2EM0A

Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 224
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGMGEKTWKCRECDMCFSQASSLRLHQNVHVGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 224
publication title Solution structure of the 18th zf-C2H2 domain from human Zinc finger protein 224
rcsb
source organism Homo sapiens
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em0A01
1A1HA 2ENCA 2I13A 2EOIA 1BB8A 2EOYA 2YTNA 2EPCA 4FK5C 1F2IG 2EN7A 2PRTA 5KL6A 2CSHA 2YTEA 2WBTA 2J7JA 1A1IA 1MEYC 1A1JA 2EM9A 1ZU1A 2YTOA 2EMGA 2WBSA 1WJPA 2D9HA 2RPCA 2EM7A 2YRMA 2EMBA 1NCSA 2EL6A 2BB8A 2ADRA 2EM5A 2ENAA 2EORA 5KL3A 1YUIA 2EMZA 2EMHA 2EMYA 2EN8A 2YTPA 2YTDA 2EMCA 2A25A 1UN6B 2EN6A 2EJ4A 1YUJA 2EP3A 2YTGA 1X6FA 2WBUA 4M9VC 1DGCA 2YSOA 2EPPA 2EQ0A 2EOQA 1JK2A 2WCC3 1JK1A 4GZNC 2EM2A 2NABA 2EN3A 2LCEA 1X3CA 1UBDC 3EPKA 2JP9A 2EQ1A 2EPUA 2EOZA 4IS1C 3VHTB 2EPAA 2RSIA 2EN1A 1LLMC 2DMIA 1X6EA 2EL5A 2EOMA 2EL4A 5KL7A 1A1GA 2EN2A 2YRKA 4F6MA 2EN4A 4R2RA 2GLIA 1A1FA 4R2SA 4X9JA 2YTJA 3EPJA 2MKNA 4R2DA 2R1FA 2MKDA 3M99B 1TF6A 3MHHC 2EM3A 4WSGA 2EE8A 2EPXA 2EM0A 1G2DC 1BBOA 2EM6A 2EMWA 2GHFA 1RMDA 3UK3C 2EOFA 2LO3A 2DGCA 1ZAAC 1ZR9A 2HGHA 4R2PA 2ELYA 2M9AA 2EOSA 5KL4A 1TF3A 2LV2A 1YSAC 2YSPA 2EMKA 2LVHA 2EOXA 2YRHA 4R2CA 2EM8A 2EOJA 4R2QA 1AAYA 1A1KA 1X5WA 5KL2A 2EOEA 4F6NA 4R2EA 2CTDA 2DLKA 2EPZA 2JPAA 1Z1BA 1B69A 2EMAA 2EMLA 1X6HA 3EPHA 2EQ3A 2YTFA 2EM4A 2DRPA 2ENHA 1KJKA 3EPLA 1A1LA 2EOHA 2YU5A 2YTIA 2EMXA 3MHSC 4F2JC 2EPRA 2LT7A 2YTQA 2E72A 1TN9A 2EOOA 2YU8A 2CT1A 4R2AA 4IJDA 1P47A 2VRDA 2EMIA 2EMFA 2MDGA 2DLQA 1G2FC 2ELZA 5KL5A
chains in the Genus database with same CATH superfamily
1MGTA 4L8NA 2I13A 4JI1E 2ODRD 1BB8A 1WXRA 2EOYA 4NHRA 2EPCA 1UILA 1I94E 2EN7A 3F6GA 4X64E 2J7JA 1A1IA 2MC6A 1MEYC 1KYQA 2ODRC 4F9CB 4LF6E 1UHZA 4R8OA 4NXME 2WBSA 3ECRA 4DV5E 5A6KA 1RQ0A 5LLQA 1NCSA 2ENAA 2LUQA 1N33E 2EMZA 4DR3E 2EMYA 2M1SA 2BBGA 2V87A 1YYOA 2MDRA 2UUCE 1UN6B 1YYWA 2EJ4A 3BBGA 3L00A 1YUJA 2WBUA 3TQMA 4JV5E 3DJWA 4P7DA 2EM2A 4P78A 4KZSA 2EN3A 2LUPB 2EPNA 5IXMB 1UBDC 2EPLX 5AC5A 2EQ1A 2EPUA 1QU6A 4O24A 2EPKX 4B3RE 2YPNA 1LLMC 4LFAE 4X66E 1X6EA 2EL5A 1GTKA 2EL4A 1YZ9A 2EN2A 4K0KE 4WYQB 5AE2A 1HNZE 4R2SA 2CPNA 5FLXC 2YTJA 2LTRA 2LTSA 2MKDA 3MHHC 4WSGA 1G2DC 2KHXA 2EM6A 2NUEA 1SFEA 2V83A 2UUAE 2EOFA 1ZAAC 1L4SA 3HPSA 4M0VA 2LJHA 2LV2A 3EQ1A 5AE3A 2LVHA 2EOJA 4R2QA 2M4IA 2NUGA 1X5WA 5LL6R 3MSWA 2CTDA 2DLKA 2EPZA 4AQYE 3RMPA 3T1YE 1WHQA 2JPAA 3OMLA 2JY9A 2ZM6E 1T4LB 1Z1BA 2EMAA 4BHCA 4LFBE 1X6HA 3EPHA 3J7Yp 3EPLA 1XMOE 2YU5A 2LBSB 2EMXA 1IMUA 2UUBE 2LT7A 3LLHA 2L2NA 2YU8A 2V8QB 1X47A 2H36X 4RH8A 5TSEA 2EMIA 2F4VE 2YT4A 4JI0E 2DLQA 1G2FC 1GQEA 1A1HA 4LF4E 4DR1E 2EPOA 2YTNA 4I8OA 1N34E 2PRTA 5KL6A 2WBTA 2VQEE 3VYYA 1A1JA 5AE1A 2EM9A 3T1HE 4JI4E 2EMGA 4DKKA 4BC7A 1X49A 1T38A 2EL6A 2EM5A 5A6BA 1IQOA 1SR9A 4DR7E 2EN8A 2KOUA 2EMCA 2L8TA 2EN6A 5A6JA 1YYKA 2EP3A 2YTGA 3AUZA 3P1XA 2NUFA 4B3TE 4DR5E 3IWDA 2EQ0A 2V89A 1JK2A 3BF2A 1EH6A 2FV4B 3HQ1A 4LF9E 1X3CA 2JP9A 1IBME 2F8BA 4WXCA 4DV6E 2EOZA 4IS1C 1N36E 3ADIA 3VHTB 4KHPE 4DUYE 2DMIA 4DR6E 2EOMA 2L33A 1A1GA 1ZBTA 1BBGA 2EN4A 3C4BA 2GLIA 3F6HA 1A1FA 3EPJA 3KZYA 4KWYA 4JI6E 3M99B 2UXCE 2EPMX 2EM3A 4LU9A 2EE8A 1BBOA 1XMQE 4DMIA 1RMDA 3UK3C 2VF1A 4RHBB 2JWOA 4BC9A 2VQFE 3JAMC 4HEIA 4R2PA 2HC5A 2M9AA 2B9DA 2EOSA 5KL4A 1TF3A 2YSPA 4LF5E 4R03A 4TUGA 1DI2A 3THOB 2YRHA 5T6JA 1T4NA 2HHHE 4WSPA 4MLVA 2JYAA 5KL2A 4TUIA 4Q35B 2MC5A 2N3HA 1X48A 2JR1A 1DQ3A 2B7TA 1PDAA 2EMLA 2RS7A 2EZ6A 1EKZA 2EQ3A 5AASA 2DRPA 5A6AA 1A1LA 4HTGA 4GEQB 2B3TB 3ADJA 4X8WA 2EPRA 5DNYA 2L3JA 2LE2A 3KZZA 2E72A 2DIXA 2M7QA 3LMLA 2L6MA 1T39A 4DR4E 2VRDA 4BCAA 2MDGA 2DSYA 5KL5A 4X65E 4ZYDA 2ENCA 2V88A 3OTOE 4LFCE 2YTEA 5ADZA 5A69A 1N3GA 4YY3E 4ZYHA 3K6QA 2KONA 2L2KB 4JI3E 1ZU1A 2YTOA 2L3CA 1NEIA 2L92A 2RSMA 2N8XA 3ZOQB 2D9HA 2RPCA 2EM7A 1J5EE 2EMBA 3AV0A 2BB8A 1HNXE 2EORA 1YUIA 2DMYA 2EMHA 2YTPA 1IBKE 2V86A 2YTDA 2A25A 4WX9A 3J81C 5BR8E 1XNQE 1RC7A 2EPPA 2EOQA 4B3SE 2WCC3 1JK1A 1GZ6A 3FIGA 4BMJA 5A2QC 2RQLA 2LCEA 2YZTA 4O43A 1HR0E 2IHR1 3H09A 1HNWE 2EPAA 4ZYEA 3BGHA 2GPIA 4F9BB 5KL7A 4B3ME 1EH8A 4F6MA 3KWRA 2WZOA 4R2RA 1PJSA 2JOXA 4WFTA 3QG5C 1TF6A 2N3GA 1PJQA 1QNTA 2VE7C 4DV1E 4JYAE 2EMWA 1T4OA 3J7AG 2LO3A 2DGCA 2HGHA 1ZR9A 2Q8UA 4LF8E 1FKAE 2EMKA 4R2CA 4WXDA 2E1MA 5LMNE 4LF7E 1A1KA 2EOEA 4LTYA 4J8ZA 1XNRE 2UXBE 2UXDE 4O5GA 1B69A 3C6MA 2YTFA 3VYXA 3BIDA 2EOHA 3HXLA 2YTIA 3MHSC 2K4VA 4F2JC 1YPNA 2YTQA 3JTZA 3DF6A 2R76A 2CT1A 4JI7E 4DV7E 1WRJA 4OOGC 2EMFA 4JI8E 4X62E 2ELZA 2EOIA 4JI5E 1F2IG 4FK5C 4BBYA 3HPZA 4O4KA 2CSHA 2V85A 2NA2A 4MLQA 2YWQA 2K7IA 1FJGE 4F9AB 5LMUE 3IWBA 3THNA 4DV4E 1WJPA 3IWCA 2YRMA 5A6BD 2ADRA 2G7HA 4WPYA 5KL3A 4ZYGA 4M30A 4JI2E 1IBLE 2HJJA 1J26A 1X6FA 3C4TA 4M9VC 1DGCA 2UU9E 2EWLA 2YSOA 2LRSA 2JXPA 4DV3E 4GZNC 2NABA 4DV2E 4BHBA 3EPKA 1AH5A 1N32E 4Q28A 2JVAA 5IV8B 2I9IA 2RSIA 3C6KA 2EN1A 5CFFE 4F54A 2RS6A 2YRKA 3ADLA 4GKKE 4M2ZA 4X9JA 2MKNA 1PKPA 2E5LE 4R2DA 4DR2E 2R1FA 1WHNA 1YFHA 4L5NC 2EPXA 2EM0A 2JOBA 2GHFA 4YHHE 2B7VA 3J80C 2ELYA 1YSAC 1EH7A 4OX9E 3JU0A 2EOXA 2L2MA 2EM8A 2FTXB 1AAYA 4DV0E 3VK6A 4F6NA 4R2EA 2LMZA 4NZVA 1O0WA 4DUZE 3HTXA 2FGGA 2EM4A 2ENHA 1KJKA 5IWAE 5AC4A 1ZBQA 2RTXA 4NXNE 1IQSA 4BS9A 5F3WA 1TN9A 2EOOA 4R2AA 4N4RB 1PJTA 4IJDA 1P47A 1STUA 3ADGA 2DB2A 5IT9C 4GKJE 2LJUA
chains in the Genus database with same CATH topology
1A1HA 2ENCA 2I13A 2EOIA 1BB8A 2EOYA 2YTNA 2EPCA 4FK5C 1F2IG 2EN7A 2PRTA 5KL6A 2CSHA 2YTEA 2WBTA 2J7JA 1A1IA 1MEYC 1A1JA 2EM9A 1ZU1A 2YTOA 2EMGA 2WBSA 1WJPA 2D9HA 2RPCA 2EM7A 2YRMA 2EMBA 1NCSA 2EL6A 2BB8A 2ADRA 2EM5A 2ENAA 2EORA 5KL3A 1YUIA 2EMZA 2EMHA 2EMYA 2EN8A 2YTPA 2YTDA 2EMCA 2A25A 1UN6B 2EN6A 2EJ4A 1YUJA 2EP3A 2YTGA 1X6FA 2WBUA 4M9VC 1DGCA 2YSOA 2EPPA 2EQ0A 2EOQA 1JK2A 2WCC3 1JK1A 4GZNC 2EM2A 2NABA 2EN3A 2LCEA 1X3CA 1UBDC 3EPKA 2JP9A 2EQ1A 2EPUA 2EOZA 4IS1C 3VHTB 2EPAA 2RSIA 2EN1A 1LLMC 2DMIA 1X6EA 2EL5A 2EOMA 2EL4A 5KL7A 1A1GA 2EN2A 2YRKA 4F6MA 2EN4A 4R2RA 2GLIA 1A1FA 4R2SA 4X9JA 2YTJA 3EPJA 2MKNA 4R2DA 2R1FA 2MKDA 3M99B 1TF6A 3MHHC 2EM3A 4WSGA 2EE8A 2EPXA 2EM0A 1G2DC 1BBOA 2EM6A 2EMWA 2GHFA 1RMDA 3UK3C 2EOFA 2LO3A 2DGCA 1ZAAC 1ZR9A 2HGHA 4R2PA 2ELYA 2M9AA 2EOSA 5KL4A 1TF3A 2LV2A 1YSAC 2YSPA 2EMKA 2LVHA 2EOXA 2YRHA 4R2CA 2EM8A 2EOJA 4R2QA 1AAYA 1A1KA 1X5WA 5KL2A 2EOEA 4F6NA 4R2EA 2CTDA 2DLKA 2EPZA 2JPAA 1Z1BA 1B69A 2EMAA 2EMLA 1X6HA 3EPHA 2EQ3A 2YTFA 2EM4A 2DRPA 2ENHA 1KJKA 3EPLA 1A1LA 2EOHA 2YU5A 2YTIA 2EMXA 3MHSC 4F2JC 2EPRA 2LT7A 2YTQA 2E72A 1TN9A 2EOOA 2YU8A 2CT1A 4R2AA 4IJDA 1P47A 2VRDA 2EMIA 2EMFA 2MDGA 2DLQA 1G2FC 2ELZA 5KL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1H A;  2ENC A;  2I13 A;  2EOI A;  1BB8 A;  2EOY A;  2YTN A;  2EPC A;  4FK5 C;  1F2I G;  2EN7 A;  2PRT A;  5KL6 A;  2CSH A;  2YTE A;  2WBT A;  2J7J A;  1A1I A;  1MEY C;  1A1J A;  2EM9 A;  1ZU1 A;  2YTO A;  2EMG A;  2WBS A;  1WJP A;  2D9H A;  2RPC A;  2EM7 A;  2YRM A;  2EMB A;  1NCS A;  2EL6 A;  2BB8 A;  2ADR A;  2EM5 A;  2ENA A;  2EOR A;  5KL3 A;  1YUI A;  2EMZ A;  2EMH A;  2EMY A;  2EN8 A;  2YTP A;  2YTD A;  2EMC A;  2A25 A;  1UN6 B;  2EN6 A;  2EJ4 A;  1YUJ A;  2EP3 A;  2YTG A;  1X6F A;  2WBU A;  4M9V C;  1DGC A;  2YSO A;  2EPP A;  2EQ0 A;  2EOQ A;  1JK2 A;  2WCC 3;  1JK1 A;  4GZN C;  2EM2 A;  2NAB A;  2EN3 A;  2LCE A;  1X3C A;  1UBD C;  3EPK A;  2JP9 A;  2EQ1 A;  2EPU A;  2EOZ A;  4IS1 C;  3VHT B;  2EPA A;  2RSI A;  2EN1 A;  1LLM C;  2DMI A;  1X6E A;  2EL5 A;  2EOM A;  2EL4 A;  5KL7 A;  1A1G A;  2EN2 A;  2YRK A;  4F6M A;  2EN4 A;  4R2R A;  2GLI A;  1A1F A;  4R2S A;  4X9J A;  2YTJ A;  3EPJ A;  2MKN A;  4R2D A;  2R1F A;  2MKD A;  3M99 B;  1TF6 A;  3MHH C;  2EM3 A;  4WSG A;  2EE8 A;  2EPX A;  2EM0 A;  1G2D C;  1BBO A;  2EM6 A;  2EMW A;  2GHF A;  1RMD A;  3UK3 C;  2EOF A;  2LO3 A;  2DGC A;  1ZAA C;  1ZR9 A;  2HGH A;  4R2P A;  2ELY A;  2M9A A;  2EOS A;  5KL4 A;  1TF3 A;  2LV2 A;  1YSA C;  2YSP A;  2EMK A;  2LVH A;  2EOX A;  2YRH A;  4R2C A;  2EM8 A;  2EOJ A;  4R2Q A;  1AAY A;  1A1K A;  1X5W A;  5KL2 A;  2EOE A;  4F6N A;  4R2E A;  2CTD A;  2DLK A;  2EPZ A;  2JPA A;  1Z1B A;  1B69 A;  2EMA A;  2EML A;  1X6H A;  3EPH A;  2EQ3 A;  2YTF A;  2EM4 A;  2DRP A;  2ENH A;  1KJK A;  3EPL A;  1A1L A;  2EOH A;  2YU5 A;  2YTI A;  2EMX A;  3MHS C;  4F2J C;  2EPR A;  2LT7 A;  2YTQ A;  2E72 A;  1TN9 A;  2EOO A;  2YU8 A;  2CT1 A;  4R2A A;  4IJD A;  1P47 A;  2VRD A;  2EMI A;  2EMF A;  2MDG A;  2DLQ A;  1G2F C;  2ELZ A;  5KL5 A; 
#chains in the Genus database with same CATH topology
 1MGT A;  4L8N A;  2I13 A;  4JI1 E;  2ODR D;  1BB8 A;  1WXR A;  2EOY A;  4NHR A;  2EPC A;  1UIL A;  1I94 E;  2EN7 A;  3F6G A;  4X64 E;  2J7J A;  1A1I A;  2MC6 A;  1MEY C;  1KYQ A;  2ODR C;  4F9C B;  4LF6 E;  1UHZ A;  4R8O A;  4NXM E;  2WBS A;  3ECR A;  4DV5 E;  5A6K A;  1RQ0 A;  5LLQ A;  1NCS A;  2ENA A;  2LUQ A;  1N33 E;  2EMZ A;  4DR3 E;  2EMY A;  2M1S A;  2BBG A;  2V87 A;  1YYO A;  2MDR A;  2UUC E;  1UN6 B;  1YYW A;  2EJ4 A;  3BBG A;  3L00 A;  1YUJ A;  2WBU A;  3TQM A;  4JV5 E;  3DJW A;  4P7D A;  2EM2 A;  4P78 A;  4KZS A;  2EN3 A;  2LUP B;  2EPN A;  5IXM B;  1UBD C;  2EPL X;  5AC5 A;  2EQ1 A;  2EPU A;  1QU6 A;  4O24 A;  2EPK X;  4B3R E;  2YPN A;  1LLM C;  4LFA E;  4X66 E;  1X6E A;  2EL5 A;  1GTK A;  2EL4 A;  1YZ9 A;  2EN2 A;  4K0K E;  4WYQ B;  5AE2 A;  1HNZ E;  4R2S A;  2CPN A;  5FLX C;  2YTJ A;  2LTR A;  2LTS A;  2MKD A;  3MHH C;  4WSG A;  1G2D C;  2KHX A;  2EM6 A;  2NUE A;  1SFE A;  2V83 A;  2UUA E;  2EOF A;  1ZAA C;  1L4S A;  3HPS A;  4M0V A;  2LJH A;  2LV2 A;  3EQ1 A;  5AE3 A;  2LVH A;  2EOJ A;  4R2Q A;  2M4I A;  2NUG A;  1X5W A;  5LL6 R;  3MSW A;  2CTD A;  2DLK A;  2EPZ A;  4AQY E;  3RMP A;  3T1Y E;  1WHQ A;  2JPA A;  3OML A;  2JY9 A;  2ZM6 E;  1T4L B;  1Z1B A;  2EMA A;  4BHC A;  4LFB E;  1X6H A;  3EPH A;  3J7Y p;  3EPL A;  1XMO E;  2YU5 A;  2LBS B;  2EMX A;  1IMU A;  2UUB E;  2LT7 A;  3LLH A;  2L2N A;  2YU8 A;  2V8Q B;  1X47 A;  2H36 X;  4RH8 A;  5TSE A;  2EMI A;  2F4V E;  2YT4 A;  4JI0 E;  2DLQ A;  1G2F C;  1GQE A;  1A1H A;  4LF4 E;  4DR1 E;  2EPO A;  2YTN A;  4I8O A;  1N34 E;  2PRT A;  5KL6 A;  2WBT A;  2VQE E;  3VYY A;  1A1J A;  5AE1 A;  2EM9 A;  3T1H E;  4JI4 E;  2EMG A;  4DKK A;  4BC7 A;  1X49 A;  1T38 A;  2EL6 A;  2EM5 A;  5A6B A;  1IQO A;  1SR9 A;  4DR7 E;  2EN8 A;  2KOU A;  2EMC A;  2L8T A;  2EN6 A;  5A6J A;  1YYK A;  2EP3 A;  2YTG A;  3AUZ A;  3P1X A;  2NUF A;  4B3T E;  4DR5 E;  3IWD A;  2EQ0 A;  2V89 A;  1JK2 A;  3BF2 A;  1EH6 A;  2FV4 B;  3HQ1 A;  4LF9 E;  1X3C A;  2JP9 A;  1IBM E;  2F8B A;  4WXC A;  4DV6 E;  2EOZ A;  4IS1 C;  1N36 E;  3ADI A;  3VHT B;  4KHP E;  4DUY E;  2DMI A;  4DR6 E;  2EOM A;  2L33 A;  1A1G A;  1ZBT A;  1BBG A;  2EN4 A;  3C4B A;  2GLI A;  3F6H A;  1A1F A;  3EPJ A;  3KZY A;  4KWY A;  4JI6 E;  3M99 B;  2UXC E;  2EPM X;  2EM3 A;  4LU9 A;  2EE8 A;  1BBO A;  1XMQ E;  4DMI A;  1RMD A;  3UK3 C;  2VF1 A;  4RHB B;  2JWO A;  4BC9 A;  2VQF E;  3JAM C;  4HEI A;  4R2P A;  2HC5 A;  2M9A A;  2B9D A;  2EOS A;  5KL4 A;  1TF3 A;  2YSP A;  4LF5 E;  4R03 A;  4TUG A;  1DI2 A;  3THO B;  2YRH A;  5T6J A;  1T4N A;  2HHH E;  4WSP A;  4MLV A;  2JYA A;  5KL2 A;  4TUI A;  4Q35 B;  2MC5 A;  2N3H A;  1X48 A;  2JR1 A;  1DQ3 A;  2B7T A;  1PDA A;  2EML A;  2RS7 A;  2EZ6 A;  1EKZ A;  2EQ3 A;  5AAS A;  2DRP A;  5A6A A;  1A1L A;  4HTG A;  4GEQ B;  2B3T B;  3ADJ A;  4X8W A;  2EPR A;  5DNY A;  2L3J A;  2LE2 A;  3KZZ A;  2E72 A;  2DIX A;  2M7Q A;  3LML A;  2L6M A;  1T39 A;  4DR4 E;  2VRD A;  4BCA A;  2MDG A;  2DSY A;  5KL5 A;  4X65 E;  4ZYD A;  2ENC A;  2V88 A;  3OTO E;  4LFC E;  2YTE A;  5ADZ A;  5A69 A;  1N3G A;  4YY3 E;  4ZYH A;  3K6Q A;  2KON A;  2L2K B;  4JI3 E;  1ZU1 A;  2YTO A;  2L3C A;  1NEI A;  2L92 A;  2RSM A;  2N8X A;  3ZOQ B;  2D9H A;  2RPC A;  2EM7 A;  1J5E E;  2EMB A;  3AV0 A;  2BB8 A;  1HNX E;  2EOR A;  1YUI A;  2DMY A;  2EMH A;  2YTP A;  1IBK E;  2V86 A;  2YTD A;  2A25 A;  4WX9 A;  3J81 C;  5BR8 E;  1XNQ E;  1RC7 A;  2EPP A;  2EOQ A;  4B3S E;  2WCC 3;  1JK1 A;  1GZ6 A;  3FIG A;  4BMJ A;  5A2Q C;  2RQL A;  2LCE A;  2YZT A;  4O43 A;  1HR0 E;  2IHR 1;  3H09 A;  1HNW E;  2EPA A;  4ZYE A;  3BGH A;  2GPI A;  4F9B B;  5KL7 A;  4B3M E;  1EH8 A;  4F6M A;  3KWR A;  2WZO A;  4R2R A;  1PJS A;  2JOX A;  4WFT A;  3QG5 C;  1TF6 A;  2N3G A;  1PJQ A;  1QNT A;  2VE7 C;  4DV1 E;  4JYA E;  2EMW A;  1T4O A;  3J7A G;  2LO3 A;  2DGC A;  2HGH A;  1ZR9 A;  2Q8U A;  4LF8 E;  1FKA E;  2EMK A;  4R2C A;  4WXD A;  2E1M A;  5LMN E;  4LF7 E;  1A1K A;  2EOE A;  4LTY A;  4J8Z A;  1XNR E;  2UXB E;  2UXD E;  4O5G A;  1B69 A;  3C6M A;  2YTF A;  3VYX A;  3BID A;  2EOH A;  3HXL A;  2YTI A;  3MHS C;  2K4V A;  4F2J C;  1YPN A;  2YTQ A;  3JTZ A;  3DF6 A;  2R76 A;  2CT1 A;  4JI7 E;  4DV7 E;  1WRJ A;  4OOG C;  2EMF A;  4JI8 E;  4X62 E;  2ELZ A;  2EOI A;  4JI5 E;  1F2I G;  4FK5 C;  4BBY A;  3HPZ A;  4O4K A;  2CSH A;  2V85 A;  2NA2 A;  4MLQ A;  2YWQ A;  2K7I A;  1FJG E;  4F9A B;  5LMU E;  3IWB A;  3THN A;  4DV4 E;  1WJP A;  3IWC A;  2YRM A;  5A6B D;  2ADR A;  2G7H A;  4WPY A;  5KL3 A;  4ZYG A;  4M30 A;  4JI2 E;  1IBL E;  2HJJ A;  1J26 A;  1X6F A;  3C4T A;  4M9V C;  1DGC A;  2UU9 E;  2EWL A;  2YSO A;  2LRS A;  2JXP A;  4DV3 E;  4GZN C;  2NAB A;  4DV2 E;  4BHB A;  3EPK A;  1AH5 A;  1N32 E;  4Q28 A;  2JVA A;  5IV8 B;  2I9I A;  2RSI A;  3C6K A;  2EN1 A;  5CFF E;  4F54 A;  2RS6 A;  2YRK A;  3ADL A;  4GKK E;  4M2Z A;  4X9J A;  2MKN A;  1PKP A;  2E5L E;  4R2D A;  4DR2 E;  2R1F A;  1WHN A;  1YFH A;  4L5N C;  2EPX A;  2EM0 A;  2JOB A;  2GHF A;  4YHH E;  2B7V A;  3J80 C;  2ELY A;  1YSA C;  1EH7 A;  4OX9 E;  3JU0 A;  2EOX A;  2L2M A;  2EM8 A;  2FTX B;  1AAY A;  4DV0 E;  3VK6 A;  4F6N A;  4R2E A;  2LMZ A;  4NZV A;  1O0W A;  4DUZ E;  3HTX A;  2FGG A;  2EM4 A;  2ENH A;  1KJK A;  5IWA E;  5AC4 A;  1ZBQ A;  2RTX A;  4NXN E;  1IQS A;  4BS9 A;  5F3W A;  1TN9 A;  2EOO A;  4R2A A;  4N4R B;  1PJT A;  4IJD A;  1P47 A;  1STU A;  3ADG A;  2DB2 A;  5IT9 C;  4GKJ E;  2LJU A; 
#chains in the Genus database with same CATH homology
 1A1H A;  2ENC A;  2I13 A;  2EOI A;  1BB8 A;  2EOY A;  2YTN A;  2EPC A;  4FK5 C;  1F2I G;  2EN7 A;  2PRT A;  5KL6 A;  2CSH A;  2YTE A;  2WBT A;  2J7J A;  1A1I A;  1MEY C;  1A1J A;  2EM9 A;  1ZU1 A;  2YTO A;  2EMG A;  2WBS A;  1WJP A;  2D9H A;  2RPC A;  2EM7 A;  2YRM A;  2EMB A;  1NCS A;  2EL6 A;  2BB8 A;  2ADR A;  2EM5 A;  2ENA A;  2EOR A;  5KL3 A;  1YUI A;  2EMZ A;  2EMH A;  2EMY A;  2EN8 A;  2YTP A;  2YTD A;  2EMC A;  2A25 A;  1UN6 B;  2EN6 A;  2EJ4 A;  1YUJ A;  2EP3 A;  2YTG A;  1X6F A;  2WBU A;  4M9V C;  1DGC A;  2YSO A;  2EPP A;  2EQ0 A;  2EOQ A;  1JK2 A;  2WCC 3;  1JK1 A;  4GZN C;  2EM2 A;  2NAB A;  2EN3 A;  2LCE A;  1X3C A;  1UBD C;  3EPK A;  2JP9 A;  2EQ1 A;  2EPU A;  2EOZ A;  4IS1 C;  3VHT B;  2EPA A;  2RSI A;  2EN1 A;  1LLM C;  2DMI A;  1X6E A;  2EL5 A;  2EOM A;  2EL4 A;  5KL7 A;  1A1G A;  2EN2 A;  2YRK A;  4F6M A;  2EN4 A;  4R2R A;  2GLI A;  1A1F A;  4R2S A;  4X9J A;  2YTJ A;  3EPJ A;  2MKN A;  4R2D A;  2R1F A;  2MKD A;  3M99 B;  1TF6 A;  3MHH C;  2EM3 A;  4WSG A;  2EE8 A;  2EPX A;  2EM0 A;  1G2D C;  1BBO A;  2EM6 A;  2EMW A;  2GHF A;  1RMD A;  3UK3 C;  2EOF A;  2LO3 A;  2DGC A;  1ZAA C;  1ZR9 A;  2HGH A;  4R2P A;  2ELY A;  2M9A A;  2EOS A;  5KL4 A;  1TF3 A;  2LV2 A;  1YSA C;  2YSP A;  2EMK A;  2LVH A;  2EOX A;  2YRH A;  4R2C A;  2EM8 A;  2EOJ A;  4R2Q A;  1AAY A;  1A1K A;  1X5W A;  5KL2 A;  2EOE A;  4F6N A;  4R2E A;  2CTD A;  2DLK A;  2EPZ A;  2JPA A;  1Z1B A;  1B69 A;  2EMA A;  2EML A;  1X6H A;  3EPH A;  2EQ3 A;  2YTF A;  2EM4 A;  2DRP A;  2ENH A;  1KJK A;  3EPL A;  1A1L A;  2EOH A;  2YU5 A;  2YTI A;  2EMX A;  3MHS C;  4F2J C;  2EPR A;  2LT7 A;  2YTQ A;  2E72 A;  1TN9 A;  2EOO A;  2YU8 A;  2CT1 A;  4R2A A;  4IJD A;  1P47 A;  2VRD A;  2EMI A;  2EMF A;  2MDG A;  2DLQ A;  1G2F C;  2ELZ A;  5KL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...