3RMPA

Structural basis for the recognition of attp substrates by p4-like integrases
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SLTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLSDARQQREGIRKMLALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CP4-like integrase
publication title Structural basis for the recognition of attP substrates by P4-like integrases
rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
total genus 17
structure length 77
sequence length 77
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3rmpA00
3JU0A 3RMPA 3JTZA
chains in the Genus database with same CATH superfamily
3HPZA 2UUBE 3ADLA 1L4SA 2EM0A 4JI2E 2EOOA 4DV3E 4DR1E 4JI6E 1X3CA 3VHTB 2DSYA 5IWAE 4JV5E 1HNZE 4GKKE 2UXBE 1NCSA 4B3TE 2A25A 2GPIA 2BB8A 2MDRA 1XMQE 4R2CA 4DR2E 4JI7E 3MHSC 4FK5C 2N3GA 3C6KA 5AE1A 2EMLA 1YUJA 5T6JA 4I8OA 2RSMA 3BGHA 4Q35B 2LVHA 2EMHA 2K7IA 2LO3A 2DIXA 3IWCA 4DR5E 3KWRA 1X6EA 4DR6E 2ODRC 1ZR9A 5AC5A 4N4RB 2K4VA 4WX9A 4R2PA 2V83A 1YYOA 2M9AA 2EN6A 4NHRA 2EPRA 2N8XA 2NUEA 1IBME 2V89A 2YTGA 2EWLA 2B7TA 4BBYA 3T1YE 1IQOA 4R8OA 4MLVA 2VF1A 1RQ0A 1X5WA 4ZYDA 1YPNA 1XNQE 2JVAA 4WXCA 2ADRA 1GQEA 2JR1A 2YTPA 2WBTA 2CT1A 4GKJE 5LL6R 1J5EE 2D9HA 4AQYE 2L3CA 2EMAA 3HXLA 1GZ6A 2IHR1 2YT4A 2EM7A 5F3WA 4JYAE 4B3SE 2LE2A 3JAMC 2V85A 3H09A 3EPHA 1WXRA 4YY3E 1UHZA 5AASA 1JK2A 2EOQA 1TF6A 4WFTA 1AAYA 3J7AG 1X6FA 2EN1A 2V88A 2EPMX 2YTFA 4GZNC 4L5NC 5KL7A 4LF7E 3ADGA 4DV6E 4DR3E 3HPSA 5AC4A 4WSGA 4LF4E 1A1HA 3THNA 4DKKA 3BBGA 2UU9E 2FGGA 2CTDA 3JTZA 2HHHE 2CSHA 5TSEA 4DV7E 5A6BD 2PRTA 2JP9A 2JY9A 1LLMC 1YZ9A 1N3GA 3RMPA 4NXNE 2UXDE 2DLKA 2KONA 2RPCA 4OX9E 1X49A 2EOXA 1HNXE 1STUA 4O5GA 2R1FA 4F6MA 2EMBA 2EPLX 1AH5A 4O24A 2RS7A 2EMXA 2EE8A 4HTGA 1GTKA 1QU6A 4BMJA 1EKZA 2EN8A 5IXMB 1WHNA 2NA2A 2LUPB 2ELZA 4IS1C 2B3TB 2LUQA 2EM3A 2EPCA 3EPLA 3J7Yp 3EPJA 4F9CB 3OMLA 4F6NA 3C6MA 4Q28A 5BR8E 5LMUE 2EP3A 2H36X 2EL4A 3KZYA 2JOBA 4DR7E 1BBOA 2YTDA 2LMZA 2GLIA 4P78A 2EN3A 1UILA 2LV2A 1N34E 5LMNE 2E72A 2YRHA 2EM8A 2EPKX 1J26A 4BCAA 4BC7A 1BB8A 2V87A 4R2EA 5CFFE 3DF6A 1A1IA 4HEIA 2V86A 4X64E 2L8TA 4IJDA 4J8ZA 1EH8A 2ELYA 3M99B 2LCEA 4TUGA 2EN2A 2YU5A 2BBGA 2EOFA 2L3JA 5IV8B 5A6KA 1EH6A 2LTSA 4JI3E 2LTRA 2GHFA 1BBGA 3L00A 1PJQA 3LMLA 1PJTA 2EN7A 1IQSA 2HGHA 2JXPA 2DRPA 4ZYHA 2MKNA 5KL2A 1WJPA 4NXME 2EMIA 5A6BA 2ENHA 1A1GA 2EQ0A 2ZM6E 2YTIA 3HQ1A 3K6QA 2JYAA 1PKPA 2EM5A 2YZTA 4LF5E 3THOB 2EOMA 4KZSA 1YYKA 2EOHA 3ZOQB 1ZAAC 4ZYGA 1YFHA 1P47A 1F2IG 2ENAA 1A1KA 2M1SA 4F54A 1T4OA 2DMYA 3EQ1A 2F8BA 4MLQA 4M2ZA 4M9VC 1T4NA 2MC6A 2KOUA 4B3ME 2YTEA 3F6GA 4BS9A 4JI1E 2LRSA 2G7HA 2RTXA 1IBLE 4X9JA 4JI4E 1FJGE 2EL6A 4F9AB 1ZU1A 2LJHA 2EPXA 2L2MA 4JI8E 2EM9A 2NUFA 2VQEE 1G2FC 2JOXA 4LF9E 4LFAE 5LLQA 2UUCE 1ZBQA 1UBDC 2B9DA 2EMFA 1NEIA 4DV2E 1N36E 2EN4A 5A6JA 4JI5E 2EMYA 2YRMA 3ADJA 2LBSB 1B69A 1FKAE 2EQ3A 1MGTA 2DMIA 4GEQB 3JU0A 2EOJA 4RH8A 4RHBB 2EPZA 4R2AA 2EL5A 2N3HA 1HR0E 2EMCA 1EH7A 2KHXA 4X65E 2B7VA 3ADIA 1PJSA 4O4KA 5IT9C 4LFCE 3AUZA 4R2DA 4R03A 3TQMA 2R76A 5FLXC 3C4TA 4KWYA 3F6HA 3BF2A 4DV5E 4ZYEA 1X6HA 4LFBE 2WBSA 5AE3A 2RQLA 2M4IA 4LF8E 2EPOA 4TUIA 2EOIA 1WRJA 4DV0E 4DMIA 2WCC3 5ADZA 2FTXB 2UXCE 1JK1A 1XNRE 2EOYA 2NUGA 2MKDA 1TN9A 2F4VE 2J7JA 4X8WA 4BHCA 2DGCA 4R2QA 4WPYA 3P1XA 4R2SA 1O0WA 2YU8A 1G2DC 2WBUA 1TF3A 1SFEA 1HNWE 5KL6A 2MC5A 2V8QB 4WXDA 1I94E 2EMGA 1N33E 2EPAA 1N32E 4LU9A 2UUAE 5A2QC 3UK3C 4M0VA 2L6MA 4NZVA 4JI0E 2EPNA 1RC7A 2EPPA 1YSAC 3DJWA 3IWBA 4M30A 1MEYC 1Z1BA 4LF6E 1T39A 2VRDA 2EM6A 1PDAA 2HC5A 5KL3A 2YTQA 2E1MA 1DGCA 4DR4E 3OTOE 2RSIA 4DV4E 1ZBTA 4P7DA 1X47A 3MSWA 2JPAA 2EOZA 2EMKA 5KL5A 2Q8UA 1XMOE 3KZZA 1T38A 2EORA 2EOSA 2VQFE 2ENCA 4LTYA 5A69A 3J81C 4KHPE 3EPKA 4R2RA 1YYWA 1X48A 2CPNA 2L33A 5AE2A 1KJKA 2YWQA 1RMDA 2NABA 5KL4A 2DB2A 2YTOA 2L92A 4X66E 1DI2A 2LJUA 2MDGA 4X62E 2EMZA 4F2JC 2E5LE 3MHHC 4YHHE 2EMWA 3VYYA 2EOEA 2RS6A 3VK6A 2L2KB 2L2NA 1A1LA 3FIGA 3LLHA 2EM4A 2EM2A 3T1HE 2ODRD 3AV0A 4DUZE 1SR9A 2YTNA 1IBKE 1UN6B 2HJJA 4BC9A 1QNTA 3QG5C 4WYQB 2YTJA 4K0KE 3ECRA 2YPNA 5A6AA 4B3RE 4BHBA 1WHQA 2VE7C 2WZOA 4WSPA 2FV4B 5DNYA 3HTXA 4DV1E 2EJ4A 2DLQA 2EPUA 4L8NA 2EQ1A 3BIDA 1YUIA 2EZ6A 2LT7A 4OOGC 4DUYE 1KYQA 1IMUA 1T4LB 3IWDA 2YSOA 2M7QA 2I13A 2YRKA 1A1JA 4O43A 2I9IA 2YSPA 3C4BA 1A1FA 4F9BB 1DQ3A 2JWOA 3VYXA 3J80C
chains in the Genus database with same CATH topology
3HPZA 2UUBE 3ADLA 2JY9A 1YZ9A 2M1SA 4F54A 1T4OA 3RMPA 4JI2E 4DV3E 4NXNE 2DMYA 4DR1E 2UXDE 2F8BA 4JI6E 4M2ZA 2KONA 1T4NA 4OX9E 1X49A 2E1MA 2MC6A 2KOUA 4B3ME 2DSYA 5IWAE 4JV5E 3F6GA 1STUA 4BS9A 2LRSA 2G7HA 2RTXA 3OTOE 1IBLE 1HNXE 1HNZE 4DV4E 4JI4E 4B3TE 1FJGE 4GKKE 2UXBE 1ZBTA 2MDRA 4P7DA 1X47A 1XMQE 2RS7A 3MSWA 4F9AB 2LJHA 4JI7E 4DR2E 1XMOE 2N3GA 2L2MA 4JI8E 5AE1A 2NUFA 1QU6A 2VQFE 4BMJA 2VQEE 1EKZA 5T6JA 2JOXA 4I8OA 4LF9E 2RSMA 4LTYA 1WHNA 4LFAE 2NA2A 3J81C 4KHPE 1YYWA 2LUPB 1X48A 3IWCA 2DIXA 4DR5E 2UUCE 3KWRA 2B3TB 2LUQA 4DR6E 2CPNA 1ZBQA 2L33A 2B9DA 2ODRC 3J7Yp 5AE2A 2HHHE 1N36E 4F9CB 3OMLA 4DV2E 2K4VA 4JI5E 4Q28A 5BR8E 2DB2A 2V83A 3ADJA 5LMUE 2LBSB 1YYOA 2H36X 2L92A 4X66E 1FKAE 4GEQB 1DI2A 3JU0A 4X62E 2JOBA 4DR7E 2N3HA 2LMZA 2E5LE 4P78A 1HR0E 3J80C 2NUEA 1UILA 2V89A 1IBME 2EWLA 2B7TA 2KHXA 4BBYA 4YHHE 1N34E 4X65E 5LMNE 3VYYA 3T1YE 2B7VA 2RS6A 4R8OA 3VK6A 2L2KB 2L2NA 4LFCE 5IT9C 4BCAA 3ADIA 3AUZA 3FIGA 4R03A 3LLHA 4BC7A 1J26A 2VF1A 2V87A 5FLXC 1RQ0A 3C4TA 3T1HE 2ODRD 3F6HA 5CFFE 3DF6A 3AV0A 4DV5E 1XNQE 2JVAA 4DUZE 1SR9A 1GQEA 2V86A 1IBKE 4LFBE 4JI1E 2JR1A 5AE3A 4X64E 2L8TA 2M4IA 4J8ZA 4LF8E 4TUIA 4GKJE 5LL6R 4DV0E 4BC9A 1J5EE 4DMIA 4AQYE 2L3CA 4WYQB 3HXLA 4TUGA 1GZ6A 2IHR1 5ADZA 2FTXB 4K0KE 2UXCE 2YT4A 5F3WA 1XNRE 4JYAE 4B3SE 4B3RE 2LE2A 3JAMC 2NUGA 1WHQA 2VE7C 2WZOA 2L3JA 2F4VE 4X8WA 4WSPA 2V85A 2FV4B 2LTSA 3H09A 4WPYA 1WXRA 4YY3E 5DNYA 3P1XA 4JI3E 2LTRA 1O0WA 4DV1E 3HTXA 1UHZA 5AASA 3LMLA 4L8NA 2EZ6A 1HNWE 4OOGC 4DUYE 2MC5A 2V8QB 4WFTA 1I94E 1N33E 3J7AG 1N32E 4LU9A 2V88A 1T4LB 3IWDA 5A2QC 2UUAE 2M7QA 4NXME 4L5NC 4LF7E 4DR4E 3ADGA 2L6MA 4M0VA 4JI0E 2ZM6E 3HQ1A 4DV6E 3K6QA 4DR3E 1PKPA 2YZTA 1RC7A 4LF5E 3C4BA 3HPSA 4LF4E 3DJWA 3IWBA 4DKKA 4F9BB 2UU9E 4M30A 2FGGA 4KZSA 1DQ3A 1YYKA 2JWOA 3JTZA 3VYXA 4LF6E 3ZOQB 4DV7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JU0 A;  3RMP A;  3JTZ A; 
#chains in the Genus database with same CATH topology
 3HPZ A;  2UUB E;  3ADL A;  1L4S A;  2EM0 A;  4JI2 E;  2EOO A;  4DV3 E;  4DR1 E;  4JI6 E;  1X3C A;  3VHT B;  2DSY A;  5IWA E;  4JV5 E;  1HNZ E;  4GKK E;  2UXB E;  1NCS A;  4B3T E;  2A25 A;  2GPI A;  2BB8 A;  2MDR A;  1XMQ E;  4R2C A;  4DR2 E;  4JI7 E;  3MHS C;  4FK5 C;  2N3G A;  3C6K A;  5AE1 A;  2EML A;  1YUJ A;  5T6J A;  4I8O A;  2RSM A;  3BGH A;  4Q35 B;  2LVH A;  2EMH A;  2K7I A;  2LO3 A;  2DIX A;  3IWC A;  4DR5 E;  3KWR A;  1X6E A;  4DR6 E;  2ODR C;  1ZR9 A;  5AC5 A;  4N4R B;  2K4V A;  4WX9 A;  4R2P A;  2V83 A;  1YYO A;  2M9A A;  2EN6 A;  4NHR A;  2EPR A;  2N8X A;  2NUE A;  1IBM E;  2V89 A;  2YTG A;  2EWL A;  2B7T A;  4BBY A;  3T1Y E;  1IQO A;  4R8O A;  4MLV A;  2VF1 A;  1RQ0 A;  1X5W A;  4ZYD A;  1YPN A;  1XNQ E;  2JVA A;  4WXC A;  2ADR A;  1GQE A;  2JR1 A;  2YTP A;  2WBT A;  2CT1 A;  4GKJ E;  5LL6 R;  1J5E E;  2D9H A;  4AQY E;  2L3C A;  2EMA A;  3HXL A;  1GZ6 A;  2IHR 1;  2YT4 A;  2EM7 A;  5F3W A;  4JYA E;  4B3S E;  2LE2 A;  3JAM C;  2V85 A;  3H09 A;  3EPH A;  1WXR A;  4YY3 E;  1UHZ A;  5AAS A;  1JK2 A;  2EOQ A;  1TF6 A;  4WFT A;  1AAY A;  3J7A G;  1X6F A;  2EN1 A;  2V88 A;  2EPM X;  2YTF A;  4GZN C;  4L5N C;  5KL7 A;  4LF7 E;  3ADG A;  4DV6 E;  4DR3 E;  3HPS A;  5AC4 A;  4WSG A;  4LF4 E;  1A1H A;  3THN A;  4DKK A;  3BBG A;  2UU9 E;  2FGG A;  2CTD A;  3JTZ A;  2HHH E;  2CSH A;  5TSE A;  4DV7 E;  5A6B D;  2PRT A;  2JP9 A;  2JY9 A;  1LLM C;  1YZ9 A;  1N3G A;  3RMP A;  4NXN E;  2UXD E;  2DLK A;  2KON A;  2RPC A;  4OX9 E;  1X49 A;  2EOX A;  1HNX E;  1STU A;  4O5G A;  2R1F A;  4F6M A;  2EMB A;  2EPL X;  1AH5 A;  4O24 A;  2RS7 A;  2EMX A;  2EE8 A;  4HTG A;  1GTK A;  1QU6 A;  4BMJ A;  1EKZ A;  2EN8 A;  5IXM B;  1WHN A;  2NA2 A;  2LUP B;  2ELZ A;  4IS1 C;  2B3T B;  2LUQ A;  2EM3 A;  2EPC A;  3EPL A;  3J7Y p;  3EPJ A;  4F9C B;  3OML A;  4F6N A;  3C6M A;  4Q28 A;  5BR8 E;  5LMU E;  2EP3 A;  2H36 X;  2EL4 A;  3KZY A;  2JOB A;  4DR7 E;  1BBO A;  2YTD A;  2LMZ A;  2GLI A;  4P78 A;  2EN3 A;  1UIL A;  2LV2 A;  1N34 E;  5LMN E;  2E72 A;  2YRH A;  2EM8 A;  2EPK X;  1J26 A;  4BCA A;  4BC7 A;  1BB8 A;  2V87 A;  4R2E A;  5CFF E;  3DF6 A;  1A1I A;  4HEI A;  2V86 A;  4X64 E;  2L8T A;  4IJD A;  4J8Z A;  1EH8 A;  2ELY A;  3M99 B;  2LCE A;  4TUG A;  2EN2 A;  2YU5 A;  2BBG A;  2EOF A;  2L3J A;  5IV8 B;  5A6K A;  1EH6 A;  2LTS A;  4JI3 E;  2LTR A;  2GHF A;  1BBG A;  3L00 A;  1PJQ A;  3LML A;  1PJT A;  2EN7 A;  1IQS A;  2HGH A;  2JXP A;  2DRP A;  4ZYH A;  2MKN A;  5KL2 A;  1WJP A;  4NXM E;  2EMI A;  5A6B A;  2ENH A;  1A1G A;  2EQ0 A;  2ZM6 E;  2YTI A;  3HQ1 A;  3K6Q A;  2JYA A;  1PKP A;  2EM5 A;  2YZT A;  4LF5 E;  3THO B;  2EOM A;  4KZS A;  1YYK A;  2EOH A;  3ZOQ B;  1ZAA C;  4ZYG A;  1YFH A;  1P47 A;  1F2I G;  2ENA A;  1A1K A;  2M1S A;  4F54 A;  1T4O A;  2DMY A;  3EQ1 A;  2F8B A;  4MLQ A;  4M2Z A;  4M9V C;  1T4N A;  2MC6 A;  2KOU A;  4B3M E;  2YTE A;  3F6G A;  4BS9 A;  4JI1 E;  2LRS A;  2G7H A;  2RTX A;  1IBL E;  4X9J A;  4JI4 E;  1FJG E;  2EL6 A;  4F9A B;  1ZU1 A;  2LJH A;  2EPX A;  2L2M A;  4JI8 E;  2EM9 A;  2NUF A;  2VQE E;  1G2F C;  2JOX A;  4LF9 E;  4LFA E;  5LLQ A;  2UUC E;  1ZBQ A;  1UBD C;  2B9D A;  2EMF A;  1NEI A;  4DV2 E;  1N36 E;  2EN4 A;  5A6J A;  4JI5 E;  2EMY A;  2YRM A;  3ADJ A;  2LBS B;  1B69 A;  1FKA E;  2EQ3 A;  1MGT A;  2DMI A;  4GEQ B;  3JU0 A;  2EOJ A;  4RH8 A;  4RHB B;  2EPZ A;  4R2A A;  2EL5 A;  2N3H A;  1HR0 E;  2EMC A;  1EH7 A;  2KHX A;  4X65 E;  2B7V A;  3ADI A;  1PJS A;  4O4K A;  5IT9 C;  4LFC E;  3AUZ A;  4R2D A;  4R03 A;  3TQM A;  2R76 A;  5FLX C;  3C4T A;  4KWY A;  3F6H A;  3BF2 A;  4DV5 E;  4ZYE A;  1X6H A;  4LFB E;  2WBS A;  5AE3 A;  2RQL A;  2M4I A;  4LF8 E;  2EPO A;  4TUI A;  2EOI A;  1WRJ A;  4DV0 E;  4DMI A;  2WCC 3;  5ADZ A;  2FTX B;  2UXC E;  1JK1 A;  1XNR E;  2EOY A;  2NUG A;  2MKD A;  1TN9 A;  2F4V E;  2J7J A;  4X8W A;  4BHC A;  2DGC A;  4R2Q A;  4WPY A;  3P1X A;  4R2S A;  1O0W A;  2YU8 A;  1G2D C;  2WBU A;  1TF3 A;  1SFE A;  1HNW E;  5KL6 A;  2MC5 A;  2V8Q B;  4WXD A;  1I94 E;  2EMG A;  1N33 E;  2EPA A;  1N32 E;  4LU9 A;  2UUA E;  5A2Q C;  3UK3 C;  4M0V A;  2L6M A;  4NZV A;  4JI0 E;  2EPN A;  1RC7 A;  2EPP A;  1YSA C;  3DJW A;  3IWB A;  4M30 A;  1MEY C;  1Z1B A;  4LF6 E;  1T39 A;  2VRD A;  2EM6 A;  1PDA A;  2HC5 A;  5KL3 A;  2YTQ A;  2E1M A;  1DGC A;  4DR4 E;  3OTO E;  2RSI A;  4DV4 E;  1ZBT A;  4P7D A;  1X47 A;  3MSW A;  2JPA A;  2EOZ A;  2EMK A;  5KL5 A;  2Q8U A;  1XMO E;  3KZZ A;  1T38 A;  2EOR A;  2EOS A;  2VQF E;  2ENC A;  4LTY A;  5A69 A;  3J81 C;  4KHP E;  3EPK A;  4R2R A;  1YYW A;  1X48 A;  2CPN A;  2L33 A;  5AE2 A;  1KJK A;  2YWQ A;  1RMD A;  2NAB A;  5KL4 A;  2DB2 A;  2YTO A;  2L92 A;  4X66 E;  1DI2 A;  2LJU A;  2MDG A;  4X62 E;  2EMZ A;  4F2J C;  2E5L E;  3MHH C;  4YHH E;  2EMW A;  3VYY A;  2EOE A;  2RS6 A;  3VK6 A;  2L2K B;  2L2N A;  1A1L A;  3FIG A;  3LLH A;  2EM4 A;  2EM2 A;  3T1H E;  2ODR D;  3AV0 A;  4DUZ E;  1SR9 A;  2YTN A;  1IBK E;  1UN6 B;  2HJJ A;  4BC9 A;  1QNT A;  3QG5 C;  4WYQ B;  2YTJ A;  4K0K E;  3ECR A;  2YPN A;  5A6A A;  4B3R E;  4BHB A;  1WHQ A;  2VE7 C;  2WZO A;  4WSP A;  2FV4 B;  5DNY A;  3HTX A;  4DV1 E;  2EJ4 A;  2DLQ A;  2EPU A;  4L8N A;  2EQ1 A;  3BID A;  1YUI A;  2EZ6 A;  2LT7 A;  4OOG C;  4DUY E;  1KYQ A;  1IMU A;  1T4L B;  3IWD A;  2YSO A;  2M7Q A;  2I13 A;  2YRK A;  1A1J A;  4O43 A;  2I9I A;  2YSP A;  3C4B A;  1A1F A;  4F9B B;  1DQ3 A;  2JWO A;  3VYX A;  3J80 C; 
#chains in the Genus database with same CATH homology
 3HPZ A;  2UUB E;  3ADL A;  2JY9 A;  1YZ9 A;  2M1S A;  4F54 A;  1T4O A;  3RMP A;  4JI2 E;  4DV3 E;  4NXN E;  2DMY A;  4DR1 E;  2UXD E;  2F8B A;  4JI6 E;  4M2Z A;  2KON A;  1T4N A;  4OX9 E;  1X49 A;  2E1M A;  2MC6 A;  2KOU A;  4B3M E;  2DSY A;  5IWA E;  4JV5 E;  3F6G A;  1STU A;  4BS9 A;  2LRS A;  2G7H A;  2RTX A;  3OTO E;  1IBL E;  1HNX E;  1HNZ E;  4DV4 E;  4JI4 E;  4B3T E;  1FJG E;  4GKK E;  2UXB E;  1ZBT A;  2MDR A;  4P7D A;  1X47 A;  1XMQ E;  2RS7 A;  3MSW A;  4F9A B;  2LJH A;  4JI7 E;  4DR2 E;  1XMO E;  2N3G A;  2L2M A;  4JI8 E;  5AE1 A;  2NUF A;  1QU6 A;  2VQF E;  4BMJ A;  2VQE E;  1EKZ A;  5T6J A;  2JOX A;  4I8O A;  4LF9 E;  2RSM A;  4LTY A;  1WHN A;  4LFA E;  2NA2 A;  3J81 C;  4KHP E;  1YYW A;  2LUP B;  1X48 A;  3IWC A;  2DIX A;  4DR5 E;  2UUC E;  3KWR A;  2B3T B;  2LUQ A;  4DR6 E;  2CPN A;  1ZBQ A;  2L33 A;  2B9D A;  2ODR C;  3J7Y p;  5AE2 A;  2HHH E;  1N36 E;  4F9C B;  3OML A;  4DV2 E;  2K4V A;  4JI5 E;  4Q28 A;  5BR8 E;  2DB2 A;  2V83 A;  3ADJ A;  5LMU E;  2LBS B;  1YYO A;  2H36 X;  2L92 A;  4X66 E;  1FKA E;  4GEQ B;  1DI2 A;  3JU0 A;  4X62 E;  2JOB A;  4DR7 E;  2N3H A;  2LMZ A;  2E5L E;  4P78 A;  1HR0 E;  3J80 C;  2NUE A;  1UIL A;  2V89 A;  1IBM E;  2EWL A;  2B7T A;  2KHX A;  4BBY A;  4YHH E;  1N34 E;  4X65 E;  5LMN E;  3VYY A;  3T1Y E;  2B7V A;  2RS6 A;  4R8O A;  3VK6 A;  2L2K B;  2L2N A;  4LFC E;  5IT9 C;  4BCA A;  3ADI A;  3AUZ A;  3FIG A;  4R03 A;  3LLH A;  4BC7 A;  1J26 A;  2VF1 A;  2V87 A;  5FLX C;  1RQ0 A;  3C4T A;  3T1H E;  2ODR D;  3F6H A;  5CFF E;  3DF6 A;  3AV0 A;  4DV5 E;  1XNQ E;  2JVA A;  4DUZ E;  1SR9 A;  1GQE A;  2V86 A;  1IBK E;  4LFB E;  4JI1 E;  2JR1 A;  5AE3 A;  4X64 E;  2L8T A;  2M4I A;  4J8Z A;  4LF8 E;  4TUI A;  4GKJ E;  5LL6 R;  4DV0 E;  4BC9 A;  1J5E E;  4DMI A;  4AQY E;  2L3C A;  4WYQ B;  3HXL A;  4TUG A;  1GZ6 A;  2IHR 1;  5ADZ A;  2FTX B;  4K0K E;  2UXC E;  2YT4 A;  5F3W A;  1XNR E;  4JYA E;  4B3S E;  4B3R E;  2LE2 A;  3JAM C;  2NUG A;  1WHQ A;  2VE7 C;  2WZO A;  2L3J A;  2F4V E;  4X8W A;  4WSP A;  2V85 A;  2FV4 B;  2LTS A;  3H09 A;  4WPY A;  1WXR A;  4YY3 E;  5DNY A;  3P1X A;  4JI3 E;  2LTR A;  1O0W A;  4DV1 E;  3HTX A;  1UHZ A;  5AAS A;  3LML A;  4L8N A;  2EZ6 A;  1HNW E;  4OOG C;  4DUY E;  2MC5 A;  2V8Q B;  4WFT A;  1I94 E;  1N33 E;  3J7A G;  1N32 E;  4LU9 A;  2V88 A;  1T4L B;  3IWD A;  5A2Q C;  2UUA E;  2M7Q A;  4NXM E;  4L5N C;  4LF7 E;  4DR4 E;  3ADG A;  2L6M A;  4M0V A;  4JI0 E;  2ZM6 E;  3HQ1 A;  4DV6 E;  3K6Q A;  4DR3 E;  1PKP A;  2YZT A;  1RC7 A;  4LF5 E;  3C4B A;  3HPS A;  4LF4 E;  3DJW A;  3IWB A;  4DKK A;  4F9B B;  2UU9 E;  4M30 A;  2FGG A;  4KZS A;  1DQ3 A;  1YYK A;  2JWO A;  3JTZ A;  3VYX A;  4LF6 E;  3ZOQ B;  4DV7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...