3RMPA

Structural basis for the recognition of attp substrates by p4-like integrases
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords CP4-like integrase
publication title Structural basis for the recognition of attP substrates by P4-like integrases
rcsb
source organism Yersinia pestis
total genus 17
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3rmpA00
3JTZA 3RMPA 3JU0A
chains in the Genus database with same CATH superfamily
3H09A 2EOFA 4LFAE 2LJUA 2L92A 5LLQA 1DGCA 2L6MA 2RSIA 2EN8A 1YYWA 1WHQA 3EPKA 2EPRA 2DMYA 4MLQA 2EL4A 5AC4A 2V86A 1RQ0A 4DV4E 2YTEA 1YYOA 2EM7A 1Z1BA 2VE7C 1A1FA 2JYAA 2NUGA 4KZSA 2EPNA 2UXBE 2EJ4A 2ELZA 4B3SE 5BR8E 4X62E 2NUEA 3K6QA 2EMYA 4OOGC 2YTPA 2M7QA 4R2PA 2B3TB 4GKJE 1QNTA 5T6JA 2R76A 2A25A 4LF9E 1YYKA 2EOZA 2EE8A 1IQSA 2EPUA 2EQ1A 2EPPA 2KOUA 3IWBA 1A1LA 4NXNE 2RQLA 2ZM6E 1YPNA 2LMZA 1HR0E 1A1IA 2EPMX 1X6EA 3EPLA 2UXCE 3THNA 1PDAA 4KHPE 4M30A 1JK1A 4DV2E 4YHHE 2LO3A 4DR1E 4JI2E 1WRJA 2YSOA 2EMCA 2EOIA 3TQMA 2YTFA 3VK6A 1N33E 4JI7E 1N34E 5AE2A 2RTXA 2EWLA 2EPKX 4HEIA 2EOJA 1HNWE 3ECRA 2YRKA 2YU5A 3ADGA 1UILA 2V85A 3THOB 2NA2A 1EH6A 2L33A 3JAMC 3MSWA 4DR5E 4X66E 4BC9A 1X47A 2EM2A 2EPAA 4LFCE 3VYYA 5A6BA 3FIGA 1PJTA 2HJJA 1BBGA 1PJQA 2EPCA 1IBLE 5KL2A 5AE3A 4R2CA 1XMQE 2YRHA 4BCAA 2YZTA 5F3WA 4GEQB 4WSGA 1HNXE 1N3GA 4AQYE 2YT4A 2EPXA 4HTGA 1T38A 1TF6A 4M2ZA 2L2NA 5KL5A 2WBSA 2EOMA 1MEYC 4LU9A 3ADJA 3AV0A 4F9AB 2VQFE 2M9AA 2YRMA 2ADRA 2KONA 3MHHC 4DUZE 1MGTA 2PRTA 2B9DA 4M9VC 4RHBB 3VHTB 3F6GA 5A6KA 4I8OA 4JI8E 2EL6A 3MHSC 2GHFA 2BB8A 2MC5A 3KZZA 1BB8A 4WPYA 4JI3E 2EQ3A 3C6KA 1ZU1A 5KL6A 4BHBA 2EMXA 3BGHA 3IWCA 4R8OA 2EMKA 2LTSA 4B3TE 2YU8A 2B7VA 2EM0A 3J7AG 4K0KE 2L3JA 3JTZA 1T39A 2V87A 4JI1E 2CSHA 1GQEA 2MKNA 5AASA 1X49A 1XMOE 2EQ0A 2EPOA 4NXME 1X6FA 5A6JA 3IWDA 2M4IA 2I13A 1GTKA 5CFFE 4DKKA 5LL6R 3J81C 2ENAA 1HNZE 4BBYA 1WJPA 2LRSA 4DV0E 2YWQA 4ZYDA 2F4VE 2WBUA 2DRPA 1ZBQA 4NHRA 1IMUA 4F54A 3C4TA 4DV6E 3KZYA 4WFTA 2V83A 4WX9A 2UUAE 2EMIA 3LLHA 2K4VA 4R2QA 4P7DA 1AH5A 2EPLX 2WBTA 4MLVA 5KL4A 2JP9A 2JR1A 4R2DA 4X8WA 2UUBE 2VF1A 1O0WA 2EMFA 3T1YE 2LVHA 2KHXA 2ODRD 1UN6B 2EOQA 1STUA 3BIDA 3C4BA 2JOBA 2MC6A 1YZ9A 2L2KB 2EM5A 4JI5E 4O4KA 3ADIA 5TSEA 3LMLA 1NEIA 1TN9A 1DQ3A 1WXRA 2VRDA 1A1GA 4DUYE 3VYXA 1SFEA 4O24A 2L3CA 2VQEE 3L00A 4Q35B 5A6BD 1T4OA 5IV8B 1B69A 1ZAAC 4X65E 4JV5E 2JXPA 2YPNA 5AE1A 1ZBTA 4DR2E 1SR9A 1YSAC 4WXCA 2Q8UA 1YFHA 1N32E 1YUIA 3ZOQB 4O43A 2FTXB 2EN2A 2D9HA 3M99B 2EOSA 2YTOA 1LLMC 4B3RE 3BBGA 2GLIA 2HHHE 2EM3A 2WZOA 5KL7A 4WXDA 3EPHA 1EH8A 5A69A 4BS9A 3BF2A 4GKKE 4ZYHA 2V89A 2GPIA 2LT7A 2EN1A 1DI2A 4Q28A 2LUQA 2YTNA 4F6NA 2YTGA 2CPNA 2FGGA 5KL3A 3AUZA 5AC5A 4IJDA 1P47A 2EMAA 4IS1C 2JOXA 2E72A 2N3GA 1YUJA 1FJGE 4N4RB 1A1JA 2DGCA 2FV4B 2CTDA 2EM6A 2IHR1 2E1MA 3C6MA 2MDRA 4DMIA 2DIXA 4X64E 2JWOA 1XNRE 2UXDE 4R2SA 4BMJA 1FKAE 2HGHA 2BBGA 2RSMA 4LTYA 2EP3A 5LMNE 4DV5E 3OMLA 2G7HA 2EMHA 2L8TA 3QG5C 5A2QC 4B3ME 2RPCA 2YTIA 2LTRA 1TF3A 4ZYEA 2DLKA 1EKZA 4WYQB 4LFBE 2EMGA 4DR6E 1RC7A 1AAYA 2V88A 4F2JC 2RS7A 4JYAE 2JVAA 3T1HE 4ZYGA 1X5WA 2EN6A 1PKPA 3HPSA 3JU0A 3OTOE 1X6HA 4KWYA 2UU9E 4YY3E 2EMBA 1BBOA 2EOEA 4JI6E 1J26A 1J5EE 2DSYA 4JI4E 3HQ1A 1F2IG 4O5GA 2EPZA 4F6MA 4F9BB 2EN3A 2ELYA 5A6AA 1N36E 4BHCA 2EZ6A 1JK2A 1RMDA 2LCEA 1X48A 2N8XA 2EORA 5IXMB 5IWAE 2EM4A 2I9IA 2M1SA 2EMWA 1UBDC 2MKDA 2RS6A 1IQOA 1EH7A 2EMZA 3ADLA 3KWRA 2NABA 1WHNA 2YTJA 5IT9C 4LF4E 4DV7E 2EOOA 2DLQA 3J7Yp 1PJSA 5ADZA 2UUCE 1G2DC 3DJWA 2LV2A 4R2RA 1NCSA 2LJHA 1IBME 1QU6A 5LMUE 2JPAA 1XNQE 4LF8E 3HXLA 2CT1A 2EMLA 3RMPA 2DB2A 4M0VA 2JY9A 2ENHA 4X9JA 2DMIA 2ENCA 4GZNC 4LF6E 4OX9E 2LE2A 4DV3E 2B7TA 2LUPB 4JI0E 4F9CB 4R2EA 4DR3E 3EQ1A 4L5NC 1KYQA 4TUIA 2L2MA 4L8NA 3P1XA 2EOHA 4TUGA 2K7IA 4DR7E 2EM8A 2ODRC 5DNYA 3EPJA 3HTXA 2F8BA 4P78A 2EOYA 2E5LE 2MDGA 4R2AA 4LF7E 2EN4A 5FLXC 1IBKE 3F6HA 2R1FA 1G2FC 2YSPA 4LF5E 2HC5A 2YTDA 1UHZA 4R03A 1A1KA 3J80C 2N3HA 1GZ6A 1KJKA 4DV1E 4WSPA 4BC7A 1I94E 2NUFA 1X3CA 4FK5C 2EOXA 1T4LB 4DR4E 2EL5A 1L4SA 3UK3C 3DF6A 4RH8A 1A1HA 4NZVA 4J8ZA 3HPZA 2EM9A 1T4NA 2EN7A 2WCC3 1ZR9A 2H36X 2J7JA 2YTQA 2LBSB 2V8QB
chains in the Genus database with same CATH topology
4AQYE 4F9BB 4DUYE 2YT4A 3VYXA 2L3CA 4M2ZA 3H09A 2VQEE 4LFAE 2L2NA 2L92A 2L6MA 1N36E 2EZ6A 4LU9A 3ADJA 3AV0A 1T4OA 4F9AB 1X48A 2VQFE 4X65E 1YYWA 1WHQA 5IWAE 4JV5E 2DMYA 2KONA 5AE1A 2M1SA 1ZBTA 4DUZE 2RS6A 2V86A 1RQ0A 4DV4E 4DR2E 2B9DA 1SR9A 1YYOA 3F6GA 4I8OA 2VE7C 2NUGA 4KZSA 4JI8E 1N32E 3ADLA 3ZOQB 2FTXB 3KWRA 2UXBE 1WHNA 2MC5A 5BR8E 4B3SE 4B3RE 5IT9C 4LF4E 4WPYA 4JI3E 4X62E 4DV7E 2HHHE 2NUEA 3J7Yp 4LF7E 3K6QA 2WZOA 5ADZA 2UUCE 3DJWA 3IWCA 4R8OA 4OOGC 2LTSA 2LJHA 4BS9A 1IBME 2M7QA 1QU6A 5LMUE 2B7VA 4B3TE 1XNQE 3J7AG 4LF8E 4K0KE 2B3TB 3HXLA 2L3JA 4GKJE 3JTZA 4GKKE 2V89A 3RMPA 2DB2A 4M0VA 2JY9A 2V87A 5T6JA 4JI1E 1DI2A 4LF9E 1YYKA 4Q28A 1GQEA 2LUQA 5AASA 1X49A 1XMOE 4LF6E 4NXME 2KOUA 3IWBA 4OX9E 4NXNE 2LE2A 4DV3E 2B7TA 2ZM6E 2CPNA 3IWDA 2LMZA 2FGGA 2M4IA 5CFFE 1HR0E 4DKKA 3AUZA 2LUPB 2UXCE 4JI0E 4F9CB 5LL6R 3J81C 4DR3E 1HNZE 4KHPE 2JOXA 4BBYA 4L5NC 2N3GA 4TUIA 1FJGE 2L2MA 4L8NA 3P1XA 4M30A 2LRSA 4TUGA 4DV0E 2FV4B 4DV2E 2E5LE 4DR7E 2IHR1 2E1MA 4YHHE 2F4VE 2MDRA 2ODRC 4DMIA 5DNYA 4DR1E 2DIXA 4X64E 4JI2E 2JWOA 1XNRE 3HTXA 2F8BA 4P78A 2UXDE 1ZBQA 3VK6A 1FKAE 4BMJA 1N33E 4JI7E 4F54A 3C4TA 5AE2A 2RSMA 4LTYA 4DV6E 2RTXA 1N34E 2EWLA 4WFTA 5LMNE 5FLXC 3OMLA 2G7HA 2L8TA 2V83A 4DV5E 2UUAE 1IBKE 3F6HA 3LLHA 1HNWE 2K4VA 5A2QC 4P7DA 4B3ME 2JR1A 4LF5E 2LTRA 3ADGA 4R03A 1UHZA 1UILA 2V85A 4X8WA 2UUBE 2NA2A 2VF1A 1O0WA 3J80C 4WYQB 1EKZA 2L33A 1GZ6A 2N3HA 4DV1E 4WSPA 3JAMC 3MSWA 4DR5E 3T1YE 4X66E 4BC9A 4LFBE 1X47A 4BC7A 1RC7A 1I94E 2NUFA 4LFCE 3VYYA 4DR6E 2V88A 2KHXA 2ODRD 1T4LB 4DR4E 3FIGA 2RS7A 1STUA 3C4BA 3DF6A 2JOBA 4JYAE 2JVAA 2MC6A 3T1HE 1YZ9A 2L2KB 1IBLE 4J8ZA 3HPZA 4JI5E 5AE3A 3ADIA 1PKPA 3HPSA 1T4NA 3JU0A 3LMLA 3OTOE 1XMQE 2UU9E 4BCAA 4YY3E 2H36X 1DQ3A 1WXRA 2YZTA 4JI6E 1J26A 5F3WA 4GEQB 1J5EE 2DSYA 4JI4E 1HNXE 3HQ1A 2LBSB 2V8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTZ A;  3RMP A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 3H09 A;  2EOF A;  4LFA E;  2LJU A;  2L92 A;  5LLQ A;  1DGC A;  2L6M A;  2RSI A;  2EN8 A;  1YYW A;  1WHQ A;  3EPK A;  2EPR A;  2DMY A;  4MLQ A;  2EL4 A;  5AC4 A;  2V86 A;  1RQ0 A;  4DV4 E;  2YTE A;  1YYO A;  2EM7 A;  1Z1B A;  2VE7 C;  1A1F A;  2JYA A;  2NUG A;  4KZS A;  2EPN A;  2UXB E;  2EJ4 A;  2ELZ A;  4B3S E;  5BR8 E;  4X62 E;  2NUE A;  3K6Q A;  2EMY A;  4OOG C;  2YTP A;  2M7Q A;  4R2P A;  2B3T B;  4GKJ E;  1QNT A;  5T6J A;  2R76 A;  2A25 A;  4LF9 E;  1YYK A;  2EOZ A;  2EE8 A;  1IQS A;  2EPU A;  2EQ1 A;  2EPP A;  2KOU A;  3IWB A;  1A1L A;  4NXN E;  2RQL A;  2ZM6 E;  1YPN A;  2LMZ A;  1HR0 E;  1A1I A;  2EPM X;  1X6E A;  3EPL A;  2UXC E;  3THN A;  1PDA A;  4KHP E;  4M30 A;  1JK1 A;  4DV2 E;  4YHH E;  2LO3 A;  4DR1 E;  4JI2 E;  1WRJ A;  2YSO A;  2EMC A;  2EOI A;  3TQM A;  2YTF A;  3VK6 A;  1N33 E;  4JI7 E;  1N34 E;  5AE2 A;  2RTX A;  2EWL A;  2EPK X;  4HEI A;  2EOJ A;  1HNW E;  3ECR A;  2YRK A;  2YU5 A;  3ADG A;  1UIL A;  2V85 A;  3THO B;  2NA2 A;  1EH6 A;  2L33 A;  3JAM C;  3MSW A;  4DR5 E;  4X66 E;  4BC9 A;  1X47 A;  2EM2 A;  2EPA A;  4LFC E;  3VYY A;  5A6B A;  3FIG A;  1PJT A;  2HJJ A;  1BBG A;  1PJQ A;  2EPC A;  1IBL E;  5KL2 A;  5AE3 A;  4R2C A;  1XMQ E;  2YRH A;  4BCA A;  2YZT A;  5F3W A;  4GEQ B;  4WSG A;  1HNX E;  1N3G A;  4AQY E;  2YT4 A;  2EPX A;  4HTG A;  1T38 A;  1TF6 A;  4M2Z A;  2L2N A;  5KL5 A;  2WBS A;  2EOM A;  1MEY C;  4LU9 A;  3ADJ A;  3AV0 A;  4F9A B;  2VQF E;  2M9A A;  2YRM A;  2ADR A;  2KON A;  3MHH C;  4DUZ E;  1MGT A;  2PRT A;  2B9D A;  4M9V C;  4RHB B;  3VHT B;  3F6G A;  5A6K A;  4I8O A;  4JI8 E;  2EL6 A;  3MHS C;  2GHF A;  2BB8 A;  2MC5 A;  3KZZ A;  1BB8 A;  4WPY A;  4JI3 E;  2EQ3 A;  3C6K A;  1ZU1 A;  5KL6 A;  4BHB A;  2EMX A;  3BGH A;  3IWC A;  4R8O A;  2EMK A;  2LTS A;  4B3T E;  2YU8 A;  2B7V A;  2EM0 A;  3J7A G;  4K0K E;  2L3J A;  3JTZ A;  1T39 A;  2V87 A;  4JI1 E;  2CSH A;  1GQE A;  2MKN A;  5AAS A;  1X49 A;  1XMO E;  2EQ0 A;  2EPO A;  4NXM E;  1X6F A;  5A6J A;  3IWD A;  2M4I A;  2I13 A;  1GTK A;  5CFF E;  4DKK A;  5LL6 R;  3J81 C;  2ENA A;  1HNZ E;  4BBY A;  1WJP A;  2LRS A;  4DV0 E;  2YWQ A;  4ZYD A;  2F4V E;  2WBU A;  2DRP A;  1ZBQ A;  4NHR A;  1IMU A;  4F54 A;  3C4T A;  4DV6 E;  3KZY A;  4WFT A;  2V83 A;  4WX9 A;  2UUA E;  2EMI A;  3LLH A;  2K4V A;  4R2Q A;  4P7D A;  1AH5 A;  2EPL X;  2WBT A;  4MLV A;  5KL4 A;  2JP9 A;  2JR1 A;  4R2D A;  4X8W A;  2UUB E;  2VF1 A;  1O0W A;  2EMF A;  3T1Y E;  2LVH A;  2KHX A;  2ODR D;  1UN6 B;  2EOQ A;  1STU A;  3BID A;  3C4B A;  2JOB A;  2MC6 A;  1YZ9 A;  2L2K B;  2EM5 A;  4JI5 E;  4O4K A;  3ADI A;  5TSE A;  3LML A;  1NEI A;  1TN9 A;  1DQ3 A;  1WXR A;  2VRD A;  1A1G A;  4DUY E;  3VYX A;  1SFE A;  4O24 A;  2L3C A;  2VQE E;  3L00 A;  4Q35 B;  5A6B D;  1T4O A;  5IV8 B;  1B69 A;  1ZAA C;  4X65 E;  4JV5 E;  2JXP A;  2YPN A;  5AE1 A;  1ZBT A;  4DR2 E;  1SR9 A;  1YSA C;  4WXC A;  2Q8U A;  1YFH A;  1N32 E;  1YUI A;  3ZOQ B;  4O43 A;  2FTX B;  2EN2 A;  2D9H A;  3M99 B;  2EOS A;  2YTO A;  1LLM C;  4B3R E;  3BBG A;  2GLI A;  2HHH E;  2EM3 A;  2WZO A;  5KL7 A;  4WXD A;  3EPH A;  1EH8 A;  5A69 A;  4BS9 A;  3BF2 A;  4GKK E;  4ZYH A;  2V89 A;  2GPI A;  2LT7 A;  2EN1 A;  1DI2 A;  4Q28 A;  2LUQ A;  2YTN A;  4F6N A;  2YTG A;  2CPN A;  2FGG A;  5KL3 A;  3AUZ A;  5AC5 A;  4IJD A;  1P47 A;  2EMA A;  4IS1 C;  2JOX A;  2E72 A;  2N3G A;  1YUJ A;  1FJG E;  4N4R B;  1A1J A;  2DGC A;  2FV4 B;  2CTD A;  2EM6 A;  2IHR 1;  2E1M A;  3C6M A;  2MDR A;  4DMI A;  2DIX A;  4X64 E;  2JWO A;  1XNR E;  2UXD E;  4R2S A;  4BMJ A;  1FKA E;  2HGH A;  2BBG A;  2RSM A;  4LTY A;  2EP3 A;  5LMN E;  4DV5 E;  3OML A;  2G7H A;  2EMH A;  2L8T A;  3QG5 C;  5A2Q C;  4B3M E;  2RPC A;  2YTI A;  2LTR A;  1TF3 A;  4ZYE A;  2DLK A;  1EKZ A;  4WYQ B;  4LFB E;  2EMG A;  4DR6 E;  1RC7 A;  1AAY A;  2V88 A;  4F2J C;  2RS7 A;  4JYA E;  2JVA A;  3T1H E;  4ZYG A;  1X5W A;  2EN6 A;  1PKP A;  3HPS A;  3JU0 A;  3OTO E;  1X6H A;  4KWY A;  2UU9 E;  4YY3 E;  2EMB A;  1BBO A;  2EOE A;  4JI6 E;  1J26 A;  1J5E E;  2DSY A;  4JI4 E;  3HQ1 A;  1F2I G;  4O5G A;  2EPZ A;  4F6M A;  4F9B B;  2EN3 A;  2ELY A;  5A6A A;  1N36 E;  4BHC A;  2EZ6 A;  1JK2 A;  1RMD A;  2LCE A;  1X48 A;  2N8X A;  2EOR A;  5IXM B;  5IWA E;  2EM4 A;  2I9I A;  2M1S A;  2EMW A;  1UBD C;  2MKD A;  2RS6 A;  1IQO A;  1EH7 A;  2EMZ A;  3ADL A;  3KWR A;  2NAB A;  1WHN A;  2YTJ A;  5IT9 C;  4LF4 E;  4DV7 E;  2EOO A;  2DLQ A;  3J7Y p;  1PJS A;  5ADZ A;  2UUC E;  1G2D C;  3DJW A;  2LV2 A;  4R2R A;  1NCS A;  2LJH A;  1IBM E;  1QU6 A;  5LMU E;  2JPA A;  1XNQ E;  4LF8 E;  3HXL A;  2CT1 A;  2EML A;  3RMP A;  2DB2 A;  4M0V A;  2JY9 A;  2ENH A;  4X9J A;  2DMI A;  2ENC A;  4GZN C;  4LF6 E;  4OX9 E;  2LE2 A;  4DV3 E;  2B7T A;  2LUP B;  4JI0 E;  4F9C B;  4R2E A;  4DR3 E;  3EQ1 A;  4L5N C;  1KYQ A;  4TUI A;  2L2M A;  4L8N A;  3P1X A;  2EOH A;  4TUG A;  2K7I A;  4DR7 E;  2EM8 A;  2ODR C;  5DNY A;  3EPJ A;  3HTX A;  2F8B A;  4P78 A;  2EOY A;  2E5L E;  2MDG A;  4R2A A;  4LF7 E;  2EN4 A;  5FLX C;  1IBK E;  3F6H A;  2R1F A;  1G2F C;  2YSP A;  4LF5 E;  2HC5 A;  2YTD A;  1UHZ A;  4R03 A;  1A1K A;  3J80 C;  2N3H A;  1GZ6 A;  1KJK A;  4DV1 E;  4WSP A;  4BC7 A;  1I94 E;  2NUF A;  1X3C A;  4FK5 C;  2EOX A;  1T4L B;  4DR4 E;  2EL5 A;  1L4S A;  3UK3 C;  3DF6 A;  4RH8 A;  1A1H A;  4NZV A;  4J8Z A;  3HPZ A;  2EM9 A;  1T4N A;  2EN7 A;  2WCC 3;  1ZR9 A;  2H36 X;  2J7J A;  2YTQ A;  2LBS B;  2V8Q B; 
#chains in the Genus database with same CATH homology
 4AQY E;  4F9B B;  4DUY E;  2YT4 A;  3VYX A;  2L3C A;  4M2Z A;  3H09 A;  2VQE E;  4LFA E;  2L2N A;  2L92 A;  2L6M A;  1N36 E;  2EZ6 A;  4LU9 A;  3ADJ A;  3AV0 A;  1T4O A;  4F9A B;  1X48 A;  2VQF E;  4X65 E;  1YYW A;  1WHQ A;  5IWA E;  4JV5 E;  2DMY A;  2KON A;  5AE1 A;  2M1S A;  1ZBT A;  4DUZ E;  2RS6 A;  2V86 A;  1RQ0 A;  4DV4 E;  4DR2 E;  2B9D A;  1SR9 A;  1YYO A;  3F6G A;  4I8O A;  2VE7 C;  2NUG A;  4KZS A;  4JI8 E;  1N32 E;  3ADL A;  3ZOQ B;  2FTX B;  3KWR A;  2UXB E;  1WHN A;  2MC5 A;  5BR8 E;  4B3S E;  4B3R E;  5IT9 C;  4LF4 E;  4WPY A;  4JI3 E;  4X62 E;  4DV7 E;  2HHH E;  2NUE A;  3J7Y p;  4LF7 E;  3K6Q A;  2WZO A;  5ADZ A;  2UUC E;  3DJW A;  3IWC A;  4R8O A;  4OOG C;  2LTS A;  2LJH A;  4BS9 A;  1IBM E;  2M7Q A;  1QU6 A;  5LMU E;  2B7V A;  4B3T E;  1XNQ E;  3J7A G;  4LF8 E;  4K0K E;  2B3T B;  3HXL A;  2L3J A;  4GKJ E;  3JTZ A;  4GKK E;  2V89 A;  3RMP A;  2DB2 A;  4M0V A;  2JY9 A;  2V87 A;  5T6J A;  4JI1 E;  1DI2 A;  4LF9 E;  1YYK A;  4Q28 A;  1GQE A;  2LUQ A;  5AAS A;  1X49 A;  1XMO E;  4LF6 E;  4NXM E;  2KOU A;  3IWB A;  4OX9 E;  4NXN E;  2LE2 A;  4DV3 E;  2B7T A;  2ZM6 E;  2CPN A;  3IWD A;  2LMZ A;  2FGG A;  2M4I A;  5CFF E;  1HR0 E;  4DKK A;  3AUZ A;  2LUP B;  2UXC E;  4JI0 E;  4F9C B;  5LL6 R;  3J81 C;  4DR3 E;  1HNZ E;  4KHP E;  2JOX A;  4BBY A;  4L5N C;  2N3G A;  4TUI A;  1FJG E;  2L2M A;  4L8N A;  3P1X A;  4M30 A;  2LRS A;  4TUG A;  4DV0 E;  2FV4 B;  4DV2 E;  2E5L E;  4DR7 E;  2IHR 1;  2E1M A;  4YHH E;  2F4V E;  2MDR A;  2ODR C;  4DMI A;  5DNY A;  4DR1 E;  2DIX A;  4X64 E;  4JI2 E;  2JWO A;  1XNR E;  3HTX A;  2F8B A;  4P78 A;  2UXD E;  1ZBQ A;  3VK6 A;  1FKA E;  4BMJ A;  1N33 E;  4JI7 E;  4F54 A;  3C4T A;  5AE2 A;  2RSM A;  4LTY A;  4DV6 E;  2RTX A;  1N34 E;  2EWL A;  4WFT A;  5LMN E;  5FLX C;  3OML A;  2G7H A;  2L8T A;  2V83 A;  4DV5 E;  2UUA E;  1IBK E;  3F6H A;  3LLH A;  1HNW E;  2K4V A;  5A2Q C;  4P7D A;  4B3M E;  2JR1 A;  4LF5 E;  2LTR A;  3ADG A;  4R03 A;  1UHZ A;  1UIL A;  2V85 A;  4X8W A;  2UUB E;  2NA2 A;  2VF1 A;  1O0W A;  3J80 C;  4WYQ B;  1EKZ A;  2L33 A;  1GZ6 A;  2N3H A;  4DV1 E;  4WSP A;  3JAM C;  3MSW A;  4DR5 E;  3T1Y E;  4X66 E;  4BC9 A;  4LFB E;  1X47 A;  4BC7 A;  1RC7 A;  1I94 E;  2NUF A;  4LFC E;  3VYY A;  4DR6 E;  2V88 A;  2KHX A;  2ODR D;  1T4L B;  4DR4 E;  3FIG A;  2RS7 A;  1STU A;  3C4B A;  3DF6 A;  2JOB A;  4JYA E;  2JVA A;  2MC6 A;  3T1H E;  1YZ9 A;  2L2K B;  1IBL E;  4J8Z A;  3HPZ A;  4JI5 E;  5AE3 A;  3ADI A;  1PKP A;  3HPS A;  1T4N A;  3JU0 A;  3LML A;  3OTO E;  1XMQ E;  2UU9 E;  4BCA A;  4YY3 E;  2H36 X;  1DQ3 A;  1WXR A;  2YZT A;  4JI6 E;  1J26 A;  5F3W A;  4GEQ B;  1J5E E;  2DSY A;  4JI4 E;  1HNX E;  3HQ1 A;  2LBS B;  2V8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...