3RMPA

Structural basis for the recognition of attp substrates by p4-like integrases
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of attP substrates by P4-like integrases
rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
molecule keywords CP4-like integrase
total genus 17
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3rmpA00
3RMPA 3JTZA 3JU0A
chains in the Genus database with same CATH superfamily
3IWCA 2YRKA 2V85A 1BBGA 4R2AA 1WRJA 2L6MA 2L2KB 3VK6A 2E1MA 4I8OA 3C6KA 2M7QA 1N32E 4JI5E 2LVHA 1XMOE 2V88A 2EMCA 4MLQA 5LL6R 2VE7C 2EPCA 2VRDA 1N36E 2NUFA 2UUBE 1A1IA 2V86A 4GEQB 2EOMA 1WHQA 4R2CA 2EQ3A 2YU5A 2WCC3 5KL4A 2EOQA 4X62E 1J26A 4Q35B 2EN7A 2BBGA 2D9HA 1UILA 1X6EA 2B3TB 4F9AB 2LJHA 4LF6E 4JI2E 2R1FA 2LJUA 1RMDA 5FLXC 1AH5A 1XNQE 4NHRA 2E72A 3EPKA 2HGHA 2EORA 4JI3E 2UU9E 5A6AA 4ZYGA 2EL5A 1GTKA 3KWRA 5LMNE 4P78A 4R8OA 2YTQA 2EM5A 2JWOA 3EPHA 3J7Yp 2DB2A 4TUGA 3ADIA 2ODRD 4JI8E 4ZYEA 2L33A 4LF8E 4F9CB 2YRMA 2F4VE 1ZAAC 4OX9E 1HNWE 1ZR9A 4BC9A 1YZ9A 1G2FC 2LO3A 2EPNA 2R76A 4DMIA 4JYAE 4N4RB 3OMLA 2EPRA 2EN2A 3FIGA 5A2QC 2L3JA 4DR4E 1SFEA 4BBYA 4B3ME 2HHHE 3DF6A 1T4OA 3VYXA 3BIDA 2CT1A 2LT7A 1B69A 2MKNA 4DV7E 2EZ6A 1X3CA 2ENAA 2EQ0A 1YFHA 3VYYA 2EL4A 1A1GA 2UUAE 2YSPA 4WX9A 4X9JA 2L92A 1SR9A 4KWYA 4R2EA 3MHSC 5AE3A 4DKKA 5AE2A 2EN3A 1WJPA 2UUCE 3J81C 2EOOA 4WXCA 2B7TA 2EM3A 2K4VA 4M9VC 2B7VA 2EOSA 1A1HA 2NUEA 1N3GA 1YYOA 4L8NA 4GKKE 3C6MA 3OTOE 4F2JC 1JK2A 3HTXA 2YTJA 1YSAC 2NA2A 2EMWA 4FK5C 2V87A 1A1KA 2EMLA 4BCAA 5AC5A 1XMQE 5IXMB 2DMYA 2YU8A 2UXDE 2LBSB 3JU0A 1HNXE 5A6BD 2EMXA 4WYQB 2EMGA 2G7HA 2V8QB 1T4NA 1WHNA 2M9AA 1T38A 4LF4E 2B9DA 2WZOA 4DR7E 2EQ1A 1QU6A 2MDRA 5TSEA 4O24A 2M1SA 2YTDA 2EOIA 2LUPB 2L2MA 2N8XA 4ZYHA 3T1YE 2ENHA 2DGCA 5IV8B 3K6QA 4X8WA 2RTXA 2EOJA 2EN1A 4DUYE 1MEYC 3L00A 2JPAA 3MSWA 2EMKA 2YTOA 2KONA 3HQ1A 1IQOA 2NUGA 1YUJA 1X5WA 2E5LE 4X64E 1PJTA 3P1XA 3KZZA 3HPSA 4O5GA 1IBME 2MC6A 2EM9A 4NXME 4R2RA 1YUIA 2MKDA 4BHBA 2EM2A 2JOBA 2EPMX 4JV5E 2YTIA 1J5EE 3ADLA 2WBSA 4HTGA 5LMUE 1QNTA 5KL6A 1TN9A 2MC5A 4P7DA 2L8TA 4IS1C 2ZM6E 4K0KE 1MGTA 2EM4A 2Q8UA 1PKPA 1WXRA 3KZYA 5BR8E 2VF1A 1DGCA 2DRPA 2I13A 3ZOQB 3AV0A 4LFCE 2YZTA 2DMIA 4DR5E 4NXNE 2ODRC 2EM7A 4KZSA 2N3HA 1NCSA 4LTYA 1UHZA 2RSMA 1KYQA 3HPZA 4WFTA 5AC4A 4BC7A 2LTSA 1YYWA 2EOEA 2L2NA 1IBKE 4DV4E 3AUZA 2EJ4A 3EPLA 1ZBQA 1X48A 2EL6A 4R03A 1X47A 4MLVA 2JVAA 4LF7E 3C4TA 2LV2A 1BB8A 2FV4B 2LE2A 2CPNA 4BS9A 1L4SA 1EH6A 1STUA 4Q28A 3THNA 4KHPE 3LLHA 5KL7A 2EPUA 1RQ0A 1TF3A 4JI0E 1UN6B 3UK3C 2F8BA 3EPJA 2EOZA 2EM6A 2V89A 3JAMC 2A25A 2EOXA 4JI1E 1ZBTA 2YTPA 4DV1E 2YTGA 5KL3A 4ZYDA 2DSYA 2EPLX 2JP9A 4R2SA 3J7AG 2EN4A 4B3SE 2LTRA 4HEIA 2WBUA 4LF9E 4GKJE 4RH8A 2EN8A 2EPAA 2N3GA 1P47A 2EMYA 1I94E 3TQMA 1O0WA 1TF6A 3ADGA 2EM0A 3VHTB 4GZNC 4DR3E 2RS6A 2JXPA 3HXLA 1Z1BA 1AAYA 2KHXA 2YTEA 4YHHE 4DV3E 1UBDC 3J80C 1T39A 5A6BA 3THOB 2LUQA 4B3RE 2EM8A 2I9IA 2EE8A 4WSPA 4L5NC 5A6JA 4BMJA 3ADJA 2YT4A 4DV5E 1HR0E 4OOGC 2GHFA 2EP3A 1GZ6A 2EMIA 1NEIA 4F6NA 1DQ3A 1A1LA 4WSGA 2YTFA 2UXCE 4X66E 1F2IG 2JOXA 1YYKA 2MDGA 2VQFE 4M0VA 2EMFA 5IWAE 2EOYA 2PRTA 1X6HA 2VQEE 4YY3E 1FKAE 4JI4E 1EH8A 4DV2E 2EOFA 2EPPA 1BBOA 4B3TE 5AE1A 4LF5E 1RC7A 2EPKX 4RHBB 1XNRE 4JI6E 5CFFE 3IWDA 4IJDA 1IMUA 1N34E 4DV6E 4LFAE 3M99B 4LU9A 2UXBE 3C4BA 5A6KA 1HNZE 4BHCA 2K7IA 2EMHA 2JY9A 5IT9C 4DR2E 4R2PA 4DR6E 2CTDA 3ECRA 2EMBA 1G2DC 4LFBE 1T4LB 5KL2A 2FGGA 2LMZA 4R2QA 2EMAA 5F3WA 2GLIA 2JYAA 4TUIA 2J7JA 4NZVA 2HC5A 4DV0E 4F6MA 1PDAA 2RPCA 1IQSA 2DLKA 3IWBA 1GQEA 3QG5C 2GPIA 3F6GA 3JTZA 2KOUA 3T1HE 2M4IA 2ELYA 2CSHA 2EPXA 2LCEA 2EN6A 4X65E 1A1FA 2YRHA 2DLQA 2YPNA 5DNYA 4R2DA 1EH7A 2WBTA 3BBGA 1IBLE 1JK1A 1FJGE 1ZU1A 4WXDA 4AQYE 2YSOA 4F54A 3LMLA 4J8ZA 5ADZA 2RS7A 4O43A 4M2ZA 2EPZA 2RSIA 1X49A 3BGHA 2EOHA 5KL5A 1X6FA 2V83A 2BB8A 2EMZA 2HJJA 1YPNA 1DI2A 2LRSA 3DJWA 4JI7E 2ADRA 2EPOA 4DR1E 2RQLA 2YTNA 1KJKA 1PJQA 2YWQA 5LLQA 2FTXB 4O4KA 3RMPA 1PJSA 2H36X 3H09A 2ELZA 1A1JA 2ENCA 4DUZE 2EWLA 3BF2A 1EKZA 3F6HA 2L3CA 5A69A 1N33E 3EQ1A 4F9BB 2JR1A 4WPYA 5T6JA 2NABA 1LLMC 2DIXA 4M30A 3MHHC 5AASA 2IHR1
chains in the Genus database with same CATH topology
1UHZA 5AE1A 2RSMA 2K4VA 3IWCA 3HPZA 4WFTA 2B7VA 2V85A 2LTSA 4BC7A 4LF5E 1YYWA 2L2NA 1IBKE 1RC7A 2NUEA 2L6MA 3AUZA 2L2KB 3VK6A 2E1MA 4DV4E 1ZBQA 1XNRE 1X48A 4I8OA 2M7QA 4JI6E 1N32E 1YYOA 4JI5E 4R03A 4L8NA 5CFFE 4GKKE 3HTXA 3OTOE 3IWDA 1XMOE 2V88A 1X47A 2NA2A 1N34E 2JVAA 5LL6R 2V87A 2VE7C 4DV6E 3C4TA 4LF7E 1N36E 2NUFA 4LFAE 4LU9A 4BCAA 2UXBE 2FV4B 2LE2A 3C4BA 1XMQE 2UUBE 1HNZE 2CPNA 4BS9A 2DMYA 2V86A 4GEQB 1WHQA 1STUA 2UXDE 5IT9C 2JY9A 4Q28A 4KHPE 2LBSB 3JU0A 4DR2E 1HNXE 3LLHA 4DR6E 4X62E 1J26A 4WYQB 1RQ0A 2G7HA 2V8QB 1T4NA 1WHNA 4LFBE 1T4LB 4JI0E 2FGGA 2LMZA 4LF4E 2F8BA 2B9DA 2WZOA 4DR7E 1UILA 1QU6A 2MDRA 5F3WA 2M1SA 2V89A 3JAMC 4TUIA 2B3TB 4F9AB 2LJHA 4LF6E 2LUPB 4JI1E 1ZBTA 4JI2E 5FLXC 4DV1E 4DV0E 2L2MA 3T1YE 1XNQE 2DSYA 3IWBA 1GQEA 3F6GA 3JTZA 2KOUA 3T1HE 2UU9E 3K6QA 4JI3E 3J7AG 4X8WA 2M4IA 3KWRA 5LMNE 4P78A 4R8OA 4B3SE 2RTXA 5AASA 2LTRA 4JI4E 4DUYE 2JWOA 4LF9E 4GKJE 3J7Yp 3MSWA 2DB2A 2N3GA 1I94E 4TUGA 3ADIA 4X65E 1O0WA 2ODRD 2KONA 3ADGA 4JI8E 2L33A 3HQ1A 4F9CB 5DNYA 4LF8E 2NUGA 4DR3E 2F4VE 2RS6A 1IBLE 4X64E 2E5LE 3HXLA 4OX9E 1HNWE 1FJGE 4BC9A 1YZ9A 2KHXA 4AQYE 4DV3E 4YHHE 3P1XA 4F54A 3HPSA 4DMIA 3J80C 4JYAE 2LUQA 3LMLA 4J8ZA 3OMLA 2MC6A 1IBME 4NXME 4B3RE 3FIGA 5ADZA 2RS7A 5A2QC 2L3JA 4M2ZA 4WSPA 4DR4E 1X49A 4L5NC 4BMJA 4BBYA 2V83A 4B3ME 2JOBA 3ADJA 3DF6A 1T4OA 2HHHE 3VYXA 4JV5E 2YT4A 4DV5E 2LRSA 1HR0E 1DI2A 3DJWA 4OOGC 4JI7E 1J5EE 4DR1E 4DV7E 1GZ6A 2EZ6A 3ADLA 5LMUE 3VYYA 2MC5A 1DQ3A 4P7DA 2L8TA 2UUAE 2ZM6E 4K0KE 2FTXB 3RMPA 2H36X 3H09A 2UXCE 4X66E 1PKPA 2JOXA 1WXRA 5BR8E 1YYKA 2L92A 2EWLA 4DUZE 2VF1A 2VQFE 1SR9A 4M0VA 3AV0A 3ZOQB 5AE3A 5IWAE 1EKZA 4LFCE 2YZTA 3F6HA 4DKKA 5AE2A 2L3CA 1N33E 4DR5E 4NXNE 4F9BB 2JR1A 4WPYA 4YY3E 5T6JA 2ODRC 2VQEE 1FKAE 2UUCE 3J81C 2DIXA 4M30A 4KZSA 4DV2E 2N3HA 2B7TA 4LTYA 4B3TE 2IHR1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMP A;  3JTZ A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 3IWC A;  2YRK A;  2V85 A;  1BBG A;  4R2A A;  1WRJ A;  2L6M A;  2L2K B;  3VK6 A;  2E1M A;  4I8O A;  3C6K A;  2M7Q A;  1N32 E;  4JI5 E;  2LVH A;  1XMO E;  2V88 A;  2EMC A;  4MLQ A;  5LL6 R;  2VE7 C;  2EPC A;  2VRD A;  1N36 E;  2NUF A;  2UUB E;  1A1I A;  2V86 A;  4GEQ B;  2EOM A;  1WHQ A;  4R2C A;  2EQ3 A;  2YU5 A;  2WCC 3;  5KL4 A;  2EOQ A;  4X62 E;  1J26 A;  4Q35 B;  2EN7 A;  2BBG A;  2D9H A;  1UIL A;  1X6E A;  2B3T B;  4F9A B;  2LJH A;  4LF6 E;  4JI2 E;  2R1F A;  2LJU A;  1RMD A;  5FLX C;  1AH5 A;  1XNQ E;  4NHR A;  2E72 A;  3EPK A;  2HGH A;  2EOR A;  4JI3 E;  2UU9 E;  5A6A A;  4ZYG A;  2EL5 A;  1GTK A;  3KWR A;  5LMN E;  4P78 A;  4R8O A;  2YTQ A;  2EM5 A;  2JWO A;  3EPH A;  3J7Y p;  2DB2 A;  4TUG A;  3ADI A;  2ODR D;  4JI8 E;  4ZYE A;  2L33 A;  4LF8 E;  4F9C B;  2YRM A;  2F4V E;  1ZAA C;  4OX9 E;  1HNW E;  1ZR9 A;  4BC9 A;  1YZ9 A;  1G2F C;  2LO3 A;  2EPN A;  2R76 A;  4DMI A;  4JYA E;  4N4R B;  3OML A;  2EPR A;  2EN2 A;  3FIG A;  5A2Q C;  2L3J A;  4DR4 E;  1SFE A;  4BBY A;  4B3M E;  2HHH E;  3DF6 A;  1T4O A;  3VYX A;  3BID A;  2CT1 A;  2LT7 A;  1B69 A;  2MKN A;  4DV7 E;  2EZ6 A;  1X3C A;  2ENA A;  2EQ0 A;  1YFH A;  3VYY A;  2EL4 A;  1A1G A;  2UUA E;  2YSP A;  4WX9 A;  4X9J A;  2L92 A;  1SR9 A;  4KWY A;  4R2E A;  3MHS C;  5AE3 A;  4DKK A;  5AE2 A;  2EN3 A;  1WJP A;  2UUC E;  3J81 C;  2EOO A;  4WXC A;  2B7T A;  2EM3 A;  2K4V A;  4M9V C;  2B7V A;  2EOS A;  1A1H A;  2NUE A;  1N3G A;  1YYO A;  4L8N A;  4GKK E;  3C6M A;  3OTO E;  4F2J C;  1JK2 A;  3HTX A;  2YTJ A;  1YSA C;  2NA2 A;  2EMW A;  4FK5 C;  2V87 A;  1A1K A;  2EML A;  4BCA A;  5AC5 A;  1XMQ E;  5IXM B;  2DMY A;  2YU8 A;  2UXD E;  2LBS B;  3JU0 A;  1HNX E;  5A6B D;  2EMX A;  4WYQ B;  2EMG A;  2G7H A;  2V8Q B;  1T4N A;  1WHN A;  2M9A A;  1T38 A;  4LF4 E;  2B9D A;  2WZO A;  4DR7 E;  2EQ1 A;  1QU6 A;  2MDR A;  5TSE A;  4O24 A;  2M1S A;  2YTD A;  2EOI A;  2LUP B;  2L2M A;  2N8X A;  4ZYH A;  3T1Y E;  2ENH A;  2DGC A;  5IV8 B;  3K6Q A;  4X8W A;  2RTX A;  2EOJ A;  2EN1 A;  4DUY E;  1MEY C;  3L00 A;  2JPA A;  3MSW A;  2EMK A;  2YTO A;  2KON A;  3HQ1 A;  1IQO A;  2NUG A;  1YUJ A;  1X5W A;  2E5L E;  4X64 E;  1PJT A;  3P1X A;  3KZZ A;  3HPS A;  4O5G A;  1IBM E;  2MC6 A;  2EM9 A;  4NXM E;  4R2R A;  1YUI A;  2MKD A;  4BHB A;  2EM2 A;  2JOB A;  2EPM X;  4JV5 E;  2YTI A;  1J5E E;  3ADL A;  2WBS A;  4HTG A;  5LMU E;  1QNT A;  5KL6 A;  1TN9 A;  2MC5 A;  4P7D A;  2L8T A;  4IS1 C;  2ZM6 E;  4K0K E;  1MGT A;  2EM4 A;  2Q8U A;  1PKP A;  1WXR A;  3KZY A;  5BR8 E;  2VF1 A;  1DGC A;  2DRP A;  2I13 A;  3ZOQ B;  3AV0 A;  4LFC E;  2YZT A;  2DMI A;  4DR5 E;  4NXN E;  2ODR C;  2EM7 A;  4KZS A;  2N3H A;  1NCS A;  4LTY A;  1UHZ A;  2RSM A;  1KYQ A;  3HPZ A;  4WFT A;  5AC4 A;  4BC7 A;  2LTS A;  1YYW A;  2EOE A;  2L2N A;  1IBK E;  4DV4 E;  3AUZ A;  2EJ4 A;  3EPL A;  1ZBQ A;  1X48 A;  2EL6 A;  4R03 A;  1X47 A;  4MLV A;  2JVA A;  4LF7 E;  3C4T A;  2LV2 A;  1BB8 A;  2FV4 B;  2LE2 A;  2CPN A;  4BS9 A;  1L4S A;  1EH6 A;  1STU A;  4Q28 A;  3THN A;  4KHP E;  3LLH A;  5KL7 A;  2EPU A;  1RQ0 A;  1TF3 A;  4JI0 E;  1UN6 B;  3UK3 C;  2F8B A;  3EPJ A;  2EOZ A;  2EM6 A;  2V89 A;  3JAM C;  2A25 A;  2EOX A;  4JI1 E;  1ZBT A;  2YTP A;  4DV1 E;  2YTG A;  5KL3 A;  4ZYD A;  2DSY A;  2EPL X;  2JP9 A;  4R2S A;  3J7A G;  2EN4 A;  4B3S E;  2LTR A;  4HEI A;  2WBU A;  4LF9 E;  4GKJ E;  4RH8 A;  2EN8 A;  2EPA A;  2N3G A;  1P47 A;  2EMY A;  1I94 E;  3TQM A;  1O0W A;  1TF6 A;  3ADG A;  2EM0 A;  3VHT B;  4GZN C;  4DR3 E;  2RS6 A;  2JXP A;  3HXL A;  1Z1B A;  1AAY A;  2KHX A;  2YTE A;  4YHH E;  4DV3 E;  1UBD C;  3J80 C;  1T39 A;  5A6B A;  3THO B;  2LUQ A;  4B3R E;  2EM8 A;  2I9I A;  2EE8 A;  4WSP A;  4L5N C;  5A6J A;  4BMJ A;  3ADJ A;  2YT4 A;  4DV5 E;  1HR0 E;  4OOG C;  2GHF A;  2EP3 A;  1GZ6 A;  2EMI A;  1NEI A;  4F6N A;  1DQ3 A;  1A1L A;  4WSG A;  2YTF A;  2UXC E;  4X66 E;  1F2I G;  2JOX A;  1YYK A;  2MDG A;  2VQF E;  4M0V A;  2EMF A;  5IWA E;  2EOY A;  2PRT A;  1X6H A;  2VQE E;  4YY3 E;  1FKA E;  4JI4 E;  1EH8 A;  4DV2 E;  2EOF A;  2EPP A;  1BBO A;  4B3T E;  5AE1 A;  4LF5 E;  1RC7 A;  2EPK X;  4RHB B;  1XNR E;  4JI6 E;  5CFF E;  3IWD A;  4IJD A;  1IMU A;  1N34 E;  4DV6 E;  4LFA E;  3M99 B;  4LU9 A;  2UXB E;  3C4B A;  5A6K A;  1HNZ E;  4BHC A;  2K7I A;  2EMH A;  2JY9 A;  5IT9 C;  4DR2 E;  4R2P A;  4DR6 E;  2CTD A;  3ECR A;  2EMB A;  1G2D C;  4LFB E;  1T4L B;  5KL2 A;  2FGG A;  2LMZ A;  4R2Q A;  2EMA A;  5F3W A;  2GLI A;  2JYA A;  4TUI A;  2J7J A;  4NZV A;  2HC5 A;  4DV0 E;  4F6M A;  1PDA A;  2RPC A;  1IQS A;  2DLK A;  3IWB A;  1GQE A;  3QG5 C;  2GPI A;  3F6G A;  3JTZ A;  2KOU A;  3T1H E;  2M4I A;  2ELY A;  2CSH A;  2EPX A;  2LCE A;  2EN6 A;  4X65 E;  1A1F A;  2YRH A;  2DLQ A;  2YPN A;  5DNY A;  4R2D A;  1EH7 A;  2WBT A;  3BBG A;  1IBL E;  1JK1 A;  1FJG E;  1ZU1 A;  4WXD A;  4AQY E;  2YSO A;  4F54 A;  3LML A;  4J8Z A;  5ADZ A;  2RS7 A;  4O43 A;  4M2Z A;  2EPZ A;  2RSI A;  1X49 A;  3BGH A;  2EOH A;  5KL5 A;  1X6F A;  2V83 A;  2BB8 A;  2EMZ A;  2HJJ A;  1YPN A;  1DI2 A;  2LRS A;  3DJW A;  4JI7 E;  2ADR A;  2EPO A;  4DR1 E;  2RQL A;  2YTN A;  1KJK A;  1PJQ A;  2YWQ A;  5LLQ A;  2FTX B;  4O4K A;  3RMP A;  1PJS A;  2H36 X;  3H09 A;  2ELZ A;  1A1J A;  2ENC A;  4DUZ E;  2EWL A;  3BF2 A;  1EKZ A;  3F6H A;  2L3C A;  5A69 A;  1N33 E;  3EQ1 A;  4F9B B;  2JR1 A;  4WPY A;  5T6J A;  2NAB A;  1LLM C;  2DIX A;  4M30 A;  3MHH C;  5AAS A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 1UHZ A;  5AE1 A;  2RSM A;  2K4V A;  3IWC A;  3HPZ A;  4WFT A;  2B7V A;  2V85 A;  2LTS A;  4BC7 A;  4LF5 E;  1YYW A;  2L2N A;  1IBK E;  1RC7 A;  2NUE A;  2L6M A;  3AUZ A;  2L2K B;  3VK6 A;  2E1M A;  4DV4 E;  1ZBQ A;  1XNR E;  1X48 A;  4I8O A;  2M7Q A;  4JI6 E;  1N32 E;  1YYO A;  4JI5 E;  4R03 A;  4L8N A;  5CFF E;  4GKK E;  3HTX A;  3OTO E;  3IWD A;  1XMO E;  2V88 A;  1X47 A;  2NA2 A;  1N34 E;  2JVA A;  5LL6 R;  2V87 A;  2VE7 C;  4DV6 E;  3C4T A;  4LF7 E;  1N36 E;  2NUF A;  4LFA E;  4LU9 A;  4BCA A;  2UXB E;  2FV4 B;  2LE2 A;  3C4B A;  1XMQ E;  2UUB E;  1HNZ E;  2CPN A;  4BS9 A;  2DMY A;  2V86 A;  4GEQ B;  1WHQ A;  1STU A;  2UXD E;  5IT9 C;  2JY9 A;  4Q28 A;  4KHP E;  2LBS B;  3JU0 A;  4DR2 E;  1HNX E;  3LLH A;  4DR6 E;  4X62 E;  1J26 A;  4WYQ B;  1RQ0 A;  2G7H A;  2V8Q B;  1T4N A;  1WHN A;  4LFB E;  1T4L B;  4JI0 E;  2FGG A;  2LMZ A;  4LF4 E;  2F8B A;  2B9D A;  2WZO A;  4DR7 E;  1UIL A;  1QU6 A;  2MDR A;  5F3W A;  2M1S A;  2V89 A;  3JAM C;  4TUI A;  2B3T B;  4F9A B;  2LJH A;  4LF6 E;  2LUP B;  4JI1 E;  1ZBT A;  4JI2 E;  5FLX C;  4DV1 E;  4DV0 E;  2L2M A;  3T1Y E;  1XNQ E;  2DSY A;  3IWB A;  1GQE A;  3F6G A;  3JTZ A;  2KOU A;  3T1H E;  2UU9 E;  3K6Q A;  4JI3 E;  3J7A G;  4X8W A;  2M4I A;  3KWR A;  5LMN E;  4P78 A;  4R8O A;  4B3S E;  2RTX A;  5AAS A;  2LTR A;  4JI4 E;  4DUY E;  2JWO A;  4LF9 E;  4GKJ E;  3J7Y p;  3MSW A;  2DB2 A;  2N3G A;  1I94 E;  4TUG A;  3ADI A;  4X65 E;  1O0W A;  2ODR D;  2KON A;  3ADG A;  4JI8 E;  2L33 A;  3HQ1 A;  4F9C B;  5DNY A;  4LF8 E;  2NUG A;  4DR3 E;  2F4V E;  2RS6 A;  1IBL E;  4X64 E;  2E5L E;  3HXL A;  4OX9 E;  1HNW E;  1FJG E;  4BC9 A;  1YZ9 A;  2KHX A;  4AQY E;  4DV3 E;  4YHH E;  3P1X A;  4F54 A;  3HPS A;  4DMI A;  3J80 C;  4JYA E;  2LUQ A;  3LML A;  4J8Z A;  3OML A;  2MC6 A;  1IBM E;  4NXM E;  4B3R E;  3FIG A;  5ADZ A;  2RS7 A;  5A2Q C;  2L3J A;  4M2Z A;  4WSP A;  4DR4 E;  1X49 A;  4L5N C;  4BMJ A;  4BBY A;  2V83 A;  4B3M E;  2JOB A;  3ADJ A;  3DF6 A;  1T4O A;  2HHH E;  3VYX A;  4JV5 E;  2YT4 A;  4DV5 E;  2LRS A;  1HR0 E;  1DI2 A;  3DJW A;  4OOG C;  4JI7 E;  1J5E E;  4DR1 E;  4DV7 E;  1GZ6 A;  2EZ6 A;  3ADL A;  5LMU E;  3VYY A;  2MC5 A;  1DQ3 A;  4P7D A;  2L8T A;  2UUA E;  2ZM6 E;  4K0K E;  2FTX B;  3RMP A;  2H36 X;  3H09 A;  2UXC E;  4X66 E;  1PKP A;  2JOX A;  1WXR A;  5BR8 E;  1YYK A;  2L92 A;  2EWL A;  4DUZ E;  2VF1 A;  2VQF E;  1SR9 A;  4M0V A;  3AV0 A;  3ZOQ B;  5AE3 A;  5IWA E;  1EKZ A;  4LFC E;  2YZT A;  3F6H A;  4DKK A;  5AE2 A;  2L3C A;  1N33 E;  4DR5 E;  4NXN E;  4F9B B;  2JR1 A;  4WPY A;  4YY3 E;  5T6J A;  2ODR C;  2VQE E;  1FKA E;  2UUC E;  3J81 C;  2DIX A;  4M30 A;  4KZS A;  4DV2 E;  2N3H A;  2B7T A;  4LTY A;  4B3T E;  2IHR 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...