2EM0A

Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 224
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGMGEKTWKCRECDMCFSQASSLRLHQNVHVGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the 18th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em0A01
2EMLA 2ENAA 1DGCA 2GLIA 1G2FC 2EORA 2JP9A 2BB8A 4GZNC 2EJ4A 2R1FA 2ELYA 2EPPA 2EMIA 3M99B 4IS1C 1TN9A 1X6EA 2EM8A 2YTPA 2DMIA 2EN7A 2NABA 4X9JA 1YUJA 1YUIA 2EN6A 2EMAA 2CT1A 3MHSC 5KL5A 1A1HA 1MEYC 2EM6A 1P47A 2EM5A 2EOFA 2EM2A 2EP3A 2WBSA 2M9AA 3EPKA 2EMKA 1TF3A 2YRHA 2DLQA 2YTOA 1Z1BA 4R2RA 2EQ0A 2EOZA 2EMWA 2LV2A 3EPJA 2DGCA 4IJDA 1X6FA 2EPCA 2EMHA 2ENCA 1KJKA 5KL6A 2D9HA 1X3CA 2EOOA 4F2JC 2I13A 2JPAA 2EMZA 2EN8A 1UBDC 1UN6B 2EL5A 2EOEA 2E72A 2MDGA 2YU8A 1WJPA 2EOIA 2ELZA 2EM9A 2EOXA 1RMDA 2EMYA 1A1IA 2WBUA 3VHTB 1TF6A 1JK2A 2ADRA 1F2IG 2YRMA 4R2CA 2EQ1A 2A25A 2EPXA 3EPHA 2EMGA 2EOHA 2YTJA 2EMFA 2YTFA 1A1LA 2CSHA 1A1KA 1NCSA 3EPLA 2LVHA 2EOSA 2EOJA 2YTEA 4R2QA 1ZU1A 3UK3C 2EOMA 1X6HA 1BB8A 2EL6A 2GHFA 2EN1A 2YTGA 4FK5C 3MHHC 5KL7A 2EPAA 2DRPA 1B69A 2EPZA 4WSGA 2MKNA 5KL4A 2RPCA 1AAYA 2EM4A 2YTDA 1A1GA 2RSIA 4R2AA 2EE8A 2DLKA 2EN3A 4M9VC 1YSAC 4R2PA 2YSPA 2MKDA 2EL4A 2EOQA 2EMBA 2EMXA 4F6NA 2EM7A 2WCC3 1JK1A 2YU5A 2PRTA 5KL2A 2LO3A 2EOYA 2EN2A 4R2DA 2CTDA 2EM0A 2EM3A 1A1JA 2VRDA 2LCEA 2YRKA 1X5WA 4R2SA 1ZR9A 1A1FA 2LT7A 4F6MA 4R2EA 1BBOA 1ZAAC 2EN4A 2YSOA 2YTQA 1LLMC 2EQ3A 1G2DC 2WBTA 2EMCA 2YTNA 2J7JA 5KL3A 2EPUA 2EPRA 2HGHA 2YTIA 2ENHA
chains in the Genus database with same CATH superfamily
2LJHA 3HPZA 2GLIA 4M0VA 2EJ4A 4LFAE 2ELYA 3C6MA 4IS1C 4K0KE 1X6EA 5LL6R 1IQOA 2YTPA 2DMIA 2JXPA 4X9JA 5LMUE 5T6JA 1PKPA 5KL5A 4N4RB 1A1HA 2RQLA 1N34E 1I94E 1P47A 2EOFA 2EP3A 2UXDE 1TF3A 1YZ9A 2YRHA 2UXCE 2DLQA 4JI2E 2KHXA 4NXNE 2EOZA 2V87A 4R03A 2DB2A 1FKAE 3BIDA 4IJDA 1IQSA 4TUIA 4BMJA 4F9BB 1XNRE 2ENCA 1KJKA 5KL6A 3AV0A 2B9DA 2D9HA 3C4TA 1UBDC 2B3TB 2L3JA 5BR8E 3QG5C 2B7VA 2E72A 4GKKE 2VE7C 2EWLA 2DIXA 1GZ6A 3LLHA 3VHTB 4X8WA 5A69A 1T4LB 1F2IG 2YRMA 1MGTA 4LF9E 3OTOE 2EQ1A 1WRJA 2RS6A 2YTJA 2EMFA 4MLQA 2CSHA 3BF2A 1HR0E 5AE3A 3EPLA 2LVHA 2EOSA 2KONA 2YTEA 3UK3C 3JU0A 4FK5C 1ZBTA 2LBSB 4DR3E 2EPAA 2JYAA 4O5GA 4WSGA 2MKNA 5KL4A 2YTDA 4ZYGA 4LF5E 4R2AA 4X65E 1EKZA 2R76A 2ODRD 1YSAC 1IMUA 2YSPA 1J26A 2V86A 2YPNA 2EMBA 2EMXA 4F6NA 2EM7A 2WCC3 2UXBE 2RS7A 4B3RE 5AC5A 2LO3A 5IWAE 5A2QC 4LF8E 2I9IA 3C6KA 2EM0A 4BBYA 3ADJA 2LCEA 1GTKA 4R2SA 1UILA 2LT7A 4F6MA 1BBOA 2YTQA 4JI0E 2L2NA 1T4OA 1G2DC 3HPSA 2J7JA 2JOXA 2EPRA 4DV0E 4M30A 1STUA 4DKKA 1YYWA 4JYAE 2ENAA 4JI7E 1DGCA 2JP9A 2BB8A 2NA2A 3KZYA 1YUJA 2HHHE 4B3ME 3AUZA 2NUGA 2N3GA 2LUQA 1YUIA 2CT1A 2MC5A 5IV8B 2V89A 2WBSA 3EPKA 1NEIA 2MDRA 2N3HA 3ECRA 4X62E 4P7DA 5LMNE 2BBGA 4WFTA 4LF7E 4WX9A 2K4VA 4Q28A 2I13A 1T39A 2EMZA 1UN6B 4DV4E 2EOEA 2RSMA 2FGGA 2MDGA 1YYKA 2EOIA 4BHBA 2LTRA 2Q8UA 2EMYA 1A1IA 1EH7A 4R2CA 4NXME 2A25A 2EPXA 3EPHA 2EOHA 5TSEA 4JI8E 3FIGA 3THNA 2EZ6A 2EOJA 1ZU1A 2K7IA 1X6HA 2JY9A 4P78A 4X64E 2EL6A 2YTGA 4F54A 1J5EE 4BHCA 4MLVA 1B69A 2EPZA 2EPOA 2FV4B 2UU9E 1AAYA 2RSIA 2V83A 5CFFE 4DV1E 4M9VC 3VYXA 2G7HA 3F6HA 2EL4A 4DUZE 4O24A 2LUPB 1AH5A 2MC6A 4KZSA 4DMIA 2PRTA 3ADIA 5KL2A 5LLQA 4BS9A 1IBLE 2JOBA 4DR4E 4DR7E 2RTXA 2B7TA 2V8QB 1X47A 2EQ3A 4B3TE 1EH8A 5AE2A 4F9CB 2NUFA 2EMCA 2L33A 4GKJE 2UUCE 2L2KB 1PDAA 2EN4A 5ADZA 2VQFE 4DR2E 4ZYDA 2EMLA 1G2FC 2EORA 4O4KA 4DV3E 3VK6A 3BBGA 4GZNC 4ZYHA 2VQEE 2EPPA 3M99B 2EMIA 1TN9A 3H09A 4LTYA 2NABA 4HTGA 1PJQA 2EPNA 2VF1A 2ZM6E 2EMAA 2EM6A 2UUBE 3K6QA 3IWCA 1XMQE 3ADLA 2EPLX 4DR6E 1YYOA 2LRSA 1Z1BA 2EQ0A 3HXLA 2JWOA 2LV2A 2EPMX 3EPJA 1SFEA 2WZOA 2EPKX 4JI3E 2JVAA 3DJWA 4YY3E 1X3CA 2EOOA 5IT9C 1QU6A 4F2JC 2JR1A 2EL5A 4KWYA 3RMPA 1WXRA 2E5LE 1N32E 5A6AA 5AC4A 4M2ZA 3IWDA 1WHQA 2L2MA 2EM9A 2EOXA 1RMDA 2LMZA 3TQMA 3J81C 2HJJA 3EQ1A 3OMLA 1JK2A 2IHR1 2ADRA 3T1HE 1DQ3A 1X48A 1A1LA 1A1KA 1NCSA 5A6KA 1PJTA 3MSWA 4LF4E 2GHFA 4AQYE 5IXMB 5KL7A 1HNXE 4LU9A 3C4BA 4J8ZA 3VYYA 4RHBB 1XNQE 1L4SA 1RC7A 2EM4A 1HNZE 2EE8A 4DV6E 5AASA 2MKDA 5A6BA 3JTZA 4TUGA 4JI5E 2YU5A 4BCAA 2EN2A 3ZOQB 4R2DA 2V85A 2ODRC 2L3CA 4LFBE 2CTDA 1N33E 2EM3A 1PJSA 4R8OA 2LTSA 1X5WA 5FLXC 4BC9A 4R2EA 1WHNA 2N8XA 1ZAAC 2YSOA 2FTXB 1FJGE 2WBTA 4DV2E 4ZYEA 3HTXA 2YTNA 2F8BA 5KL3A 2HGHA 2YTIA 4L5NC 1YFHA 4WXDA 3L00A 2GPIA 4DR1E 2V88A 2R1FA 2EM8A 2EN7A 2EN6A 1DI2A 3MHSC 1MEYC 2NUEA 4WSPA 4NHRA 2M1SA 2EM5A 4KHPE 2EM2A 2M9AA 1N3GA 4L8NA 2EMKA 5A6JA 2YTOA 4R2RA 1ZBQA 1KYQA 2EMWA 4JI1E 3J7Yp 2DGCA 1N36E 4JI6E 1X6FA 4BC7A 2HC5A 4DUYE 2EPCA 2EMHA 4O43A 4OX9E 4I8OA 2YT4A 2JPAA 2EN8A 1T38A 4WXCA 3KZZA 1IBME 5A6BD 4YHHE 2YU8A 1WJPA 4JV5E 2ELZA 2H36X 1YPNA 4GEQB 3DF6A 2WBUA 1TF6A 4X66E 2KOUA 1BBGA 4DV5E 4NZVA 2EMGA 3F6GA 4HEIA 2YTFA 3HQ1A 3JAMC 5F3WA 4LF6E 4R2QA 2F4VE 2EOMA 1T4NA 2DSYA 5AE1A 1BB8A 1X49A 2EN1A 3MHHC 3ADGA 2DRPA 1IBKE 4DV7E 3THOB 2L8TA 2DMYA 4F9AB 2RPCA 2LE2A 1A1GA 4RH8A 2L92A 2DLKA 2EN3A 3LMLA 4R2PA 1XMOE 1O0WA 2EOQA 4WYQB 3J80C 2YWQA 1JK1A 2UUAE 1RQ0A 3T1YE 1QNTA 2YZTA 5DNYA 2EOYA 2CPNA 1HNWE 1GQEA 1EH6A 2M7QA 4OOGC 2LJUA 1UHZA 2L6MA 1A1JA 2VRDA 2YRKA 2M4IA 1A1FA 1ZR9A 2E1MA 1LLMC 4DR5E 4LFCE 3BGHA 3IWBA 3P1XA 4WPYA 1SR9A 4JI4E 2EPUA 3KWRA 4Q35B 3J7AG 4B3SE 2ENHA
chains in the Genus database with same CATH topology
2EMLA 2ENAA 1DGCA 2GLIA 1G2FC 2EORA 2JP9A 2BB8A 4GZNC 2EJ4A 2R1FA 2ELYA 2EPPA 2EMIA 3M99B 4IS1C 1TN9A 1X6EA 2EM8A 2YTPA 2DMIA 2EN7A 2NABA 4X9JA 1YUJA 1YUIA 2EN6A 2EMAA 2CT1A 3MHSC 5KL5A 1A1HA 1MEYC 2EM6A 1P47A 2EM5A 2EOFA 2EM2A 2EP3A 2WBSA 2M9AA 3EPKA 2EMKA 1TF3A 2YRHA 2DLQA 2YTOA 1Z1BA 4R2RA 2EQ0A 2EOZA 2EMWA 2LV2A 3EPJA 2DGCA 4IJDA 1X6FA 2EPCA 2EMHA 2ENCA 1KJKA 5KL6A 2D9HA 1X3CA 2EOOA 4F2JC 2I13A 2JPAA 2EMZA 2EN8A 1UBDC 1UN6B 2EL5A 2EOEA 2E72A 2MDGA 2YU8A 1WJPA 2EOIA 2ELZA 2EM9A 2EOXA 1RMDA 2EMYA 1A1IA 2WBUA 3VHTB 1TF6A 1JK2A 2ADRA 1F2IG 2YRMA 4R2CA 2EQ1A 2A25A 2EPXA 3EPHA 2EMGA 2EOHA 2YTJA 2EMFA 2YTFA 1A1LA 2CSHA 1A1KA 1NCSA 3EPLA 2LVHA 2EOSA 2EOJA 2YTEA 4R2QA 1ZU1A 3UK3C 2EOMA 1X6HA 1BB8A 2EL6A 2GHFA 2EN1A 2YTGA 4FK5C 3MHHC 5KL7A 2EPAA 2DRPA 1B69A 2EPZA 4WSGA 2MKNA 5KL4A 2RPCA 1AAYA 2EM4A 2YTDA 1A1GA 2RSIA 4R2AA 2EE8A 2DLKA 2EN3A 4M9VC 1YSAC 4R2PA 2YSPA 2MKDA 2EL4A 2EOQA 2EMBA 2EMXA 4F6NA 2EM7A 2WCC3 1JK1A 2YU5A 2PRTA 5KL2A 2LO3A 2EOYA 2EN2A 4R2DA 2CTDA 2EM0A 2EM3A 1A1JA 2VRDA 2LCEA 2YRKA 1X5WA 4R2SA 1ZR9A 1A1FA 2LT7A 4F6MA 4R2EA 1BBOA 1ZAAC 2EN4A 2YSOA 2YTQA 1LLMC 2EQ3A 1G2DC 2WBTA 2EMCA 2YTNA 2J7JA 5KL3A 2EPUA 2EPRA 2HGHA 2YTIA 2ENHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EML A;  2ENA A;  1DGC A;  2GLI A;  1G2F C;  2EOR A;  2JP9 A;  2BB8 A;  4GZN C;  2EJ4 A;  2R1F A;  2ELY A;  2EPP A;  2EMI A;  3M99 B;  4IS1 C;  1TN9 A;  1X6E A;  2EM8 A;  2YTP A;  2DMI A;  2EN7 A;  2NAB A;  4X9J A;  1YUJ A;  1YUI A;  2EN6 A;  2EMA A;  2CT1 A;  3MHS C;  5KL5 A;  1A1H A;  1MEY C;  2EM6 A;  1P47 A;  2EM5 A;  2EOF A;  2EM2 A;  2EP3 A;  2WBS A;  2M9A A;  3EPK A;  2EMK A;  1TF3 A;  2YRH A;  2DLQ A;  2YTO A;  1Z1B A;  4R2R A;  2EQ0 A;  2EOZ A;  2EMW A;  2LV2 A;  3EPJ A;  2DGC A;  4IJD A;  1X6F A;  2EPC A;  2EMH A;  2ENC A;  1KJK A;  5KL6 A;  2D9H A;  1X3C A;  2EOO A;  4F2J C;  2I13 A;  2JPA A;  2EMZ A;  2EN8 A;  1UBD C;  1UN6 B;  2EL5 A;  2EOE A;  2E72 A;  2MDG A;  2YU8 A;  1WJP A;  2EOI A;  2ELZ A;  2EM9 A;  2EOX A;  1RMD A;  2EMY A;  1A1I A;  2WBU A;  3VHT B;  1TF6 A;  1JK2 A;  2ADR A;  1F2I G;  2YRM A;  4R2C A;  2EQ1 A;  2A25 A;  2EPX A;  3EPH A;  2EMG A;  2EOH A;  2YTJ A;  2EMF A;  2YTF A;  1A1L A;  2CSH A;  1A1K A;  1NCS A;  3EPL A;  2LVH A;  2EOS A;  2EOJ A;  2YTE A;  4R2Q A;  1ZU1 A;  3UK3 C;  2EOM A;  1X6H A;  1BB8 A;  2EL6 A;  2GHF A;  2EN1 A;  2YTG A;  4FK5 C;  3MHH C;  5KL7 A;  2EPA A;  2DRP A;  1B69 A;  2EPZ A;  4WSG A;  2MKN A;  5KL4 A;  2RPC A;  1AAY A;  2EM4 A;  2YTD A;  1A1G A;  2RSI A;  4R2A A;  2EE8 A;  2DLK A;  2EN3 A;  4M9V C;  1YSA C;  4R2P A;  2YSP A;  2MKD A;  2EL4 A;  2EOQ A;  2EMB A;  2EMX A;  4F6N A;  2EM7 A;  2WCC 3;  1JK1 A;  2YU5 A;  2PRT A;  5KL2 A;  2LO3 A;  2EOY A;  2EN2 A;  4R2D A;  2CTD A;  2EM0 A;  2EM3 A;  1A1J A;  2VRD A;  2LCE A;  2YRK A;  1X5W A;  4R2S A;  1ZR9 A;  1A1F A;  2LT7 A;  4F6M A;  4R2E A;  1BBO A;  1ZAA C;  2EN4 A;  2YSO A;  2YTQ A;  1LLM C;  2EQ3 A;  1G2D C;  2WBT A;  2EMC A;  2YTN A;  2J7J A;  5KL3 A;  2EPU A;  2EPR A;  2HGH A;  2YTI A;  2ENH A; 
#chains in the Genus database with same CATH topology
 2LJH A;  3HPZ A;  2GLI A;  4M0V A;  2EJ4 A;  4LFA E;  2ELY A;  3C6M A;  4IS1 C;  4K0K E;  1X6E A;  5LL6 R;  1IQO A;  2YTP A;  2DMI A;  2JXP A;  4X9J A;  5LMU E;  5T6J A;  1PKP A;  5KL5 A;  4N4R B;  1A1H A;  2RQL A;  1N34 E;  1I94 E;  1P47 A;  2EOF A;  2EP3 A;  2UXD E;  1TF3 A;  1YZ9 A;  2YRH A;  2UXC E;  2DLQ A;  4JI2 E;  2KHX A;  4NXN E;  2EOZ A;  2V87 A;  4R03 A;  2DB2 A;  1FKA E;  3BID A;  4IJD A;  1IQS A;  4TUI A;  4BMJ A;  4F9B B;  1XNR E;  2ENC A;  1KJK A;  5KL6 A;  3AV0 A;  2B9D A;  2D9H A;  3C4T A;  1UBD C;  2B3T B;  2L3J A;  5BR8 E;  3QG5 C;  2B7V A;  2E72 A;  4GKK E;  2VE7 C;  2EWL A;  2DIX A;  1GZ6 A;  3LLH A;  3VHT B;  4X8W A;  5A69 A;  1T4L B;  1F2I G;  2YRM A;  1MGT A;  4LF9 E;  3OTO E;  2EQ1 A;  1WRJ A;  2RS6 A;  2YTJ A;  2EMF A;  4MLQ A;  2CSH A;  3BF2 A;  1HR0 E;  5AE3 A;  3EPL A;  2LVH A;  2EOS A;  2KON A;  2YTE A;  3UK3 C;  3JU0 A;  4FK5 C;  1ZBT A;  2LBS B;  4DR3 E;  2EPA A;  2JYA A;  4O5G A;  4WSG A;  2MKN A;  5KL4 A;  2YTD A;  4ZYG A;  4LF5 E;  4R2A A;  4X65 E;  1EKZ A;  2R76 A;  2ODR D;  1YSA C;  1IMU A;  2YSP A;  1J26 A;  2V86 A;  2YPN A;  2EMB A;  2EMX A;  4F6N A;  2EM7 A;  2WCC 3;  2UXB E;  2RS7 A;  4B3R E;  5AC5 A;  2LO3 A;  5IWA E;  5A2Q C;  4LF8 E;  2I9I A;  3C6K A;  2EM0 A;  4BBY A;  3ADJ A;  2LCE A;  1GTK A;  4R2S A;  1UIL A;  2LT7 A;  4F6M A;  1BBO A;  2YTQ A;  4JI0 E;  2L2N A;  1T4O A;  1G2D C;  3HPS A;  2J7J A;  2JOX A;  2EPR A;  4DV0 E;  4M30 A;  1STU A;  4DKK A;  1YYW A;  4JYA E;  2ENA A;  4JI7 E;  1DGC A;  2JP9 A;  2BB8 A;  2NA2 A;  3KZY A;  1YUJ A;  2HHH E;  4B3M E;  3AUZ A;  2NUG A;  2N3G A;  2LUQ A;  1YUI A;  2CT1 A;  2MC5 A;  5IV8 B;  2V89 A;  2WBS A;  3EPK A;  1NEI A;  2MDR A;  2N3H A;  3ECR A;  4X62 E;  4P7D A;  5LMN E;  2BBG A;  4WFT A;  4LF7 E;  4WX9 A;  2K4V A;  4Q28 A;  2I13 A;  1T39 A;  2EMZ A;  1UN6 B;  4DV4 E;  2EOE A;  2RSM A;  2FGG A;  2MDG A;  1YYK A;  2EOI A;  4BHB A;  2LTR A;  2Q8U A;  2EMY A;  1A1I A;  1EH7 A;  4R2C A;  4NXM E;  2A25 A;  2EPX A;  3EPH A;  2EOH A;  5TSE A;  4JI8 E;  3FIG A;  3THN A;  2EZ6 A;  2EOJ A;  1ZU1 A;  2K7I A;  1X6H A;  2JY9 A;  4P78 A;  4X64 E;  2EL6 A;  2YTG A;  4F54 A;  1J5E E;  4BHC A;  4MLV A;  1B69 A;  2EPZ A;  2EPO A;  2FV4 B;  2UU9 E;  1AAY A;  2RSI A;  2V83 A;  5CFF E;  4DV1 E;  4M9V C;  3VYX A;  2G7H A;  3F6H A;  2EL4 A;  4DUZ E;  4O24 A;  2LUP B;  1AH5 A;  2MC6 A;  4KZS A;  4DMI A;  2PRT A;  3ADI A;  5KL2 A;  5LLQ A;  4BS9 A;  1IBL E;  2JOB A;  4DR4 E;  4DR7 E;  2RTX A;  2B7T A;  2V8Q B;  1X47 A;  2EQ3 A;  4B3T E;  1EH8 A;  5AE2 A;  4F9C B;  2NUF A;  2EMC A;  2L33 A;  4GKJ E;  2UUC E;  2L2K B;  1PDA A;  2EN4 A;  5ADZ A;  2VQF E;  4DR2 E;  4ZYD A;  2EML A;  1G2F C;  2EOR A;  4O4K A;  4DV3 E;  3VK6 A;  3BBG A;  4GZN C;  4ZYH A;  2VQE E;  2EPP A;  3M99 B;  2EMI A;  1TN9 A;  3H09 A;  4LTY A;  2NAB A;  4HTG A;  1PJQ A;  2EPN A;  2VF1 A;  2ZM6 E;  2EMA A;  2EM6 A;  2UUB E;  3K6Q A;  3IWC A;  1XMQ E;  3ADL A;  2EPL X;  4DR6 E;  1YYO A;  2LRS A;  1Z1B A;  2EQ0 A;  3HXL A;  2JWO A;  2LV2 A;  2EPM X;  3EPJ A;  1SFE A;  2WZO A;  2EPK X;  4JI3 E;  2JVA A;  3DJW A;  4YY3 E;  1X3C A;  2EOO A;  5IT9 C;  1QU6 A;  4F2J C;  2JR1 A;  2EL5 A;  4KWY A;  3RMP A;  1WXR A;  2E5L E;  1N32 E;  5A6A A;  5AC4 A;  4M2Z A;  3IWD A;  1WHQ A;  2L2M A;  2EM9 A;  2EOX A;  1RMD A;  2LMZ A;  3TQM A;  3J81 C;  2HJJ A;  3EQ1 A;  3OML A;  1JK2 A;  2IHR 1;  2ADR A;  3T1H E;  1DQ3 A;  1X48 A;  1A1L A;  1A1K A;  1NCS A;  5A6K A;  1PJT A;  3MSW A;  4LF4 E;  2GHF A;  4AQY E;  5IXM B;  5KL7 A;  1HNX E;  4LU9 A;  3C4B A;  4J8Z A;  3VYY A;  4RHB B;  1XNQ E;  1L4S A;  1RC7 A;  2EM4 A;  1HNZ E;  2EE8 A;  4DV6 E;  5AAS A;  2MKD A;  5A6B A;  3JTZ A;  4TUG A;  4JI5 E;  2YU5 A;  4BCA A;  2EN2 A;  3ZOQ B;  4R2D A;  2V85 A;  2ODR C;  2L3C A;  4LFB E;  2CTD A;  1N33 E;  2EM3 A;  1PJS A;  4R8O A;  2LTS A;  1X5W A;  5FLX C;  4BC9 A;  4R2E A;  1WHN A;  2N8X A;  1ZAA C;  2YSO A;  2FTX B;  1FJG E;  2WBT A;  4DV2 E;  4ZYE A;  3HTX A;  2YTN A;  2F8B A;  5KL3 A;  2HGH A;  2YTI A;  4L5N C;  1YFH A;  4WXD A;  3L00 A;  2GPI A;  4DR1 E;  2V88 A;  2R1F A;  2EM8 A;  2EN7 A;  2EN6 A;  1DI2 A;  3MHS C;  1MEY C;  2NUE A;  4WSP A;  4NHR A;  2M1S A;  2EM5 A;  4KHP E;  2EM2 A;  2M9A A;  1N3G A;  4L8N A;  2EMK A;  5A6J A;  2YTO A;  4R2R A;  1ZBQ A;  1KYQ A;  2EMW A;  4JI1 E;  3J7Y p;  2DGC A;  1N36 E;  4JI6 E;  1X6F A;  4BC7 A;  2HC5 A;  4DUY E;  2EPC A;  2EMH A;  4O43 A;  4OX9 E;  4I8O A;  2YT4 A;  2JPA A;  2EN8 A;  1T38 A;  4WXC A;  3KZZ A;  1IBM E;  5A6B D;  4YHH E;  2YU8 A;  1WJP A;  4JV5 E;  2ELZ A;  2H36 X;  1YPN A;  4GEQ B;  3DF6 A;  2WBU A;  1TF6 A;  4X66 E;  2KOU A;  1BBG A;  4DV5 E;  4NZV A;  2EMG A;  3F6G A;  4HEI A;  2YTF A;  3HQ1 A;  3JAM C;  5F3W A;  4LF6 E;  4R2Q A;  2F4V E;  2EOM A;  1T4N A;  2DSY A;  5AE1 A;  1BB8 A;  1X49 A;  2EN1 A;  3MHH C;  3ADG A;  2DRP A;  1IBK E;  4DV7 E;  3THO B;  2L8T A;  2DMY A;  4F9A B;  2RPC A;  2LE2 A;  1A1G A;  4RH8 A;  2L92 A;  2DLK A;  2EN3 A;  3LML A;  4R2P A;  1XMO E;  1O0W A;  2EOQ A;  4WYQ B;  3J80 C;  2YWQ A;  1JK1 A;  2UUA E;  1RQ0 A;  3T1Y E;  1QNT A;  2YZT A;  5DNY A;  2EOY A;  2CPN A;  1HNW E;  1GQE A;  1EH6 A;  2M7Q A;  4OOG C;  2LJU A;  1UHZ A;  2L6M A;  1A1J A;  2VRD A;  2YRK A;  2M4I A;  1A1F A;  1ZR9 A;  2E1M A;  1LLM C;  4DR5 E;  4LFC E;  3BGH A;  3IWB A;  3P1X A;  4WPY A;  1SR9 A;  4JI4 E;  2EPU A;  3KWR A;  4Q35 B;  3J7A G;  4B3S E;  2ENH A; 
#chains in the Genus database with same CATH homology
 2EML A;  2ENA A;  1DGC A;  2GLI A;  1G2F C;  2EOR A;  2JP9 A;  2BB8 A;  4GZN C;  2EJ4 A;  2R1F A;  2ELY A;  2EPP A;  2EMI A;  3M99 B;  4IS1 C;  1TN9 A;  1X6E A;  2EM8 A;  2YTP A;  2DMI A;  2EN7 A;  2NAB A;  4X9J A;  1YUJ A;  1YUI A;  2EN6 A;  2EMA A;  2CT1 A;  3MHS C;  5KL5 A;  1A1H A;  1MEY C;  2EM6 A;  1P47 A;  2EM5 A;  2EOF A;  2EM2 A;  2EP3 A;  2WBS A;  2M9A A;  3EPK A;  2EMK A;  1TF3 A;  2YRH A;  2DLQ A;  2YTO A;  1Z1B A;  4R2R A;  2EQ0 A;  2EOZ A;  2EMW A;  2LV2 A;  3EPJ A;  2DGC A;  4IJD A;  1X6F A;  2EPC A;  2EMH A;  2ENC A;  1KJK A;  5KL6 A;  2D9H A;  1X3C A;  2EOO A;  4F2J C;  2I13 A;  2JPA A;  2EMZ A;  2EN8 A;  1UBD C;  1UN6 B;  2EL5 A;  2EOE A;  2E72 A;  2MDG A;  2YU8 A;  1WJP A;  2EOI A;  2ELZ A;  2EM9 A;  2EOX A;  1RMD A;  2EMY A;  1A1I A;  2WBU A;  3VHT B;  1TF6 A;  1JK2 A;  2ADR A;  1F2I G;  2YRM A;  4R2C A;  2EQ1 A;  2A25 A;  2EPX A;  3EPH A;  2EMG A;  2EOH A;  2YTJ A;  2EMF A;  2YTF A;  1A1L A;  2CSH A;  1A1K A;  1NCS A;  3EPL A;  2LVH A;  2EOS A;  2EOJ A;  2YTE A;  4R2Q A;  1ZU1 A;  3UK3 C;  2EOM A;  1X6H A;  1BB8 A;  2EL6 A;  2GHF A;  2EN1 A;  2YTG A;  4FK5 C;  3MHH C;  5KL7 A;  2EPA A;  2DRP A;  1B69 A;  2EPZ A;  4WSG A;  2MKN A;  5KL4 A;  2RPC A;  1AAY A;  2EM4 A;  2YTD A;  1A1G A;  2RSI A;  4R2A A;  2EE8 A;  2DLK A;  2EN3 A;  4M9V C;  1YSA C;  4R2P A;  2YSP A;  2MKD A;  2EL4 A;  2EOQ A;  2EMB A;  2EMX A;  4F6N A;  2EM7 A;  2WCC 3;  1JK1 A;  2YU5 A;  2PRT A;  5KL2 A;  2LO3 A;  2EOY A;  2EN2 A;  4R2D A;  2CTD A;  2EM0 A;  2EM3 A;  1A1J A;  2VRD A;  2LCE A;  2YRK A;  1X5W A;  4R2S A;  1ZR9 A;  1A1F A;  2LT7 A;  4F6M A;  4R2E A;  1BBO A;  1ZAA C;  2EN4 A;  2YSO A;  2YTQ A;  1LLM C;  2EQ3 A;  1G2D C;  2WBT A;  2EMC A;  2YTN A;  2J7J A;  5KL3 A;  2EPU A;  2EPR A;  2HGH A;  2YTI A;  2ENH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...