4DV5E 2EOIA 1YPNA 4BHCA 2WBTA 2MDRA 4ZYHA 5AC4A 1DQ3A 5LLQA 2UXCE 2M4IA 2WBUA 4JI8E 2EOOA 3OTOE 2MKNA 3VHTB 2WCC3 2E1MA 1N33E 2LRSA 2YTDA 4WSPA 1ZAAC 3H09A 2L3CA 1SR9A 2RS7A 3IWCA 1NCSA 2EOXA 4JI6E 4M0VA 1XNQE 2FGGA 2WZOA 2LT7A 2YTEA 2YTJA 2YTNA 2YTGA 4M2ZA 1UILA 3TQMA 2MC6A 2EMIA 1X49A 3K6QA 5KL6A 4DR5E 1ZR9A 3LMLA 1X48A 4X62E 4Q35B 3AV0A 4BBYA 4DV7E 4WXDA 4WXCA 2EL5A 2BB8A 1T4LB 2EE8A 2EOQA 2EPKX 2UUBE 2HC5A 1PJQA 2L2NA 3VYYA 4DR3E 2EMLA 1YYOA 2YTQA 2EMHA 2EMKA 4O43A 5IWAE 1B69A 3EQ1A 2ODRC 4HTGA 1EH8A 1ZU1A 4YHHE 3ADGA 3F6GA 2A25A 1N32E 1IMUA 1GQEA 4DV0E 4R2CA 5A6JA 2KHXA 1YUJA 2EM7A 4LFBE 3AUZA 4WYQB 2EM2A 3MSWA 2EL4A 4R2DA 2ELZA 1YUIA 5ADZA 2JWOA 1T38A 1X6HA 1IBME 2DSYA 4I8OA 4BC7A 2HHHE 2EQ3A 3KZZA 4JI3E 3ECRA 2V86A 2EPAA 2L8TA 4TUGA 3ZOQB 4JI1E 5LMNE 1I94E 2EPPA 2LVHA 5A6BD 5T6JA 4DR1E 3J7AG 4NXME 4LF7E 1IQSA 2EPNA 2V85A 2EN3A 3EPJA 2NUFA 2I13A 2V89A 3HQ1A 4R2RA 1A1LA 2G7HA 1EH7A 1X5WA 2JVAA 4R2EA 1IBKE 4RHBB 2B9DA 1HNWE 4F9AB 3DF6A 3BF2A 2NABA 2YRKA 3MHHC 5FLXC 2B3TB 5AE1A 2RSMA 3EPKA 2WBSA 2JOBA 2ELYA 2ODRD 4MLVA 2YWQA 3J7Yp 2LUQA 1A1JA 2L6MA 4YY3E 2YSPA 1KYQA 1X3CA 4LF6E 2UUAE 1AH5A 3QG5C 4B3RE 1A1KA 1L4SA 1GZ6A 2EQ0A 2L33A 3BBGA 2EN6A 2EL6A 4DV4E 2RTXA 1STUA 2EMZA 2EN1A 2MC5A 2UXBE 5KL3A 4B3ME 2RS6A 1BBOA 4P7DA 2EOYA 2LJHA 2FTXB 1Z1BA 5AE3A 2CT1A 5A6BA 2YU5A 3DJWA 2JR1A 1G2DC 1ZBQA 2MDGA 1DGCA 3VYXA 2RQLA 4R2SA 2EN7A 2GHFA 4O24A 2EMCA 3HPSA 4LF4E 1MGTA 4RH8A 4JI4E 1J26A 2VE7C 3FIGA 4R2QA 1BBGA 4WX9A 1A1IA 2YSOA 3P1XA 2YZTA 2DMYA 4JYAE 1A1GA 1PKPA 2K4VA 1IBLE 2EM3A 2EPCA 2LUPB 2V88A 1HR0E 1TF3A 2VF1A 3HXLA 2EPRA 2DLQA 4KZSA 2UUCE 2HJJA 4BMJA 2DMIA 2YRMA 3T1HE 5KL7A 2EMYA 5KL4A 2DRPA 1YFHA 4BHBA 1UHZA 4F2JC 4LF9E 3JAMC 2EWLA 1A1HA 1UN6B 4IJDA 2PRTA 2EOEA 1T4NA 2EMBA 2JYAA 2EM9A 4WFTA 1N34E 1N3GA 4O4KA 2EM4A 4LFAE 4WSGA 4DR6E 3T1YE 4M30A 2EMXA 4DV3E 4K0KE 2EMFA 4F9CB 2EMGA 2RPCA 2EOJA 4R2AA
chains in the Genus database with same CATH topology
3UK3C 3EPKA 1NCSA 2EOXA 2ELYA 2ADRA 2WBSA 4R2PA 2LT7A 2YTEA 2YTJA 3M99B 2YTNA 2YTGA 2EOMA 1A1JA 2EMIA 5KL2A 5KL5A 5KL6A 2EMWA 2YSPA 1ZR9A 1X3CA 4F6MA 1A1FA 1F2IG 1A1KA 2EN2A 2EM8A 2ENHA 2EQ0A 4F6NA 2HGHA 1WJPA 2EPZA 2EN6A 2EL5A 2BB8A 1YSAC 2EL6A 2EE8A 2EOQA 3EPLA 2JPAA 2EN4A 1TF6A 2EMLA 2EM6A 2EMZA 2EMHA 2EMKA 2EN1A 2VRDA 2YTQA 1B69A 2M9AA 2LO3A 5KL3A 1BBOA 2EOYA 2R1FA 1UBDC 1ZU1A 4M9VC 3MHSC 2YRHA 1Z1BA 2CT1A 2A25A 2LCEA 2YU8A 2YU5A 1RMDA 1G2DC 2RSIA 2MDGA 1DGCA 2EOSA 1X6EA 4R2SA 2EOHA 1G2FC 2EN8A 2MKDA 2EN7A 2GHFA 4R2CA 2LV2A 2EMCA 2EORA 1YUJA 2J7JA 1KJKA 2EM7A 2EM0A 2EM2A 2EP3A 1JK1A 2EL4A 4R2QA 4R2DA 1A1IA 3EPHA 2ELZA 2DLKA 1YUIA 1X6FA 2YSOA 1A1GA 1X6HA 2EM3A 2EPCA 2EMAA 4X9JA 1TF3A 2EPRA 2EQ3A 2CTDA 2YTOA 1TN9A 2DLQA 1MEYC 2YTPA 1P47A 1JK2A 1LLMC 2EPAA 1BB8A 2EPXA 2DMIA 2EPPA 2LVHA 2YRMA 2EM5A 5KL7A 2ENAA 2EPUA 4IS1C 2EMYA 5KL4A 2EJ4A 2EN3A 3EPJA 2DRPA 2I13A 2CSHA 4F2JC 4R2RA 1A1LA 2EQ1A 1X5WA 2EOZA 1AAYA 2GLIA 1A1HA 1UN6B 2E72A 4IJDA 2PRTA 4GZNC 2EOEA 2YTIA 2DGCA 2EMBA 2JP9A 2EOIA 2WBTA 2EM9A 4R2EA 2ENCA 4FK5C 2WBUA 2YTFA 2EM4A 2D9HA 4WSGA 2EOOA 2EMXA 2MKNA 3VHTB 2WCC3 2EMFA 2EMGA 2EOFA 2RPCA 2EOJA 2YTDA 2NABA 1ZAAC 4R2AA 2YRKA 3MHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UK3 C;  3EPK A;  1NCS A;  2EOX A;  2ELY A;  2ADR A;  2WBS A;  4R2P A;  2LT7 A;  2YTE A;  2YTJ A;  3M99 B;  2YTN A;  2YTG A;  2EOM A;  1A1J A;  2EMI A;  5KL2 A;  5KL5 A;  5KL6 A;  2EMW A;  2YSP A;  1ZR9 A;  1X3C A;  4F6M A;  1A1F A;  1F2I G;  1A1K A;  2EN2 A;  2EM8 A;  2ENH A;  2EQ0 A;  4F6N A;  2HGH A;  1WJP A;  2EPZ A;  2EN6 A;  2EL5 A;  2BB8 A;  1YSA C;  2EL6 A;  2EE8 A;  2EOQ A;  3EPL A;  2JPA A;  2EN4 A;  1TF6 A;  2EML A;  2EM6 A;  2EMZ A;  2EMH A;  2EMK A;  2EN1 A;  2VRD A;  2YTQ A;  1B69 A;  2M9A A;  2LO3 A;  5KL3 A;  1BBO A;  2EOY A;  2R1F A;  1UBD C;  1ZU1 A;  4M9V C;  3MHS C;  2YRH A;  1Z1B A;  2CT1 A;  2A25 A;  2LCE A;  2YU8 A;  2YU5 A;  1RMD A;  1G2D C;  2RSI A;  2MDG A;  1DGC A;  2EOS A;  1X6E A;  4R2S A;  2EOH A;  1G2F C;  2EN8 A;  2MKD A;  2EN7 A;  2GHF A;  4R2C A;  2LV2 A;  2EMC A;  2EOR A;  1YUJ A;  2J7J A;  1KJK A;  2EM7 A;  2EM0 A;  2EM2 A;  2EP3 A;  1JK1 A;  2EL4 A;  4R2Q A;  4R2D A;  1A1I A;  3EPH A;  2ELZ A;  2DLK A;  1YUI A;  1X6F A;  2YSO A;  1A1G A;  1X6H A;  2EM3 A;  2EPC A;  2EMA A;  4X9J A;  1TF3 A;  2EPR A;  2EQ3 A;  2CTD A;  2YTO A;  1TN9 A;  2DLQ A;  1MEY C;  2YTP A;  1P47 A;  1JK2 A;  1LLM C;  2EPA A;  1BB8 A;  2EPX A;  2DMI A;  2EPP A;  2LVH A;  2YRM A;  2EM5 A;  5KL7 A;  2ENA A;  2EPU A;  4IS1 C;  2EMY A;  5KL4 A;  2EJ4 A;  2EN3 A;  3EPJ A;  2DRP A;  2I13 A;  2CSH A;  4F2J C;  4R2R A;  1A1L A;  2EQ1 A;  1X5W A;  2EOZ A;  1AAY A;  2GLI A;  1A1H A;  1UN6 B;  2E72 A;  4IJD A;  2PRT A;  4GZN C;  2EOE A;  2YTI A;  2DGC A;  2EMB A;  2JP9 A;  2EOI A;  2WBT A;  2EM9 A;  4R2E A;  2ENC A;  4FK5 C;  2WBU A;  2YTF A;  2EM4 A;  2D9H A;  4WSG A;  2EOO A;  2EMX A;  2MKN A;  3VHT B;  2WCC 3;  2EMF A;  2EMG A;  2EOF A;  2RPC A;  2EOJ A;  2YTD A;  2NAB A;  1ZAA C;  4R2A A;  2YRK A;  3MHH C; 
#chains in the Genus database with same CATH topology
 1WHN A;  2DB2 A;  1FKA E;  5A69 A;  5LL6 R;  3M99 B;  2UXD E;  2EOM A;  4LFC E;  2IHR 1;  3HPZ A;  2B7T A;  4MLQ A;  5KL2 A;  3J81 C;  5KL5 A;  3F6H A;  5F3W A;  2EMW A;  4DR2 E;  2N8X A;  4F6M A;  1A1F A;  2L2K B;  2N3G A;  2ENH A;  4F6N A;  5AAS A;  4R8O A;  2HGH A;  1XMQ E;  4BC9 A;  2EN4 A;  5DNY A;  1NEI A;  2EM6 A;  1DI2 A;  4N4R B;  2M9A A;  2LO3 A;  4KHP E;  1N36 E;  3JTZ A;  2LTS A;  2R1F A;  4KWY A;  1XMO E;  3ADI A;  1UBD C;  3MHS C;  4R03 A;  5BR8 E;  4DKK A;  4B3S E;  2ZM6 E;  2FV4 B;  2EOH A;  2NUE A;  2MKD A;  5IT9 C;  1IQO A;  2YPN A;  2N3H A;  4HEI A;  2LTR A;  4X8W A;  4DV6 E;  5AE2 A;  1JK1 A;  2JY9 A;  1O0W A;  2Q8U A;  3IWD A;  4DV1 E;  5IV8 B;  2JOX A;  3EPH A;  2LE2 A;  5TSE A;  2E5L E;  1WXR A;  4DV2 E;  3C6K A;  1HNX E;  3KZY A;  2CPN A;  4OOG C;  2CTD A;  2L2M A;  1TN9 A;  4L8N A;  4DMI A;  2YTP A;  4DUZ E;  2KON A;  4JI5 E;  1BB8 A;  3JU0 A;  4JI0 E;  4WPY A;  4JV5 E;  2BBG A;  4B3T E;  3ADJ A;  2R76 A;  1X47 A;  2ENA A;  4DR7 E;  5A2Q C;  1QNT A;  2CSH A;  1WHQ A;  4LF5 E;  2EQ1 A;  1AAY A;  1QU6 A;  2VQF E;  2EPO A;  1YZ9 A;  2YTI A;  2VQE E;  2JP9 A;  4OX9 E;  4JI2 E;  1FJG E;  2ENC A;  4FK5 C;  3RMP A;  2YTF A;  1T4O A;  2D9H A;  2EOF A;  3KWR A;  5LMU E;  4LF8 E;  3BGH A;  3UK3 C;  4AQY E;  4NXN E;  2EZ6 A;  2ADR A;  2M7Q A;  4R2P A;  5A6K A;  3C4B A;  2B7V A;  4GKJ E;  4DR4 E;  2NA2 A;  2H36 X;  1PJT A;  2EPL X;  1F2I G;  3BID A;  2EN2 A;  2EM8 A;  4F54 A;  1GTK A;  2KOU A;  3C6M A;  1WJP A;  2EPZ A;  2JXP A;  2LJU A;  1YSA C;  3EPL A;  2M1S A;  2JPA A;  1TF6 A;  1YYK A;  2EPM X;  4TUI A;  2VRD A;  2NUG A;  1YYW A;  4ZYE A;  4X65 E;  2GPI A;  4P78 A;  2I9I A;  4M9V C;  1PJS A;  1SFE A;  2YRH A;  4ZYD A;  1EKZ A;  4Q28 A;  2YU8 A;  3L00 A;  2LCE A;  2V8Q B;  2YT4 A;  4JI7 E;  3VK6 A;  4BS9 A;  1PDA A;  1RMD A;  4LTY A;  1RC7 A;  3J80 C;  1RQ0 A;  1ZBT A;  2RSI A;  4L5N C;  4ZYG A;  2EOS A;  1X6E A;  1G2F C;  2EN8 A;  1HNZ E;  1XNR E;  3OML A;  3THO B;  2LV2 A;  2EOR A;  2UU9 E;  2J7J A;  1KJK A;  4J8Z A;  1J5E E;  3ADL A;  2EM0 A;  5IXM B;  2EP3 A;  5CFF E;  2DLK A;  1X6F A;  4X64 E;  4DUY E;  2F4V E;  2EMA A;  2V87 A;  5AC5 A;  4F9B B;  3IWB A;  4X66 E;  4X9J A;  3LLH A;  2LBS B;  2YTO A;  4NHR A;  1MEY C;  1WRJ A;  4LU9 A;  1P47 A;  4NZV A;  3THN A;  1JK2 A;  1LLM C;  2L92 A;  2F8B A;  4O5G A;  2K7I A;  3HTX A;  2EPX A;  2EM5 A;  2EPU A;  4IS1 C;  1T39 A;  2EJ4 A;  4GEQ B;  5A6A A;  4GKK E;  3C4T A;  2V83 A;  2EOZ A;  2L3J A;  2GLI A;  1EH6 A;  2E72 A;  2DIX A;  2LMZ A;  4BCA A;  4GZN C;  2DGC A;  4DV5 E;  2EOI A;  1YPN A;  4BHC A;  2WBT A;  2MDR A;  4ZYH A;  5AC4 A;  1DQ3 A;  5LLQ A;  2UXC E;  2M4I A;  2WBU A;  4JI8 E;  2EOO A;  3OTO E;  2MKN A;  3VHT B;  2WCC 3;  2E1M A;  1N33 E;  2LRS A;  2YTD A;  4WSP A;  1ZAA C;  3H09 A;  2L3C A;  1SR9 A;  2RS7 A;  3IWC A;  1NCS A;  2EOX A;  4JI6 E;  4M0V A;  1XNQ E;  2FGG A;  2WZO A;  2LT7 A;  2YTE A;  2YTJ A;  2YTN A;  2YTG A;  4M2Z A;  1UIL A;  3TQM A;  2MC6 A;  2EMI A;  1X49 A;  3K6Q A;  5KL6 A;  4DR5 E;  1ZR9 A;  3LML A;  1X48 A;  4X62 E;  4Q35 B;  3AV0 A;  4BBY A;  4DV7 E;  4WXD A;  4WXC A;  2EL5 A;  2BB8 A;  1T4L B;  2EE8 A;  2EOQ A;  2EPK X;  2UUB E;  2HC5 A;  1PJQ A;  2L2N A;  3VYY A;  4DR3 E;  2EML A;  1YYO A;  2YTQ A;  2EMH A;  2EMK A;  4O43 A;  5IWA E;  1B69 A;  3EQ1 A;  2ODR C;  4HTG A;  1EH8 A;  1ZU1 A;  4YHH E;  3ADG A;  3F6G A;  2A25 A;  1N32 E;  1IMU A;  1GQE A;  4DV0 E;  4R2C A;  5A6J A;  2KHX A;  1YUJ A;  2EM7 A;  4LFB E;  3AUZ A;  4WYQ B;  2EM2 A;  3MSW A;  2EL4 A;  4R2D A;  2ELZ A;  1YUI A;  5ADZ A;  2JWO A;  1T38 A;  1X6H A;  1IBM E;  2DSY A;  4I8O A;  4BC7 A;  2HHH E;  2EQ3 A;  3KZZ A;  4JI3 E;  3ECR A;  2V86 A;  2EPA A;  2L8T A;  4TUG A;  3ZOQ B;  4JI1 E;  5LMN E;  1I94 E;  2EPP A;  2LVH A;  5A6B D;  5T6J A;  4DR1 E;  3J7A G;  4NXM E;  4LF7 E;  1IQS A;  2EPN A;  2V85 A;  2EN3 A;  3EPJ A;  2NUF A;  2I13 A;  2V89 A;  3HQ1 A;  4R2R A;  1A1L A;  2G7H A;  1EH7 A;  1X5W A;  2JVA A;  4R2E A;  1IBK E;  4RHB B;  2B9D A;  1HNW E;  4F9A B;  3DF6 A;  3BF2 A;  2NAB A;  2YRK A;  3MHH C;  5FLX C;  2B3T B;  5AE1 A;  2RSM A;  3EPK A;  2WBS A;  2JOB A;  2ELY A;  2ODR D;  4MLV A;  2YWQ A;  3J7Y p;  2LUQ A;  1A1J A;  2L6M A;  4YY3 E;  2YSP A;  1KYQ A;  1X3C A;  4LF6 E;  2UUA E;  1AH5 A;  3QG5 C;  4B3R E;  1A1K A;  1L4S A;  1GZ6 A;  2EQ0 A;  2L33 A;  3BBG A;  2EN6 A;  2EL6 A;  4DV4 E;  2RTX A;  1STU A;  2EMZ A;  2EN1 A;  2MC5 A;  2UXB E;  5KL3 A;  4B3M E;  2RS6 A;  1BBO A;  4P7D A;  2EOY A;  2LJH A;  2FTX B;  1Z1B A;  5AE3 A;  2CT1 A;  5A6B A;  2YU5 A;  3DJW A;  2JR1 A;  1G2D C;  1ZBQ A;  2MDG A;  1DGC A;  3VYX A;  2RQL A;  4R2S A;  2EN7 A;  2GHF A;  4O24 A;  2EMC A;  3HPS A;  4LF4 E;  1MGT A;  4RH8 A;  4JI4 E;  1J26 A;  2VE7 C;  3FIG A;  4R2Q A;  1BBG A;  4WX9 A;  1A1I A;  2YSO A;  3P1X A;  2YZT A;  2DMY A;  4JYA E;  1A1G A;  1PKP A;  2K4V A;  1IBL E;  2EM3 A;  2EPC A;  2LUP B;  2V88 A;  1HR0 E;  1TF3 A;  2VF1 A;  3HXL A;  2EPR A;  2DLQ A;  4KZS A;  2UUC E;  2HJJ A;  4BMJ A;  2DMI A;  2YRM A;  3T1H E;  5KL7 A;  2EMY A;  5KL4 A;  2DRP A;  1YFH A;  4BHB A;  1UHZ A;  4F2J C;  4LF9 E;  3JAM C;  2EWL A;  1A1H A;  1UN6 B;  4IJD A;  2PRT A;  2EOE A;  1T4N A;  2EMB A;  2JYA A;  2EM9 A;  4WFT A;  1N34 E;  1N3G A;  4O4K A;  2EM4 A;  4LFA E;  4WSG A;  4DR6 E;  3T1Y E;  4M30 A;  2EMX A;  4DV3 E;  4K0K E;  2EMF A;  4F9C B;  2EMG A;  2RPC A;  2EOJ A;  4R2A A; 
#chains in the Genus database with same CATH homology
 3UK3 C;  3EPK A;  1NCS A;  2EOX A;  2ELY A;  2ADR A;  2WBS A;  4R2P A;  2LT7 A;  2YTE A;  2YTJ A;  3M99 B;  2YTN A;  2YTG A;  2EOM A;  1A1J A;  2EMI A;  5KL2 A;  5KL5 A;  5KL6 A;  2EMW A;  2YSP A;  1ZR9 A;  1X3C A;  4F6M A;  1A1F A;  1F2I G;  1A1K A;  2EN2 A;  2EM8 A;  2ENH A;  2EQ0 A;  4F6N A;  2HGH A;  1WJP A;  2EPZ A;  2EN6 A;  2EL5 A;  2BB8 A;  1YSA C;  2EL6 A;  2EE8 A;  2EOQ A;  3EPL A;  2JPA A;  2EN4 A;  1TF6 A;  2EML A;  2EM6 A;  2EMZ A;  2EMH A;  2EMK A;  2EN1 A;  2VRD A;  2YTQ A;  1B69 A;  2M9A A;  2LO3 A;  5KL3 A;  1BBO A;  2EOY A;  2R1F A;  1UBD C;  1ZU1 A;  4M9V C;  3MHS C;  2YRH A;  1Z1B A;  2CT1 A;  2A25 A;  2LCE A;  2YU8 A;  2YU5 A;  1RMD A;  1G2D C;  2RSI A;  2MDG A;  1DGC A;  2EOS A;  1X6E A;  4R2S A;  2EOH A;  1G2F C;  2EN8 A;  2MKD A;  2EN7 A;  2GHF A;  4R2C A;  2LV2 A;  2EMC A;  2EOR A;  1YUJ A;  2J7J A;  1KJK A;  2EM7 A;  2EM0 A;  2EM2 A;  2EP3 A;  1JK1 A;  2EL4 A;  4R2Q A;  4R2D A;  1A1I A;  3EPH A;  2ELZ A;  2DLK A;  1YUI A;  1X6F A;  2YSO A;  1A1G A;  1X6H A;  2EM3 A;  2EPC A;  2EMA A;  4X9J A;  1TF3 A;  2EPR A;  2EQ3 A;  2CTD A;  2YTO A;  1TN9 A;  2DLQ A;  1MEY C;  2YTP A;  1P47 A;  1JK2 A;  1LLM C;  2EPA A;  1BB8 A;  2EPX A;  2DMI A;  2EPP A;  2LVH A;  2YRM A;  2EM5 A;  5KL7 A;  2ENA A;  2EPU A;  4IS1 C;  2EMY A;  5KL4 A;  2EJ4 A;  2EN3 A;  3EPJ A;  2DRP A;  2I13 A;  2CSH A;  4F2J C;  4R2R A;  1A1L A;  2EQ1 A;  1X5W A;  2EOZ A;  1AAY A;  2GLI A;  1A1H A;  1UN6 B;  2E72 A;  4IJD A;  2PRT A;  4GZN C;  2EOE A;  2YTI A;  2DGC A;  2EMB A;  2JP9 A;  2EOI A;  2WBT A;  2EM9 A;  4R2E A;  2ENC A;  4FK5 C;  2WBU A;  2YTF A;  2EM4 A;  2D9H A;  4WSG A;  2EOO A;  2EMX A;  2MKN A;  3VHT B;  2WCC 3;  2EMF A;  2EMG A;  2EOF A;  2RPC A;  2EOJ A;  2YTD A;  2NAB A;  1ZAA C;  4R2A A;  2YRK A;  3MHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...