2EM0A

Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 224
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGMGEKTWKCRECDMCFSQASSLRLHQNVHVGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the 18th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em0A01
2EN8A 2JP9A 2EN4A 2CSHA 1TF3A 4R2AA 2YSPA 2YTOA 1NCSA 5KL4A 2YTIA 2DMIA 4IS1C 2R1FA 2EMKA 2MKNA 4R2EA 1F2IG 2EMFA 2EORA 2NABA 1JK2A 1WJPA 2EM8A 2ELYA 1X6HA 2WBTA 4F6NA 1B69A 4R2PA 2I13A 2EQ0A 1MEYC 5KL3A 1UN6B 2EOQA 2LT7A 2DLKA 2EMCA 4R2DA 2EMAA 1A1LA 2LCEA 4X9JA 2E72A 2ENAA 2EM0A 2D9HA 2EMZA 2YTGA 2YTEA 1AAYA 3EPHA 2JPAA 3MHHC 3MHSC 3VHTB 2EOMA 2YRKA 2EL5A 1LLMC 1A1IA 1BBOA 5KL2A 2EPAA 1X5WA 4IJDA 2WCC3 2EL4A 2EQ3A 2YSOA 1YSAC 2EOXA 4GZNC 1A1FA 2EPPA 4R2CA 1UBDC 5KL7A 2EL6A 1X6EA 1Z1BA 2LO3A 2EM4A 1P47A 2GLIA 4F2JC 2EM6A 2J7JA 5KL5A 1DGCA 2WBUA 1X3CA 4R2SA 4R2QA 1G2DC 2EM2A 2LV2A 2EMYA 2YTNA 4FK5C 5KL6A 2DRPA 2YTFA 3EPKA 2CTDA 4R2RA 2A25A 2EOJA 3EPLA 2WBSA 2EN3A 2EOEA 1A1KA 1X6FA 2EMLA 1BB8A 2MKDA 2ELZA 3EPJA 2EN6A 4F6MA 1ZAAC 2PRTA 2RSIA 3UK3C 2EOYA 2EOFA 1JK1A 2EM3A 2EMHA 2EMXA 2YTQA 2ENHA 2DLQA 2EOOA 2EJ4A 2ENCA 4WSGA 2EN7A 2ADRA 2MDGA 2EOZA 2VRDA 1A1GA 2YTPA 2EMGA 2LVHA 2YRMA 2YU8A 2EPRA 2EPZA 2EM7A 2EOIA 2EPUA 2M9AA 2EN2A 1KJKA 2EMWA 2EQ1A 2YTJA 1YUJA 2BB8A 2EOSA 1A1JA 2EP3A 2EOHA 2EE8A 2EM5A 2EN1A 4M9VC 2CT1A 2EMIA 2EM9A 2EMBA 3M99B 2EPCA 2DGCA 1TN9A 2HGHA 2YU5A 2GHFA 2YTDA 1ZU1A 1A1HA 1YUIA 1TF6A 1ZR9A 2EPXA 2RPCA 2YRHA 1G2FC 1RMDA
chains in the Genus database with same CATH superfamily
2EN8A 2JP9A 2CSHA 4WPYA 4R8OA 5LLQA 4R2AA 4X65E 2ODRC 4JI1E 2MKNA 4R2EA 2JXPA 2EM8A 2BBGA 4KZSA 1X6HA 5TSEA 3ADGA 1WHNA 1QU6A 3QG5C 3J80C 1B69A 2EPNA 4P78A 2I13A 1UN6B 4MLVA 2KHXA 1PJTA 2DLKA 3THOB 4R2DA 2M7QA 2LCEA 4GEQB 5IV8B 1UILA 2YTEA 1AAYA 2JPAA 2F8BA 2N8XA 4JI0E 2EOMA 2YRKA 2EL5A 1LLMC 4JI6E 2EPAA 1GQEA 4X62E 2WCC3 2LRSA 4DR2E 2EOXA 2IHR1 3F6HA 3BBGA 4K0KE 3HPSA 3IWDA 2YPNA 1P47A 4BC9A 4F2JC 3C4TA 3HTXA 2YTNA 2DRPA 4FK5C 1UHZA 2LUPB 2UXDE 1WHQA 4DV4E 4O24A 4WXCA 4WX9A 3ECRA 1DQ3A 2EOEA 1A1KA 1X6FA 2E1MA 2VQEE 2H36X 1ZAAC 2PRTA 2RSIA 2RS6A 4DMIA 4HTGA 1JK1A 4NHRA 1IBME 1YYWA 2B9DA 3AUZA 2L92A 1AH5A 4DR5E 2ENCA 1XMQE 2LE2A 2EN7A 2K4VA 3DJWA 2EOZA 2VRDA 2YRMA 2WZOA 4JV5E 2EPRA 2M9AA 2EN2A 4DV2E 1T4NA 1XMOE 4N4RB 2EOSA 2JWOA 4F9CB 3HXLA 3IWBA 2EM9A 4JI2E 2EMBA 2DGCA 2FGGA 2B7VA 1FJGE 4ZYEA 4BHBA 4BC7A 2DB2A 2HGHA 4DV0E 1QNTA 2L2NA 4DV5E 2UXCE 1ZR9A 2DMYA 2YRHA 1G2FC 3J7Yp 2MKDA 2LVHA 4OX9E 1TF3A 4WFTA 2EMFA 5AE1A 2KONA 2ELYA 2V8QB 2WBTA 4JI3E 4JYAE 2Q8UA 2EQ0A 4P7DA 1XNQE 4WYQB 2LT7A 4LFAE 3H09A 2EMZA 4LTYA 3VYXA 2VF1A 1HNWE 3MHSC 4NXME 3AV0A 1EKZA 1BBOA 2HJJA 3ADJA 4DR7E 4F54A 1T4OA 4B3ME 2V87A 5A69A 3L00A 1IMUA 1UBDC 4R2CA 2LO3A 2EM4A 2GLIA 5KL5A 4ZYDA 4R2QA 2EMYA 3C6KA 2NUFA 5CFFE 2YTFA 1EH6A 2RPCA 3EPKA 3VYYA 2GPIA 2K7IA 3C4BA 2JOXA 4O43A 2LTSA 2WBSA 1MGTA 1ZBQA 1T38A 4R03A 1BB8A 3J81C 5T6JA 2LTRA 3THNA 4GKKE 2EN6A 2EWLA 4F6MA 4ZYHA 1PKPA 1PJSA 2EPMX 1J26A 3ADIA 3BGHA 2L33A 4JI7E 2EM3A 4B3SE 2EMXA 2DLQA 2EOOA 4Q35B 1HNZE 5A2QC 2EJ4A 3KWRA 1T4LB 2I9IA 5LMNE 2MDGA 1T39A 1N32E 1A1GA 2LJUA 2YTPA 2YU8A 2EPUA 2EQ1A 1YUJA 1A1JA 2EPKX 4DKKA 4YHHE 2ZM6E 2EN1A 2YWQA 4M9VC 2CT1A 2DIXA 4NXNE 4OOGC 1TN9A 1IQOA 2L8TA 2MC6A 3ZOQB 2YU5A 2GHFA 4TUIA 1DI2A 3TQMA 2L3JA 1FKAE 1YUIA 4B3RE 2G7HA 4BS9A 1RC7A 1N33E 1GZ6A 2EN4A 3KZZA 4WSPA 4M30A 2YSPA 5LMUE 5KL4A 4IS1C 2R1FA 4L5NC 2EMKA 2EORA 1JK2A 4DUZE 4X66E 4LFCE 2UUAE 3RMPA 4DR3E 4R2PA 3JU0A 1MEYC 2YZTA 5KL3A 3P1XA 1N34E 3VK6A 2EMAA 2L3CA 4X9JA 5AE3A 2EM0A 2D9HA 2JOBA 2N3HA 3KZYA 3VHTB 1A1IA 2L2MA 2RS7A 2V83A 5IXMB 5BR8E 1X5WA 1GTKA 2N3GA 3FIGA 1WXRA 3T1YE 1YSAC 2R76A 4F9BB 1WRJA 2EPPA 5A6KA 2V88A 5KL7A 1X6EA 1Z1BA 3T1HE 2HHHE 2EM6A 5FLXC 3ADLA 1N36E 2CTDA 2EOJA 2EN3A 4NZVA 2EMLA 2B7TA 4TUGA 2ELZA 4LU9A 3EPJA 4DV1E 2NUGA 2DSYA 3UK3C 4ZYGA 4DUYE 1XNRE 2EMHA 1O0WA 2YTQA 3J7AG 4X8WA 3OTOE 1YYOA 1SR9A 1PJQA 2CPNA 4WSGA 1STUA 2ADRA 2UUBE 3JTZA 4B3TE 2F4VE 2VE7C 2EMGA 2HC5A 2EM7A 2EOIA 1KJKA 5AASA 2YT4A 4LF9E 2JVAA 2BB8A 2KOUA 4DV6E 2EP3A 2EOHA 2EM5A 3BF2A 2EMIA 2UU9E 2UXBE 3M99B 5DNYA 2EPCA 2MDRA 3OMLA 4JI5E 4BMJA 4GKJE 1SFEA 4BBYA 2V85A 5AE2A 5AC4A 1A1HA 2B3TB 2LJHA 2EPXA 5LL6R 2E5LE 2JY9A 2YTOA 5ADZA 1NCSA 2YTIA 2DMIA 2VQFE 4LF4E 2FTXB 4BCAA 2FV4B 2JR1A 2M4IA 1F2IG 2NABA 1IBLE 1YZ9A 1WJPA 1YPNA 4HEIA 1IQSA 1X49A 4F6NA 4LF6E 2M1SA 4DV7E 1X47A 4MLQA 4O4KA 4RHBB 1X48A 2EOQA 2NUEA 1ZBTA 4F9AB 2EMCA 1A1LA 2ODRD 4BHCA 2E72A 2ENAA 4KWYA 2YTGA 3DF6A 1BBGA 2MC5A 3MHHC 3EPHA 2RQLA 1HR0E 4X64E 5KL2A 4I8OA 1J5EE 2LUQA 4LF5E 2NA2A 4IJDA 2EL4A 2EQ3A 2JYAA 2RSMA 2YSOA 2L6MA 4GZNC 1A1FA 3HQ1A 5A6BD 1N3GA 3JAMC 2EL6A 3LMLA 1DGCA 2J7JA 2L2KB 3F6GA 1I94E 2WBUA 1X3CA 4R2SA 1G2DC 2EM2A 2LV2A 5KL6A 4Q28A 4R2RA 2A25A 5IT9C 3EPLA 1YYKA 3K6QA 3C6MA 3EQ1A 5A6JA 1RQ0A 1HNXE 4LF7E 4LF8E 4DV3E 5IWAE 4AQYE 4L8NA 2EZ6A 3HPZA 2EOYA 2EOFA 1EH8A 2ENHA 4KHPE 1IBKE 5A6BA 1YFHA 1NEIA 4J8ZA 4M0VA 2EPLX 4M2ZA 2LBSB 2EPZA 3MSWA 5F3WA 3LLHA 2EMWA 3IWCA 2YTJA 2V86A 5AC5A 4WXDA 4JI4E 1PDAA 2EE8A 4JI8E 5A6AA 3BIDA 4DR1E 4O5GA 4LFBE 1EH7A 2LMZA 2UUCE 4DR4E 1KYQA 4YY3E 2V89A 2YTDA 1ZU1A 4RH8A 1TF6A 1L4SA 4DR6E 2RTXA 2EPOA 1RMDA
chains in the Genus database with same CATH topology
2EN8A 2JP9A 2EN4A 2CSHA 1TF3A 4R2AA 2YSPA 2YTOA 1NCSA 5KL4A 2YTIA 2DMIA 4IS1C 2R1FA 2EMKA 2MKNA 4R2EA 1F2IG 2EMFA 2EORA 2NABA 1JK2A 1WJPA 2EM8A 2ELYA 1X6HA 2WBTA 4F6NA 1B69A 4R2PA 2I13A 2EQ0A 1MEYC 5KL3A 1UN6B 2EOQA 2LT7A 2DLKA 2EMCA 4R2DA 2EMAA 1A1LA 2LCEA 4X9JA 2E72A 2ENAA 2EM0A 2D9HA 2EMZA 2YTGA 2YTEA 1AAYA 3EPHA 2JPAA 3MHHC 3MHSC 3VHTB 2EOMA 2YRKA 2EL5A 1LLMC 1A1IA 1BBOA 5KL2A 2EPAA 1X5WA 4IJDA 2WCC3 2EL4A 2EQ3A 2YSOA 1YSAC 2EOXA 4GZNC 1A1FA 2EPPA 4R2CA 1UBDC 5KL7A 2EL6A 1X6EA 1Z1BA 2LO3A 2EM4A 1P47A 2GLIA 4F2JC 2EM6A 2J7JA 5KL5A 1DGCA 2WBUA 1X3CA 4R2SA 4R2QA 1G2DC 2EM2A 2LV2A 2EMYA 2YTNA 4FK5C 5KL6A 2DRPA 2YTFA 3EPKA 2CTDA 4R2RA 2A25A 2EOJA 3EPLA 2WBSA 2EN3A 2EOEA 1A1KA 1X6FA 2EMLA 1BB8A 2MKDA 2ELZA 3EPJA 2EN6A 4F6MA 1ZAAC 2PRTA 2RSIA 3UK3C 2EOYA 2EOFA 1JK1A 2EM3A 2EMHA 2EMXA 2YTQA 2ENHA 2DLQA 2EOOA 2EJ4A 2ENCA 4WSGA 2EN7A 2ADRA 2MDGA 2EOZA 2VRDA 1A1GA 2YTPA 2EMGA 2LVHA 2YRMA 2YU8A 2EPRA 2EPZA 2EM7A 2EOIA 2EPUA 2M9AA 2EN2A 1KJKA 2EMWA 2EQ1A 2YTJA 1YUJA 2BB8A 2EOSA 1A1JA 2EP3A 2EOHA 2EE8A 2EM5A 2EN1A 4M9VC 2CT1A 2EMIA 2EM9A 2EMBA 3M99B 2EPCA 2DGCA 1TN9A 2HGHA 2YU5A 2GHFA 2YTDA 1ZU1A 1A1HA 1YUIA 1TF6A 1ZR9A 2EPXA 2RPCA 2YRHA 1G2FC 1RMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  2JP9 A;  2EN4 A;  2CSH A;  1TF3 A;  4R2A A;  2YSP A;  2YTO A;  1NCS A;  5KL4 A;  2YTI A;  2DMI A;  4IS1 C;  2R1F A;  2EMK A;  2MKN A;  4R2E A;  1F2I G;  2EMF A;  2EOR A;  2NAB A;  1JK2 A;  1WJP A;  2EM8 A;  2ELY A;  1X6H A;  2WBT A;  4F6N A;  1B69 A;  4R2P A;  2I13 A;  2EQ0 A;  1MEY C;  5KL3 A;  1UN6 B;  2EOQ A;  2LT7 A;  2DLK A;  2EMC A;  4R2D A;  2EMA A;  1A1L A;  2LCE A;  4X9J A;  2E72 A;  2ENA A;  2EM0 A;  2D9H A;  2EMZ A;  2YTG A;  2YTE A;  1AAY A;  3EPH A;  2JPA A;  3MHH C;  3MHS C;  3VHT B;  2EOM A;  2YRK A;  2EL5 A;  1LLM C;  1A1I A;  1BBO A;  5KL2 A;  2EPA A;  1X5W A;  4IJD A;  2WCC 3;  2EL4 A;  2EQ3 A;  2YSO A;  1YSA C;  2EOX A;  4GZN C;  1A1F A;  2EPP A;  4R2C A;  1UBD C;  5KL7 A;  2EL6 A;  1X6E A;  1Z1B A;  2LO3 A;  2EM4 A;  1P47 A;  2GLI A;  4F2J C;  2EM6 A;  2J7J A;  5KL5 A;  1DGC A;  2WBU A;  1X3C A;  4R2S A;  4R2Q A;  1G2D C;  2EM2 A;  2LV2 A;  2EMY A;  2YTN A;  4FK5 C;  5KL6 A;  2DRP A;  2YTF A;  3EPK A;  2CTD A;  4R2R A;  2A25 A;  2EOJ A;  3EPL A;  2WBS A;  2EN3 A;  2EOE A;  1A1K A;  1X6F A;  2EML A;  1BB8 A;  2MKD A;  2ELZ A;  3EPJ A;  2EN6 A;  4F6M A;  1ZAA C;  2PRT A;  2RSI A;  3UK3 C;  2EOY A;  2EOF A;  1JK1 A;  2EM3 A;  2EMH A;  2EMX A;  2YTQ A;  2ENH A;  2DLQ A;  2EOO A;  2EJ4 A;  2ENC A;  4WSG A;  2EN7 A;  2ADR A;  2MDG A;  2EOZ A;  2VRD A;  1A1G A;  2YTP A;  2EMG A;  2LVH A;  2YRM A;  2YU8 A;  2EPR A;  2EPZ A;  2EM7 A;  2EOI A;  2EPU A;  2M9A A;  2EN2 A;  1KJK A;  2EMW A;  2EQ1 A;  2YTJ A;  1YUJ A;  2BB8 A;  2EOS A;  1A1J A;  2EP3 A;  2EOH A;  2EE8 A;  2EM5 A;  2EN1 A;  4M9V C;  2CT1 A;  2EMI A;  2EM9 A;  2EMB A;  3M99 B;  2EPC A;  2DGC A;  1TN9 A;  2HGH A;  2YU5 A;  2GHF A;  2YTD A;  1ZU1 A;  1A1H A;  1YUI A;  1TF6 A;  1ZR9 A;  2EPX A;  2RPC A;  2YRH A;  1G2F C;  1RMD A; 
#chains in the Genus database with same CATH topology
 2EN8 A;  2JP9 A;  2CSH A;  4WPY A;  4R8O A;  5LLQ A;  4R2A A;  4X65 E;  2ODR C;  4JI1 E;  2MKN A;  4R2E A;  2JXP A;  2EM8 A;  2BBG A;  4KZS A;  1X6H A;  5TSE A;  3ADG A;  1WHN A;  1QU6 A;  3QG5 C;  3J80 C;  1B69 A;  2EPN A;  4P78 A;  2I13 A;  1UN6 B;  4MLV A;  2KHX A;  1PJT A;  2DLK A;  3THO B;  4R2D A;  2M7Q A;  2LCE A;  4GEQ B;  5IV8 B;  1UIL A;  2YTE A;  1AAY A;  2JPA A;  2F8B A;  2N8X A;  4JI0 E;  2EOM A;  2YRK A;  2EL5 A;  1LLM C;  4JI6 E;  2EPA A;  1GQE A;  4X62 E;  2WCC 3;  2LRS A;  4DR2 E;  2EOX A;  2IHR 1;  3F6H A;  3BBG A;  4K0K E;  3HPS A;  3IWD A;  2YPN A;  1P47 A;  4BC9 A;  4F2J C;  3C4T A;  3HTX A;  2YTN A;  2DRP A;  4FK5 C;  1UHZ A;  2LUP B;  2UXD E;  1WHQ A;  4DV4 E;  4O24 A;  4WXC A;  4WX9 A;  3ECR A;  1DQ3 A;  2EOE A;  1A1K A;  1X6F A;  2E1M A;  2VQE E;  2H36 X;  1ZAA C;  2PRT A;  2RSI A;  2RS6 A;  4DMI A;  4HTG A;  1JK1 A;  4NHR A;  1IBM E;  1YYW A;  2B9D A;  3AUZ A;  2L92 A;  1AH5 A;  4DR5 E;  2ENC A;  1XMQ E;  2LE2 A;  2EN7 A;  2K4V A;  3DJW A;  2EOZ A;  2VRD A;  2YRM A;  2WZO A;  4JV5 E;  2EPR A;  2M9A A;  2EN2 A;  4DV2 E;  1T4N A;  1XMO E;  4N4R B;  2EOS A;  2JWO A;  4F9C B;  3HXL A;  3IWB A;  2EM9 A;  4JI2 E;  2EMB A;  2DGC A;  2FGG A;  2B7V A;  1FJG E;  4ZYE A;  4BHB A;  4BC7 A;  2DB2 A;  2HGH A;  4DV0 E;  1QNT A;  2L2N A;  4DV5 E;  2UXC E;  1ZR9 A;  2DMY A;  2YRH A;  1G2F C;  3J7Y p;  2MKD A;  2LVH A;  4OX9 E;  1TF3 A;  4WFT A;  2EMF A;  5AE1 A;  2KON A;  2ELY A;  2V8Q B;  2WBT A;  4JI3 E;  4JYA E;  2Q8U A;  2EQ0 A;  4P7D A;  1XNQ E;  4WYQ B;  2LT7 A;  4LFA E;  3H09 A;  2EMZ A;  4LTY A;  3VYX A;  2VF1 A;  1HNW E;  3MHS C;  4NXM E;  3AV0 A;  1EKZ A;  1BBO A;  2HJJ A;  3ADJ A;  4DR7 E;  4F54 A;  1T4O A;  4B3M E;  2V87 A;  5A69 A;  3L00 A;  1IMU A;  1UBD C;  4R2C A;  2LO3 A;  2EM4 A;  2GLI A;  5KL5 A;  4ZYD A;  4R2Q A;  2EMY A;  3C6K A;  2NUF A;  5CFF E;  2YTF A;  1EH6 A;  2RPC A;  3EPK A;  3VYY A;  2GPI A;  2K7I A;  3C4B A;  2JOX A;  4O43 A;  2LTS A;  2WBS A;  1MGT A;  1ZBQ A;  1T38 A;  4R03 A;  1BB8 A;  3J81 C;  5T6J A;  2LTR A;  3THN A;  4GKK E;  2EN6 A;  2EWL A;  4F6M A;  4ZYH A;  1PKP A;  1PJS A;  2EPM X;  1J26 A;  3ADI A;  3BGH A;  2L33 A;  4JI7 E;  2EM3 A;  4B3S E;  2EMX A;  2DLQ A;  2EOO A;  4Q35 B;  1HNZ E;  5A2Q C;  2EJ4 A;  3KWR A;  1T4L B;  2I9I A;  5LMN E;  2MDG A;  1T39 A;  1N32 E;  1A1G A;  2LJU A;  2YTP A;  2YU8 A;  2EPU A;  2EQ1 A;  1YUJ A;  1A1J A;  2EPK X;  4DKK A;  4YHH E;  2ZM6 E;  2EN1 A;  2YWQ A;  4M9V C;  2CT1 A;  2DIX A;  4NXN E;  4OOG C;  1TN9 A;  1IQO A;  2L8T A;  2MC6 A;  3ZOQ B;  2YU5 A;  2GHF A;  4TUI A;  1DI2 A;  3TQM A;  2L3J A;  1FKA E;  1YUI A;  4B3R E;  2G7H A;  4BS9 A;  1RC7 A;  1N33 E;  1GZ6 A;  2EN4 A;  3KZZ A;  4WSP A;  4M30 A;  2YSP A;  5LMU E;  5KL4 A;  4IS1 C;  2R1F A;  4L5N C;  2EMK A;  2EOR A;  1JK2 A;  4DUZ E;  4X66 E;  4LFC E;  2UUA E;  3RMP A;  4DR3 E;  4R2P A;  3JU0 A;  1MEY C;  2YZT A;  5KL3 A;  3P1X A;  1N34 E;  3VK6 A;  2EMA A;  2L3C A;  4X9J A;  5AE3 A;  2EM0 A;  2D9H A;  2JOB A;  2N3H A;  3KZY A;  3VHT B;  1A1I A;  2L2M A;  2RS7 A;  2V83 A;  5IXM B;  5BR8 E;  1X5W A;  1GTK A;  2N3G A;  3FIG A;  1WXR A;  3T1Y E;  1YSA C;  2R76 A;  4F9B B;  1WRJ A;  2EPP A;  5A6K A;  2V88 A;  5KL7 A;  1X6E A;  1Z1B A;  3T1H E;  2HHH E;  2EM6 A;  5FLX C;  3ADL A;  1N36 E;  2CTD A;  2EOJ A;  2EN3 A;  4NZV A;  2EML A;  2B7T A;  4TUG A;  2ELZ A;  4LU9 A;  3EPJ A;  4DV1 E;  2NUG A;  2DSY A;  3UK3 C;  4ZYG A;  4DUY E;  1XNR E;  2EMH A;  1O0W A;  2YTQ A;  3J7A G;  4X8W A;  3OTO E;  1YYO A;  1SR9 A;  1PJQ A;  2CPN A;  4WSG A;  1STU A;  2ADR A;  2UUB E;  3JTZ A;  4B3T E;  2F4V E;  2VE7 C;  2EMG A;  2HC5 A;  2EM7 A;  2EOI A;  1KJK A;  5AAS A;  2YT4 A;  4LF9 E;  2JVA A;  2BB8 A;  2KOU A;  4DV6 E;  2EP3 A;  2EOH A;  2EM5 A;  3BF2 A;  2EMI A;  2UU9 E;  2UXB E;  3M99 B;  5DNY A;  2EPC A;  2MDR A;  3OML A;  4JI5 E;  4BMJ A;  4GKJ E;  1SFE A;  4BBY A;  2V85 A;  5AE2 A;  5AC4 A;  1A1H A;  2B3T B;  2LJH A;  2EPX A;  5LL6 R;  2E5L E;  2JY9 A;  2YTO A;  5ADZ A;  1NCS A;  2YTI A;  2DMI A;  2VQF E;  4LF4 E;  2FTX B;  4BCA A;  2FV4 B;  2JR1 A;  2M4I A;  1F2I G;  2NAB A;  1IBL E;  1YZ9 A;  1WJP A;  1YPN A;  4HEI A;  1IQS A;  1X49 A;  4F6N A;  4LF6 E;  2M1S A;  4DV7 E;  1X47 A;  4MLQ A;  4O4K A;  4RHB B;  1X48 A;  2EOQ A;  2NUE A;  1ZBT A;  4F9A B;  2EMC A;  1A1L A;  2ODR D;  4BHC A;  2E72 A;  2ENA A;  4KWY A;  2YTG A;  3DF6 A;  1BBG A;  2MC5 A;  3MHH C;  3EPH A;  2RQL A;  1HR0 E;  4X64 E;  5KL2 A;  4I8O A;  1J5E E;  2LUQ A;  4LF5 E;  2NA2 A;  4IJD A;  2EL4 A;  2EQ3 A;  2JYA A;  2RSM A;  2YSO A;  2L6M A;  4GZN C;  1A1F A;  3HQ1 A;  5A6B D;  1N3G A;  3JAM C;  2EL6 A;  3LML A;  1DGC A;  2J7J A;  2L2K B;  3F6G A;  1I94 E;  2WBU A;  1X3C A;  4R2S A;  1G2D C;  2EM2 A;  2LV2 A;  5KL6 A;  4Q28 A;  4R2R A;  2A25 A;  5IT9 C;  3EPL A;  1YYK A;  3K6Q A;  3C6M A;  3EQ1 A;  5A6J A;  1RQ0 A;  1HNX E;  4LF7 E;  4LF8 E;  4DV3 E;  5IWA E;  4AQY E;  4L8N A;  2EZ6 A;  3HPZ A;  2EOY A;  2EOF A;  1EH8 A;  2ENH A;  4KHP E;  1IBK E;  5A6B A;  1YFH A;  1NEI A;  4J8Z A;  4M0V A;  2EPL X;  4M2Z A;  2LBS B;  2EPZ A;  3MSW A;  5F3W A;  3LLH A;  2EMW A;  3IWC A;  2YTJ A;  2V86 A;  5AC5 A;  4WXD A;  4JI4 E;  1PDA A;  2EE8 A;  4JI8 E;  5A6A A;  3BID A;  4DR1 E;  4O5G A;  4LFB E;  1EH7 A;  2LMZ A;  2UUC E;  4DR4 E;  1KYQ A;  4YY3 E;  2V89 A;  2YTD A;  1ZU1 A;  4RH8 A;  1TF6 A;  1L4S A;  4DR6 E;  2RTX A;  2EPO A;  1RMD A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  2JP9 A;  2EN4 A;  2CSH A;  1TF3 A;  4R2A A;  2YSP A;  2YTO A;  1NCS A;  5KL4 A;  2YTI A;  2DMI A;  4IS1 C;  2R1F A;  2EMK A;  2MKN A;  4R2E A;  1F2I G;  2EMF A;  2EOR A;  2NAB A;  1JK2 A;  1WJP A;  2EM8 A;  2ELY A;  1X6H A;  2WBT A;  4F6N A;  1B69 A;  4R2P A;  2I13 A;  2EQ0 A;  1MEY C;  5KL3 A;  1UN6 B;  2EOQ A;  2LT7 A;  2DLK A;  2EMC A;  4R2D A;  2EMA A;  1A1L A;  2LCE A;  4X9J A;  2E72 A;  2ENA A;  2EM0 A;  2D9H A;  2EMZ A;  2YTG A;  2YTE A;  1AAY A;  3EPH A;  2JPA A;  3MHH C;  3MHS C;  3VHT B;  2EOM A;  2YRK A;  2EL5 A;  1LLM C;  1A1I A;  1BBO A;  5KL2 A;  2EPA A;  1X5W A;  4IJD A;  2WCC 3;  2EL4 A;  2EQ3 A;  2YSO A;  1YSA C;  2EOX A;  4GZN C;  1A1F A;  2EPP A;  4R2C A;  1UBD C;  5KL7 A;  2EL6 A;  1X6E A;  1Z1B A;  2LO3 A;  2EM4 A;  1P47 A;  2GLI A;  4F2J C;  2EM6 A;  2J7J A;  5KL5 A;  1DGC A;  2WBU A;  1X3C A;  4R2S A;  4R2Q A;  1G2D C;  2EM2 A;  2LV2 A;  2EMY A;  2YTN A;  4FK5 C;  5KL6 A;  2DRP A;  2YTF A;  3EPK A;  2CTD A;  4R2R A;  2A25 A;  2EOJ A;  3EPL A;  2WBS A;  2EN3 A;  2EOE A;  1A1K A;  1X6F A;  2EML A;  1BB8 A;  2MKD A;  2ELZ A;  3EPJ A;  2EN6 A;  4F6M A;  1ZAA C;  2PRT A;  2RSI A;  3UK3 C;  2EOY A;  2EOF A;  1JK1 A;  2EM3 A;  2EMH A;  2EMX A;  2YTQ A;  2ENH A;  2DLQ A;  2EOO A;  2EJ4 A;  2ENC A;  4WSG A;  2EN7 A;  2ADR A;  2MDG A;  2EOZ A;  2VRD A;  1A1G A;  2YTP A;  2EMG A;  2LVH A;  2YRM A;  2YU8 A;  2EPR A;  2EPZ A;  2EM7 A;  2EOI A;  2EPU A;  2M9A A;  2EN2 A;  1KJK A;  2EMW A;  2EQ1 A;  2YTJ A;  1YUJ A;  2BB8 A;  2EOS A;  1A1J A;  2EP3 A;  2EOH A;  2EE8 A;  2EM5 A;  2EN1 A;  4M9V C;  2CT1 A;  2EMI A;  2EM9 A;  2EMB A;  3M99 B;  2EPC A;  2DGC A;  1TN9 A;  2HGH A;  2YU5 A;  2GHF A;  2YTD A;  1ZU1 A;  1A1H A;  1YUI A;  1TF6 A;  1ZR9 A;  2EPX A;  2RPC A;  2YRH A;  1G2F C;  1RMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...