3EQ1A

The crystal structure of human porphobilinogen deaminase at 2.8a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
338
structure length
312
Chain Sequence
RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPQHEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human porphobilinogen deaminase at 2.8 A: the molecular basis of acute intermittent porphyria
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 96
structure length 312
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3eq1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A02
2XXVA 5KCJA 1MDQA 4N13A 4OETA 4EF1A 3FJ7A 4U1ZA 1QUKA 1SW4A 1PB7A 4HCYA 2WKYA 3EHUA 4LZ7A 1NFTA 1OLAA 3IO6A 1QVSA 2F97A 3CG3A 3G3JA 4U23A 4BDRA 3O29A 5HPQA 1MXVA 2I6EA 3FIRA 2Y7KA 1D9YA 2QSXA 5K2YA 1NKXA 1POY1 2HZKA 5A5XA 1RYOA 4LUBA 1UQWA 2YJPA 1OMPA 1MQGA 3MZ1A 1NL5A 4C1UA 3N6UA 2RC8A 3W15C 1BKAA 2UXAA 4KYSA 4EF2A 3H06B 1ZMGA 5BUUA 4E0XA 1A40A 5L9OA 4ND9A 1Q1KA 4GQOA 1XVYA 2QS3A 4FAJA 1MY2A 2GH9A 4TQUQ 1SBPA 3DELB 4IO6A 5I58A 1L5TA 3I5OA 5KCJB 3SEWA 3TELA 1M5CA 1P99A 1B2HA 1B4HA 3K1PA 2VOZA 3HHFA 3TTMA 3V5AA 3T96B 1Y1MA 4RXLA 3UGWA 2DQVA 2H4IA 5TP9B 1NH7A 4ZECA 5AA4B 3A09A 3RGYA 3SETA 1GGGA 3ZSFA 2QS2A 2UYFA 3L6GA 2F78A 1MXYA 2D21A 3MWBA 3O66A 4IY6A 4U21A 1GVCA 3RUMA 4F19A 4C1TA 2OZZA 4R9GA 4OHNA 4F2OA 3EQ1A 1FTMA 1VE4A 2O1MA 4GD5A 5I56A 4GFRA 3GBAA 5H8HB 1DOTA 4PFUA 2E0SA 4X9TA 5CMMA 3RQTA 2ONSA 4OEVA 4TLLB 4FEBA 2YLNA 4Z7EA 2OWTA 4UACA 1P1NA 4O3CA 1OQHA 2IEEA 3VLVA 1XC1A 1UTHB 2B65A 3B7DA 3MQ9A 1MQDA 1A54A 1S50A 5FTIA 4IY5A 4H6DA 2YPNA 1AIVA 5EHMA 5TPAA 1QJMA 2I49A 1N04A 3MUQA 3THIA 3T9HB 2UVIA 2DYXA 1I6QA 3K4UA 3R26A 1MPCA 1O64A 3T93B 3KSJA 3K6VA 1MDP1 3FJMA 2F7CA 3BBRA 3LSWA 3U72A 3PGFA 1NH8A 4BDNA 1MG1A 3E13X 2H9BA 3VVEA 4KCCA 1IXIA 3LSXA 4JDFA 4JWXA 1B1XA 1P1QA 1Y20A 3FVGA 1LB8A 3LBSA 4GWOA 4H8IA 3TCFA 4R73A 3MC2A 3ZKLA 3R7XA 3O9PA 2NUVA 4XKQA 4QFKA 3C35A 1IZ1A 1EH3A 3FVKA 2XX7A 2XXRA 1URDA 3MVXA 3VVDA 5I2NA 4U4XA 1CE2A 3Q29A 1P1WA 3KFMA 4GXAA 5IKBA 2PVUA 3WAFA 5F7VA 2O68A 3GLBA 3ZS6A 5JTYB 3VFJA 2ZYKA 5BWJA 4E0WA 1I6AA 1SD3A 2AYSA 2B3BA 4PE5B 1MQJA 3K1NA 1JETA 4PQJA 2NVUB 4U22A 2XXHA 4KYEA 3FATA 2G29A 2OJTA 3ILUB 4FJPA 3FVNA 3PMWA 1AL3A 1O7TA 4H5GA 1B5HA 2PMSA 1ATGA 2DE4A 5FHOA 3T66A 3PPPA 4OFLA 1LB9A 3RT6B 4YMBA 3MP8A 1FTJA 1MXUA 1MY1A 4PFYA 3C31A 2VHAA 1P1OA 3KN3A 3C34A 4WEPA 2PX1A 4ZEFA 1EZPA 4NE4A 1FQBA 1LSTA 3ECRA 1KWHA 1Z7NE 4R75A 1FQAA 3R6UA 2F7AA 4G68A 4ZEIA 3KEIA 1Y3NA 5I84A 4G8HA 3MP6A 5KDTB 1Y3PA 5HBCA 1ZIUA 2RCAA 3EF7A 3IOVA 3PUZE 3D4GA 3PUVE 1P1UA 3M3KA 1XT8A 3PMXA 1B6HA 3B6QA 2XXIA 3LR1A 3SEVA 4ECFA 4NF5A 4XKRA 2F6PA 1IXCA 2ZNUA 1XOCA 2A5TA 3IB2A 2XXYA 5EYFA 5CBRA 1AH5A 2Q2AA 4GF8A 1MXWA 4RJZA 2ZYNA 5EHSA 3RT8A 2O7UA 4JSDA 2AIXA 1QW0A 1ZJLA 2XX8A 4OMBA 3KJ7A 1N7WA 5H8NA 3IOTA 3V83A 3KOSA 1PC3A 5CBSA 3KOTA 5DVFA 3HO7A 3Q27A 4R2BA 3O97A 2HCAA 3ODBA 2HEUA 1FQEA 3HCQA 3N94A 2GHAA 1N7XA 4NEDA 4BLAA 3V89B 3WAEA 1B52A 4XTCQ 4G68C 2V3TA 3C33A 1B5JA 3HN0A 5L8DA 1VFDA 4FATA 2DWHA 3SKPA 4EQ9A 1A8EA 1B7ZA 3KG2A 3FXUA 2I48A 2HQ0A 1FQCA 2X7PA 4H8JA 2B3FA 2QL3A 3IB0A 1MY0A 4X48A 1LAXA 3W9WA 1PBQA 1NNTA 2ANJA 3BKIB 4I1DA 5JTYA 4F31B 4YB5A 4YKIA 1LAFE 1MQIA 2A5TB 1US4A 3M3FA 1QKAA 1UTBA 1LBCA 1R9QA 2LAOA 2F36A 4OXVA 1BP5A 4U4SA 3UK4A 2F7BA 3VXCA 4HCWA 3QK6A 3SEUA 2I4BA 4F2QA 1AOVA 3FV1A 3PUYE 1J1NA 2I0CA 3G3IA 3RPWA 3H7MA 4ESWA 2X7QA 4EQBA 4HW8A 3VV5A 2XXTA 5FHMA 3HSTA 2UVHA 2AL4A 3QSLA 4IGRA 5H8FB 4G68B 3RTFB 1SYHA 3CRBA 3CI8A 1GR2A 3ILTB 1IITA 4POXA 3JZJA 1FTOA 2DS9A 3FUZA 3M8UA 5DTBA 5I57B 4Z0IA 4BDMA 1LAGE 3DM0A 4LQ5A 3DLNA 3OEKA 4Q8RA 3KZGA 4ZE8A 5TPAB 3T22A 3CVGA 3T9XB 1WVJA 3BFTA 4LVQA 2GFEA 2QRYA 4F3GA 4K3FA 3UN6A 4LZ5A 1PBPA 1UTHA 4ZS9A 2XD2A 2RCBA 2R9JA 2GRVA 3U8QA 2Y7PA 1TWYA 3UORA 4NF4B 4OVJA 4MLVA 1IXGA 3MVWA 4MLQA 5L9MA 4KYDA 3OEMA 5CMCA 3KN7A 4TLMB 5H8QA 1B40A 2PT2A 4JXIA 1MM6A 4F22A 4LA9A 4ELRA 4IO5A 4G8MA 4KHZE 5CMBA 5I2NB 3O2AA 1US5A 1DMBA 1B32A 4R2FA 2FYIA 5ITOA 3SDFA 2H99A 4MFIA 2QS4A 4QFNA 3EHTA 4RK9A 3VLWA 4OFOA 3H4ZA 5J1DA 3PV0E 4QFOA 1DPEA 1A55A 5H8QB 2Z8DA 3TTRA 3FZVA 1RYXA 1OLCA 3K1MA 5M2VA 1GV8A 5HM4B 3T9UA 4DE8A 1JEUA 5JEIA 3S4UA 2O84X 3FVOA 2BJJX 4R6YA 2ABHA 4KPTA 4DXBA 4BDLA 4C0RA 4ESXA 1NMUA 3GXAA 1T0KA 4ZEDA 2DE2A 3TZAA 1N84A 2DXRA 3CR9A 4Q30B 4F3PA 5FTHA 1LFIA 4F3SA 4MF3A 2ZYMA 3OOAA 2HZLA 3H6TA 3O28A 4QSDA 3EPEA 2F6GA 1B3HA 3FASA 3TTLA 4M4GA 2V3UA 3UP9A 4JWOA 2V93A 1VR5A 5ICQA 3K01A 3IK6B 2ALUA 1FTLA 1ZTYA 2P2AA 5H8NB 2XD3A 1B46A 1UTBB 1TT1A 2UYEA 3LUYA 3MP1A 5DEXA 2DWIA 1B4ZA 2E1SA 3UIFA 4L17A 2QS1A 3UA8A 4DCXA 4POWA 4ELOA 5ITPA 4NWDA 3DP4A 1PEBA 1LBBA 3CSGA 4YICA 4AQ4A 1NNFA 2A5SA 2QPQA 2V3QA 5B70A 1NNPA 4GVOA 1SW5A 1Z7ME 2OK2A 2XXXA 3B6TA 3QUFA 1MM7A 1MXZA 3K02A 3U92A 3S9LC 3U1OA 1ZU0A 1JW4A 3H03A 2I4CA 2F8DA 2R71A 2O6AA 4OESA 4KQPA 5AE4A 5L9SA 1SVXB 3OO6A 2XXUA 3HV1A 4PFWA 4N6PA 2X26A 4DZ1A 3BFUA 1F9BA 3LC8A 4PFTA 4EQ7A 3S9NC 1ZBMA 3G3FA 4ZE9A 2I0BA 4XXUA 3IO4A 1BTJA 1POTA 4FORA 4R6HA 4DLDA 3I6VA 3H3GA 1N3XA 2O69A 3M3LA 2PT1A 3OD7A 5AA2D 3MPLA 5AA3A 1LCFA 1MXXA 2F5XA 4IO2A 2QJEA 3RN8A 3HPIA 2NWJA 5I57A 3PPOA 1LAHE 3TODA 2DWAA 3K6UA 4JBZA 4G4PA 4O3AA 2VD3A 3FXQA 4X1DA 1N76A 2XXPA 4N07A 3PD8A 3TUSA 3MZ9A 3KGCA 3SESA 5F1QA 3S9EA 1FW0A 3K0VA 5DEXB 3QXMA 3S2VA 3MAMA 4P0IA 1HSEA 4GXSB 2ZNTA 3ONMA 1USYE 4WEDA 4I62A 3EN3A 4H0WA 1Y9UA 3IR1A 2CZLA 3KJTA 2QMWA 3OMBA 4YKJA 3OO7A 2PBWA 4ELPA 3FGSA 5KDTA 1B7HA 1DTGA 2Y7RA 1B0HA 4GOTA 1H76A 3RY3A 3G3GA 3TQWA 3EHSA 4U1OA 2O51A 4QSEA 3IOWA 3RTWB 3TAJA 2RINA 3TMGA 4F1VA 3S9MC 1M5DA 3TTNA 1MY3A 5CMKA 4PETA 3MVZA 2OWSA 4F3BA 1VFEA 4RA1A 1B3LA 1MY4A 2P0SA 3K2DA 1ANFA 4JWYA 3TFLA 1Y3QA 3A3UA 1EU8A 3K00A 4XIGQ 4AB5A 4KI0E 1ZLQA 5ISUA 3RLFE 2DVZA 1FQFA 2Q88A 4H1XA 4QFPA 2I3VA 2FNCA 3PU5A 1M5BA 4OYVA 1DTZA 1URGA 1H44A 3G3KA 3N5LA 4LATA 3O6GA 5H8HA 3H6UA 4DCYA 2NOOA 3OXNA 3LSFB 3Q25A 4ONYA 4MH5A 4TOZA 4R6KA 3H6VA 4QSCA 2ESNA 4RPNA 4RY1A 4Q5TA 1PB9A 1SW2A 1B1HA 2NXOA 3IL1B 3PPQA 4XKNA 3IJOB 1SW1A 1LCTA 3C9HA 1H45A 1MQHA 2Z8FA 4GL8A 1OQGA 1MH4A 1IXHA 2D5WA 3OENA 3OSRA 3SEXA 4OFJA 3CIJA 4GLIA 4ZZAA 2ONKE 4RNSA 3VDFA 1LFHA 1IUDA 4THIA 4ZEKA 2ZYOA 3TPAA 4AB6A 3PUWE 1PDAA 1SI1A 2G93A 5H8FA 5I58B 2VD2A 2UVJA 2XXWA 3CFLA 3ZKKA 3I3VA 2O1LA 1S7YA 4DXUA 5I2KA 2HAVA 3F11A 3IX1A 4DXCA 5I56B 4YAHX 3U93A 1A7LA 4LP2B 4QRZA 4DIGA 1D3KA 4FIMA 4OTEA 4YB6A 2CMOA 3TKDA 1M5EA 1XS5A 1BIYA 2REGA 1JVYA 3LSLA 1LGBC 3MW0A 4LZ8A 4R74A 1II5A 1R6ZA 4EXLA 4F18A 2DXYA 3O6HA 1QULA 5IAIA 4U2RA 2RC7A 3CFZA 4OERA 4KFQA 1M5FA 4NTLA 4IO3A 4QHQA 4DDDA 3QAXA 5AA4A 3DP8A 1A8FA 2Q89A 3OSQA 2GHBA 3KSXA 5LOMA 2V25A 2OLBA 2Z8EA 4IO4A 2V84A 2H98A 1I69A 1B3EA 2DSFA 4RYAA 4F1YA 2HXWA 3VLUA 4ZDMA 3IORA 1SYIA 1O63A 3MZBA 1B05A 4KD5A 3QUJA 4KR5A 4OWDA 1FCKA 1HSLA 4RPOA 5TP9A 5I59B 1AMFA 2DWJA 1Y4CA 1B51A 1JVXA 3D4CA 3IAZA 4GRKA 3KN8A 1I6BA 1D4NA 4ZZEA 1ELJA 3FV2A 3GBBA 4I9DA 3QYTA 2H25A 3C32A 1Y4TA 4NF6B 5B7DA 4OENA 1JW1A 5DVJA 1B7UA 1B58A 3MPKA 1CB6A 5CRYA 1GTKA 3USDA 1UIVA 3W9VA 1Q35A 1IQ7A 1N3WA 1XHYA 3CSBA 1YTVA 3DP6A 4FE8A 4GIZA 1JQFA 4YKPA 3MBPA 1LFGA 4OZ9A 3IOUA 1MPBA 4M1VA 1YPNA 5AA1A 1HSJA 1DSNA 1VSOA 2OCUA 1DPPA 3IJXB 3TCHA 1BLFA 1ZKBA 4NF6A 4IO7A 4NF5B 4H67A 4MBPA 5A5XB 1H3DA 1JW5A 1XVXA 2ZMBA 1QKBA 4NMYA 3Q28A 2XXQA 1FQDA 1S9TA 3JYRA 4P11A 5H8SA 2VP1A 1TXFA 3VVFA 3TEPA 1B3FA 2Z22A 1TFDA 4ZEBA 4R9FA 1SDXA 5K2XA 2M8CA 4OEUA 4LONB 1YCJA 4PP0A 4X1BA 1MS7A 5ELVA 3VXBA 3T9VA 2DVCA 3G3HA 3FD3A 2QMXA 4FECA 1QUIA 5TU0A 1A99A 2Q8JA 2UVGA 1B5IA 1OVTA 4EDPA 1MH3A 1Y1ZA 2ONRA 3OO9A 3FXRA 4YKKA 2IA4A 4IB2A 5DT6A 5AA2B 5DYHA 3K6XA 4NF8B 4H65A 3QIMA 1IEJA 5CC2A 4YMAA 2RF1A 2ZXTA 3V8XB 2H5YA 3C36A 3C4MA 2PYYA 4OQOA 3PMVA 4I8CA 4F1UA 1B9JA 1OVBA 2VGQA 1N0TA 3OO8A 1URSA 5I2KB 2DP8A 2DE3A 2Q2CA 2R6GE 3O6IA 4NF4A 3H6WA 3N26A 2HAUA 2XX9A 4G2ZA 4WXJA 2Q9TA 2ZNSA 3TCGA 4BDQA 3MJNA 5CM6A 3SEYA 1R1NA 3A3CA 3TTKA 3G7WA 3RNNA 3N6TA 5AA2A 2Y84A 3Q26A 3PPRA 1TFAA 1QUJA 2F34A 4QF9A 3E9XA 3TYHA 3U94A 1USYH 3IB1A 4LQ2A 5JK4A 4XKPA 2D3IA 5ICTA 3MVYA 3E4RA 3TQLA 4BDOA 1LLSA 2W7YA 3E3KA 3KBRA 3PPNA 1YAEA 1WDNA 2FA7A 4P0GA 4YZZA 2DOJA 2Y7IA 1UIUA 4RK2A 2OBGA 2P1SA 1SI0A 2HFBA 3PUXE 2XHDA 1MRPA 3B6WA 1JNFA 3PD9A 5DVIA 1WODA 4G8NA 4WKMA 1IIWA 3K6WA 1FTKA 4JSOA 1SQYA 4JB7A 3L6HA 1EZOA 1RKMA 3AXFA 5CI5A 3TDJA 4GL0A 4HTGA 4EXKA 1JEVA 3FJGA 3OELA 1R9LA 4KCDA 2KLFA 2RKMA 1MPDA 4H5FA 1OIBA 3JV9A 4YU0A 1D9VA 4IGTA 3P7IA 2I3WA 2F35A 4NWCA 4Q0CA 4EUOA 1PB8A 4G77A 4NF8A 2Y7WA 3GZGA 1H43A 5KZTA 3VE1B 2RC9A 3HHGA 4FEDA 1B0LA 3SERA 4ELQA 3CFXA 2I58A 4F39A 1B3GA 2THIA 2REJA 1NNKA 4UA8A 2AL5A 4ISUA 1EZ9A 4O3BA 2Z23A 4HS7A 4YB7A 5FHNA 4R72A 5I59A 4QFLA 4F29A 2O7IA 3CG1A
chains in the Genus database with same CATH superfamily
1MDQA 4OETA 2EM8A 4X8RA 1SW4A 4J8ZA 4RY1A 1NFTA 2WCC3 3FIRA 5K2YA 1DBZA 1L4SA 3E78A 3MZ1A 4C1UA 4EF2A 2UXAA 1ZMGA 2EN3A 4AQYE 4PC9A 4ND9A 2QS3A 4F9CB 1NV2A 1L5TA 3TELA 2EPRA 3J7AG 2WBBA 4PF8A 2F3DA 2H4IA 2EMFA 3RGYA 1GGGA 2QS2A 3O66A 2EOEA 2OZZA 4OHNA 2N8XA 2FVZA 3HQ1A 2EPZA 4LF7E 4PFUA 2E0SA 2V88A 4GKJE 2ONSA 2OWTA 1OQHA 2B65A 2N3HA 1A54A 2YPNA 2I49A 4ZYGA 3DF6A 3T9HB 2L8TA 4PAFA 4JYAE 3LSWA 3LSXA 4JDFA 1B1XA 3LBSA 4OX9E 2LRSA 4GWOA 3MC2A 1IZ1A 2XX7A 3VVDA 5I2NA 5IKBA 1P1WA 3WAFA 5BWJA 5JTYB 3VFJA 1SD3A 1MQJA 4FJPA 4WPYA 1LBWA 1B5HA 2R8TA 1ATGA 2OWZA 2ZZXA 4L5NC 1MXUA 3BBGA 1MY1A 5I7IA 3C31A 4R2DA 2PX1A 3R6UA 2F7AA 3KEIA 1Y3PA 3LLHA 1ZIUA 1P1UA 5LL6R 3LR1A 2LE2A 3SEVA 4ECFA 1FBGA 2YTIA 3IB2A 5CBRA 4R2SA 1AH5A 4RJZA 5EHSA 4BC9A 3RT8A 2O7UA 4DV1E 4OMBA 1N7WA 4GWYA 2MKNA 2RSIA 3R7XA 4BCAA 1FQEA 2EM2A 2EPCA 4P47A 2EM5A 4BLAA 1B52A 3K6QA 4Q28A 4XTCQ 5J16A 2V3TA 4PFIA 2FGGA 3HN0A 2DWHA 2UXBE 2JWOA 2I48A 2X7PA 2QL3A 1MY0A 4X48A 1A1FA 1PBQA 4MIJA 3BKIB 4YB5A 2ELZA 4OXVA 4U4SA 1BP5A 3UK4A 1BBOA 2F7BA 4HCWA 2EM7A 1J1NA 2EL4A 2VPNA 4HW8A 3VV5A 5FHMA 2UVHA 2YZTA 4G68B 1YZ0A 1WRJA 1IITA 1FTOA 1DQ3A 3FUZA 3M8UA 1LAGE 5T6JA 4ZE8A 5TPAB 2B9DA 3CVGA 4PFBA 2GFEA 2QRYA 1UTHA 2RCBA 2CPNA 4PGNA 3A29A 4MLQA 2HGHA 4KYDA 4JI3E 4I3EA 5H8QA 1B40A 4F22A 2DMIA 4JXIA 4O7MA 5DNYA 5CMBA 2EQ0A 1US5A 1NI9A 5ITOA 1NV6A 1GZ6A 2YTNA 2ENHA 2YT4A 2QS4A 3EHTA 3H4ZA 1DPEA 1STUA 2FHYA 3TTRA 1IMEA 1SPIA 4DE8A 5AASA 2O84X 3KWRA 2ABHA 4KPTA 4ZYHA 4DXBA 2EPLX 4C0RA 2A25A 5TSEA 5LMUE 1JK1A 2B4LA 1N84A 4F3PA 5FTHA 4F3SA 4F54A 2ZYMA 2HZLA 4JI4E 3TTLA 4JWOA 3IK6B 1FTLA 2ENCA 3LUYA 3MP1A 4L17A 5ITPA 4MX6A 1XMOE 1PEBA 4AQ4A 2A5SA 2WZOA 4GVOA 1A1JA 2OK2A 3S9LC 1JW4A 3H03A 4JI1E 2R71A 3IWBA 4KQPA 3OO6A 1XNQE 4N6PA 4PFTA 5IT9C 4I40A 1T4LB 1MXXA 1LAHE 2WX9A 2VD3A 3SESA 3AV0A 2EZ6A 3S9EA 1FW0A 3K0VA 5DEXB 2YTFA 3ONMA 1RDXA 1USYE 2EN8A 4WEDA 4I62A 2JXPA 2Y5KA 3IR1A 4H0WA 3LUZA 2QMWA 1QNTA 2LTSA 1IMBA 1B7HA 1DTGA 4GOTA 4HE0A 3RY3A 2L92A 4YY3E 3S9MC 2RINA 1M5DA 3TTNA 4I8OA 4PETA 4F3BA 1VFEA 4RA1A 3F6GA 4IR8A 2P0SA 4NXME 1ANFA 1EU8A 3K00A 2DVZA 2I3VA 2FNCA 1ZBTA 4LATA 3O6GA 3H6UA 3MYUA 4RPNA 2ESNA 4WSPA 2NXOA 2V87A 2V89A 1H45A 1MQHA 4GL8A 2L3JA 1IMUA 4P9KA 2ONKE 1WHQA 5LTCA 2DRPA 2UVJA 4JI5E 2O1LA 5I2KA 2GPIA 4F31B 5H8FA 1D3KA 4O24A 1M5EA 4JI2E 1BIYA 4F18A 1LGBC 2F3BA 5IAIA 2RC7A 3CFZA 1IQOA 2GHBA 5LOMA 3QMFA 4IO4A 2KOUA 1B3EA 4F1YA 3IORA 1O63A 1B05A 4JVIA 1AMFA 2DWJA 3D4CA 2EJ4A 4ZZEA 1ELJA 2KONA 3QYTA 3C32A 5ESYA 5DVJA 4DI3D 1CB6A 4F2QA 1IQ7A 1N3WA 4ESWA 1YTVA 3MBPA 4OZ9A 1YPNA 1VSOA 2QFLA 2OCUA 1DPPA 2WYKA 4IO7A 1QGXA 1XVXA 4L8NA 1TF3A 4NMYA 3Q28A 3JYRA 2VP1A 1TXFA 3VVFA 1B3FA 4B3ME 4PP0A 4OEUA 4LONB 3VXBA 4N4UA 4LF6E 2EPUA 1QUIA 4DKKA 2JOXA 1YYOA 3FBPA 3F6HA 2EOMA 1B5IA 1OVTA 2RSMA 2IA4A 2PCRA 1YZ9A 4NF8B 3QIMA 4YMAA 3C36A 3C4MA 4OQOA 4I8CA 4F1UA 2VGQA 1N0TA 3VYYA 2PFZA 1URSA 4TUIA 4MNIA 4IJDA 2DP8A 2HAUA 2XX9A 3MJNA 3SEYA 3G7WA 2Y84A 4AS4A 3PPRA 2F34A 2QVVA 1O0WA 1NV5A 1DGCA 3E3KA 1WJPA 4YZZA 1UIUA 1LBYA 3PUXE 1MRPA 3B6WA 1JNFA 4R2AA 4WKMA 1WXRA 2CEYA 2WYPA 4X9JA 3AXFA 4HTGA 1R9LA 4H5FA 1FPEA 4IGTA 2I3WA 1I94E 4G77A 4R2EA 1H43A 1PJSA 1ZAAC 3SERA 5EQAA 4ELQA 2I58A 4UA8A 2REJA 4WXDA 2O7IA 5A5XA 2HHHE 1PB7A 4LZ7A 3EHUA 2EQ3A 3IO6A 2F97A 1NKXA 1UQWA 2YJPA 4DR7E 4MNCA 3W15C 1BKAA 1YYKA 3ADLA 4OVSA 1XVYA 2GH9A 4TQUQ 5KCJB 3SEWA 1B2HA 5A69A 1B4HA 2VOZA 3T96B 3UGWA 1FBHA 2EMWA 3MHSC 2QVRA 3ZSFA 1RMDA 3PTYA 4O8MA 5EYGA 3AUZA 4U21A 1LBXA 3U65A 4DI4B 4R9GA 1FTMA 1VE4A 2YTDA 1DOTA 4OEVA 2UU9E 4TLLB 4O3CA 1S50A 4H6DA 1AIVA 5EHMA 4BBYA 4M30A 4P1EA 1FPJA 2LUPB 1XMQE 2UVIA 1I6QA 3K4UA 4GBWA 2P3VA 3K6VA 1MDP1 5IZ3A 2F7CA 3U72A 4BDNA 3PGFA 1FPIA 1NH8A 5IZ1A 2YWQA 2LBSB 4JWXA 2F8BA 4H8IA 1Y20A 1LB8A 2B7VA 2GQ1A 2YSPA 4QFKA 3FVKA 1URDA 2WBUA 1CE2A 3Q29A 2PVUA 1IMCA 2LTRA 5F7VA 1T38A 2AYSA 3B50A 4PE5B 1JETA 1KA1A 4DV0E 3FATA 2OJTA 4GBVA 2V83A 1AL3A 3T66A 3UK3C 4OFLA 3HPSA 4ZEFA 1EZPA 2EOFA 2WBDA 1FQBA 1LSTA 1YYZA 1Z7NE 3MHHC 3MP6A 5KDTB 1FJGE 2EOXA 1FJ6A 3T1YE 2RS6A 2XXIA 2F6PA 2MC6A 4ZYDA 2A5TA 2XXYA 5IWAE 4WYQB 2VRDA 2ZYNA 2AIXA 1WHNA 2E1MA 3KOSA 1X6EA 1FPKA 3HO7A 3ODBA 2P3NA 2GHAA 2VQEE 1N7XA 3C33A 1B5JA 5KL6A 2XXKA 1A1IA 4X65E 5A6AA 1FBPA 1B7ZA 3KG2A 2B3FA 3IB0A 3W9WA 2ANJA 1US4A 3M3FA 1UTBA 1R9QA 4LN5A 2LAOA 2OX3A 4GZNC 3VXCA 3C4BA 2EN4A 2I4BA 5F3WA 4FBPA 3G3IA 2FBPA 2AL4A 3QSLA 3RTFB 4PGPA 3HXLA 3CI8A 1GR2A 5A5LA 3ILTB 2HC5A 4POXA 1Q9DA 4NF0A 4KXPA 5I57B 4Z0IA 4BDMA 4DR1E 4LQ5A 3T9XB 1GQEA 4K3FA 1DK4A 2Y7PA 1TWYA 4GX4A 5L9MA 2RS7A 1A1LA 5CMCA 4TLMB 4KHZE 3O2AA 1DMBA 1B32A 1QU6A 3LV0A 5J1DA 4QFOA 5I5PA 4NZVA 1A55A 3MSTA 4DV6E 3FZVA 1RYXA 1SR9A 1GV8A 1G0IA 2EL6A 1FBFA 5A6JA 4ZEDA 2DXRA 3CR9A 5KL5A 3EPEA 2F6GA 4BMJA 3FASA 4M4GA 2BJIA 5ICQA 2ALUA 3RYDA 2P2AA 2XD3A 2UYEA 2CTDA 4NQ8A 2EP3A 2DWIA 1B4ZA 3UA8A 4DCXA 4NWDA 3DP4A 4QBAA 3CSGA 1NCSA 4H46A 1NNFA 2QPQA 5B70A 1SW5A 1Z7ME 1SFEA 2LJHA 1MM7A 1MXZA 3QUFA 4IS1C 1LEVA 4JI7E 2O6AA 4DUZE 2EN7A 4FK5C 3HV1A 2YRMA 4PFWA 2X26A 2EOOA 3ROJA 1IQSA 4EQ7A 2I0BA 4FORA 4DLDA 3KZYA 2O69A 3M3LA 4N91A 3MPLA 5AA3A 1LCFA 4IO2A 3PPOA 2DWAA 3K6UA 2VPOA 4P3LA 2XXPA 3PD8A 2XWKA 5KL4A 3QXMA 4P0IA 1HSEA 4GXSB 4MJOA 4X66E 1Y9UA 2PBWA 4AS5A 4ELPA 5KDTA 4TUGA 1LBVA 1B0HA 1F2IG 1HNXE 1H76A 3TQWA 2EPNA 3EHSA 2O51A 1FJ9A 3TMGA 4F1VA 2ZM6E 2WBTA 2JJKA 1MY3A 3MVZA 4DV7E 2ELYA 1MY4A 4JWYA 4NGUA 2LVHA 5KL2A 4DR6E 1ZLQA 1FQFA 4QFPA 4JVCA 1VDWA 3N5LA 4MMPA 4DCYA 2VT5A 4ONYA 4R6KA 4QSCA 1LBZA 4O4KA 2B3TB 3IL1B 3PPQA 2EMKA 3IJOB 1SW1A 1IXHA 3OSRA 2B7TA 3SEXA 3T1HE 3VDFA 1LFHA 1IUDA 1YUJA 1SI1A 3IFAA 2LMZA 2MC5A 3I3VA 3ZKKA 4DXUA 5I56B 4YAHX 3U93A 1A7LA 4LP2B 4OTEA 4YB6A 2CMOA 3TKDA 4R74A 3LSLA 4BS9A 4LZ8A 2DXYA 4HE2A 4JI6E 4KFQA 5AA4A 1EYKA 4LF9E 3QAXA 3DP8A 2Q89A 2CT1A 2V84A 4RYAA 3VLUA 4ZDMA 4OWDA 2M4IA 2ODRC 3BIGA 4KD5A 1FCKA 1HSLA 1B51A 1JVXA 1XI6A 1B69A 1I6BA 3KN8A 3GBBA 4NF6B 1Y4TA 5B7DA 1B58A 3MPKA 2F4VE 5CRYA 1GTKA 4Z7EA 1UIVA 1Q35A 3CSBA 4N17A 1EKZA 4YKPA 2V85A 1JQFA 1MPBA 1N34E 3IJXB 1G2FC 4NF6A 4NF5B 1JW5A 1QKBA 4H45A 4OANA 1IMDA 4ZEBA 4R9FA 5K2XA 3EKIA 3ISPA 3T9VA 3FD3A 2Q8UA 4PTKA 5TU0A 3D1RA 4EDPA 1Y1ZA 2ONRA 2DLQA 4YKKA 4O94A 4WFTA 3K6XA 2UUCE 1IEJA 5CC2A 1X6FA 2ZXTA 3V8XB 2PYYA 5A2QC 3VHTB 1B9JA 1DI2A 1OVBA 2DE3A 4F6MA 3N26A 4G2ZA 2Q9TA 2ZNSA 3TTKA 1TFAA 3U94A 3E9XA 1USYH 3IB1A 1IMFA 4X04A 5JK4A 4XKPA 1LLSA 3KBRA 1NV0A 2V86A 1INPA 2DOJA 4RK2A 2HFBA 5DVIA 4O43A 1N36E 2YU5A 3K6WA 2H36X 3QG5C 3LMLA 2NABA 4JB7A 3L6HA 5CI5A 2MKDA 3C4TA 3OELA 4KCDA 1X6HA 1MPDA 1J26A 3JV9A 2EMCA 1G2DC 1D9VA 3P7IA 4Q0CA 4EUOA 3J7Yp 1RDZA 4NF8A 3GZGA 3HHGA 1PJTA 1B0LA 5EQ7A 1EH8A 4ISUA 3J81C 5FHNA 5I59A 5BUUA 2Z8FA 2EOQA 1QUKA 4HCYA 2LV2A 4DDDA 1IBME 3CG3A 4P56A 5HPQA 3KZZA 1MXVA 5EQ9A 4LU9A 1BBGA 4XF5A 2CZHA 1NL5A 2YTOA 3N6UA 1EYIA 4KYSA 1YUIA 2GLIA 4E0XA 4R8OA 4NHBA 1Q1KA 4GQOA 1MGTA 1MY2A 4IO6A 3NOHA 1M5CA 1FBCA 4JVDA 3IFCA 4GX6A 3HHFA 3ADGA 4ZECA 1NH7A 1NV3A 3SETA 5AE1A 2F78A 1MXYA 3MWBA 3RUMA 4C1TA 4F2OA 3EQ1A 2XWIA 3GBAA 2DIXA 2EMLA 4MCOA 5CMMA 2BBGA 4UACA 1P1NA 3VLVA 1XC1A 1UTHB 4MNPA 2Q8MA 5TPAA 1QJMA 3THIA 3R26A 3EPLA 5IM2A 2EOZA 1MPCA 2ENAA 1O64A 3FJMA 2I13A 3BBRA 2DLKA 1MG1A 3VVEA 1IXIA 4OOGC 3VYXA 1DCUA 2L33A 3FVGA 1P1QA 3TCFA 3ZKLA 3P1XA 3O9PA 4XKQA 4R03A 5AC5A 1EH3A 3H09A 4U4XA 4GXAA 2O68A 3GLBA 3ZS6A 2ZYKA 4F6NA 3THNA 4HE1A 4E0WA 2Q74A 3K1NA 4PQJA 3EPHA 5AE2A 4U22A 2NVUB 4KYEA 1IBLE 3FVNA 3PMWA 4H5GA 1O7TA 2LT7A 2DE4A 2PMSA 4YMBA 3MP8A 1FTJA 4PFYA 4WSGA 2LJUA 3KN3A 3EPJA 2DB2A 4NE4A 3ECRA 1KWHA 5I84A 4MEVA 4ZEIA 1RQ0A 4G8HA 2MKZA 5KL3A 3IOVA 3EF7A 3PUZE 3PUVE 1MEYC 1XT8A 3PMXA 1NEIA 2EN2A 3BIDA 4NF5A 2ZNUA 1XOCA 2EN1A 4GF8A 1QW0A 1ZJLA 2L5VA 2XX8A 2QVUA 3KJ7A 1NV1A 5A6BD 4N6KA 2EOJA 5CBSA 3KOTA 3Q27A 4R2BA 2HCAA 3HCQA 3N94A 1KA0A 2HHMA 3TQMA 4NEDA 3WAEA 4BHBA 4G68C 4X8WA 1KJKA 1NUWA 1VFDA 4FATA 1A8EA 2YRKA 4NN3A 1FQCA 4H8JA 4PAIA 1NNTA 3L00A 1NV4A 5JTYA 2EM0A 1BK4A 1LAFE 1MQIA 2A5TB 2UXCE 3RPLB 2DGCA 3SEUA 4BC7A 1X48A 2YTEA 2XXTA 3HSTA 3M99B 3IWCA 5AC4A 3CRBA 4JV5E 2YTGA 3DM0A 4DV5E 3T22A 1WVJA 3BFTA 1X47A 3FIGA 1PBPA 4ZS9A 2XD2A 2YTPA 3U8QA 2EMBA 4NF4B 4OVJA 3MVWA 1IXGA 3OEMA 3HFUA 1MM6A 4LA9A 4ELRA 4IO5A 4G8MA 4NAPA 4R2FA 2FYIA 3SDFA 2H99A 4MFIA 4RK9A 3VLWA 4OFOA 3BF2A 3EPKA 3PV0E 1ZBQA 5H8QB 2Z8DA 1UILA 1OLCA 4DUYE 3K1MA 4KWYA 5IZ3B 5M2VA 3T9UA 1JEUA 5JEIA 1A1KA 4ESXA 2E72A 1NMUA 3GXAA 1T0KA 3TZAA 4Q30B 4MF3A 3OOAA 3O28A 4QSDA 1B3HA 4DV2E 2V3UA 2V93A 3K01A 1YSAC 1ZTYA 5H8NB 3RPLA 1LLMC 3C6KA 1HR0E 2E1SA 3UIFA 2QS1A 4POWA 4ELOA 1LBBA 4YICA 4OVRA 1NNPA 2XXXA 1P47A 2EMXA 3U1OA 1ZU0A 2PRTA 2NUFA 2I4CA 2F8DA 4OESA 2XXUA 2L2MA 4RH8A 4DZ1A 3T0JA 3BFUA 4P8BA 3LC8A 2JVAA 4XXUA 3IO4A 1POTA 2EM4A 1N3XA 5AA2D 3HPIA 2NWJA 4R2RA 2EM9A 2EPMX 1N76A 3KGCA 3S2VA 5IGAA 4LF8E 2CZLA 3KJTA 4P78A 3OMBA 4ZYEA 4DR2E 4N81A 3FGSA 2FTXB 3TAJA 3RTWB 4HXVA 1PJQA 5CMKA 2OWSA 2EL5A 2JYAA 4JI0E 1Y3QA 4O7IA 3A3UA 4XIGQ 4KI0E 5ISUA 2Q88A 4PE3A 2EQ1A 3PU5A 2EMIA 3IWDA 5CFFE 1M5BA 4OYVA 1DTZA 1URGA 1H44A 5H8HA 3B8BA 3OXNA 2EPAA 5A6KA 1EH6A 4M9VC 3H6VA 4N15A 4Q5TA 2LCEA 1B1HA 4PBHA 1LCTA 1MH4A 3OENA 4DV4E 2D5WA 4OFJA 2E5LE 3CIJA 4GLIA 4ZZAA 4P7DA 5T3JA 4THIA 5I57A 4AB6A 3PUWE 2G93A 5I58B 2VD2A 2XXWA 3CFLA 1S7YA 2HAVA 3IX1A 2EMGA 4DIGA 4FIMA 2VF1A 1IMAA 4EXLA 3MW0A 1K9YA 3MSWA 4U2RA 2NUGA 4OERA 1M5FA 4NTLA 4QHQA 4DR5E 5LMNE 1A8FA 3KSXA 2OLBA 2Z8EA 4OVPA 2H98A 2DSFA 2HXWA 1SYIA 1D9QA 4KR5A 1T4NA 1Y4CA 2ZZWA 4MAGA 1FBEA 3FV2A 1RDYA 2VE7C 1B7UA 2RQLA 2JP9A 2YRHA 2JOBA 3V83A 3DP6A 4RHBB 4FE8A 4GIZA 2DDKA 3IOUA 4M1VA 1YFHA 2EMZA 1HSJA 1DSNA 3TCHA 1BLFA 4MBPA 2NUEA 1FQDA 4P11A 3TEPA 4O5GA 2Z22A 1N32E 1SDXA 2M8CA 4GX3A 4DR4E 2GHFA 5LDZA 3G3HA 4FECA 3ADIA 1A99A 3GYYA 3OO9A 2YSOA 3FXRA 4IB2A 5AA2B 2H5YA 3PMVA 1UN6B 5I2KB 4PF6A 4LTYA 2R6GE 4WXJA 4NF4A 3H6WA 2L6MA 2IHR1 2EOYA 2D9HA 2EM6A 1R1NA 3A3CA 3RNNA 5AA2A 1QUJA 3TYHA 4LQ2A 2EPKX 1X5WA 3TQLA 2W7YA 3PPNA 1KYQA 2OBGA 4GEQB 4R2CA 3PD9A 2EWLA 1WODA 4G8NA 2BB8A 1FTKA 4PBQA 4JSOA 1FSAA 4LFAE 1EZOA 1RKMA 3JU0A 2PFYA 2KLFA 1PB8A 2Y7WA 2CZIA 4FEDA 2LO3A 4PCDA 1FPBA 1B3GA 2CZKA 2EOSA 1NNKA 2AL5A 4YB7A 3THOB 4O3BA 4HS7A 4DR3E 4R72A 4QFLA 3JTZA 3CG1A 2XXVA 5KCJA 4N13A 4EF1A 3FJ7A 4U1ZA 1X3CA 2WKYA 5EYFA 4BDRA 1OLAA 1QVSA 4U23A 3G3JA 4I3YA 3O29A 2I6EA 2Y7KA 3HTXA 1D9YA 2QSXA 5FBPA 1POY1 2HZKA 1J5EE 3RMPA 1RYOA 4LUBA 2UUBE 1OMPA 1MQGA 2EPOA 2RC8A 4PFRA 2R1FA 3H06B 1A40A 5L9OA 2N3GA 4BHCA 4FAJA 4WX9A 1SBPA 3DELB 5I58A 4LFBE 2R76A 3I5OA 1P99A 2KQZA 2M9AA 3K1PA 3TTMA 3V5AA 1Y1MA 4RXLA 2DQVA 1ZR9A 5TP9B 5ET8A 5AA4B 3A09A 4XFEA 2UYFA 4Q35B 3L6GA 2D21A 4IY6A 1GVCA 4F19A 2HJJA 2O1MA 4GD5A 5I56A 4GFRA 5H8HB 2JR1A 4X9TA 3RQTA 4F9AB 4FEBA 2YLNA 3J80C 1A1GA 2IEEA 3MQ9A 1AAYA 3B7DA 1MQDA 5FTIA 4IY5A 5F24A 4UABA 1FTAA 1N04A 3MUQA 3SZPA 2DYXA 2UUAE 4YHHE 3T93B 3KSJA 3E13X 2H9BA 4KCCA 2LUQA 4N8YA 4R73A 2NUVA 3C35A 4GWSA 5LLQA 2XXRA 4PAKA 3MVXA 3KFMA 1BB8A 2WBSA 1I6AA 2B3BA 4N4RB 2V4CA 2CEXA 1FBDA 2XXHA 2EPPA 2G29A 4R2QA 3ILUB 4N8GA 4GWZA 5FHOA 2EM3A 3PPPA 1LB9A 3RT6B 3C6MA 1NV7A 2VHAA 4GWUA 1P1OA 1YXIA 3C34A 4N6DA 4WEPA 4R75A 2EMYA 1FQAA 4G68A 1Y3NA 5HBCA 2L2KB 4F2JC 3E79A 5KL7A 3D4GA 2EN6A 3M3KA 2J7JA 1B6HA 3B6QA 2FV4B 4G61A 4XKRA 5ET5A 4QXDA 1IXCA 1TF6A 4HEIA 2Q2AA 1MXWA 4JSDA 2FIXA 1G0HA 2EOIA 5H8NA 3IOTA 1PC3A 5DVFA 3O97A 2HEUA 4X64E 2I9IA 3V89B 4OVTA 5L8DA 3SKPA 2FIEA 4EQ9A 1RC7A 3FXUA 2HQ0A 1TN9A 1LAXA 4I1DA 4OVQA 4YKIA 1QKAA 1LBCA 2F36A 3QK6A 1AOVA 3FV1A 3PUYE 2I0CA 3RPWA 3H7MA 2X7QA 4EQBA 4LF4E 4IGRA 5H8FB 1NUYA 1SYHA 3JZJA 2EMAA 2DS9A 5DTBA 2HPGA 4PDDA 1JK2A 3DLNA 3OEKA 5IXMB 3KZGA 4LFCE 4Q8RA 4GKKE 2UXDE 4NXNE 4LVQA 4F3GA 2NA2A 4P1LA 4LZ5A 3UN6A 2R9JA 2GRVA 2M7QA 3UORA 4MLVA 3KN7A 2PT2A 3KC0A 5I2NB 4B3TE 4R2PA 4QFNA 2EOHA 5HM4B 3KBZA 3S4UA 3FVOA 2BJJX 4R6YA 1FPLA 4BDLA 3KC1A 5ET6A 2DE2A 1LFIA 3H6TA 1FPFA 2RPCA 1A1HA 3ZOQB 3UP9A 1VR5A 4M2ZA 4OA4A 1B46A 1UTBB 4X62E 1TT1A 5DEXA 4NHRA 2V3QA 3B6TA 3K02A 3U92A 1EYJA 1XNRE 5AE4A 5L9SA 4K0KE 1SVXB 2ADRA 1K9ZA 1F9BA 3S9NC 4NX1A 1ZBMA 1JP4A 3G3FA 4ZE9A 1BTJA 4R6HA 3I6VA 3H3GA 4GWXA 2PT1A 3OD7A 5IV8B 2F5XA 2QJEA 3RN8A 2K4VA 3TODA 4JBZA 4G4PA 4O3AA 3FXQA 4X1DA 4N07A 3TUSA 3MZ9A 5F1QA 3MAMA 2JPAA 2ZNTA 3EN3A 1YYWA 4YKJA 3OO7A 3JAMC 5DW8A 2Y7RA 3BIHA 3G3GA 4U1OA 4QSEA 3IOWA 1HNZE 4KHPE 1NUXA 1B3LA 2M1SA 3K2DA 3TFLA 2XWOA 1FPDA 3BGHA 4F9BB 4AB5A 4MHFA 3RLFE 4H1XA 3FXBA 1IBKE 2DSYA 1FKAE 3G3KA 2K7IA 2NOOA 1X49A 3LSFB 3Q25A 4MH5A 4TOZA 4WXCA 1ZU1A 1T39A 1EH7A 1PB9A 1SW2A 1AWBA 4XKNA 3C9HA 2EE8A 1OQGA 2L2NA 1N3GA 4M0VA 4RNSA 2EMHA 4ZEKA 2ZYOA 3TPAA 1PDAA 3F11A 4DXCA 3VK6A 5AE3A 5BR8E 4QRZA 1NUZA 2XA5A 3HPZA 4KZSA 2DMYA 2REGA 1XS5A 1JVYA 1II5A 1R6ZA 4XEQA 3O6HA 1QULA 4GWWA 4IO3A 5EQ8A 3OSQA 1N33E 2V25A 2XWVA 1UHZA 2VQFE 2YTJA 1I69A 3OMLA 3MZBA 5I59B 3QUJA 4RPOA 5TP9A 4GRKA 3IAZA 2CSHA 4NG7A 4PDHA 1D4NA 4I9DA 2H25A 4OENA 1JW1A 1Z1BA 3USDA 3W9VA 1XHYA 1LFGA 3ADJA 2JY9A 5AA1A 2HXRA 1UBDC 1ZKBA 4H67A 2RTXA 5A5XB 1H3DA 2ZMBA 2XXQA 2V8QB 1S9TA 5H8SA 5IZZA 1TFDA 4DV3E 1YCJA 2ZZVA 1MS7A 4X1BA 5ELVA 2DVCA 2QMXA 1T4OA 1CNQA 2YTQA 2Q8JA 2UVGA 2KHXA 1MH3A 1PKPA 5DT6A 5DYHA 4H65A 2B4MA 2RF1A 3OTOE 5ET7A 2MDRA 4LF5E 3OO8A 3O6IA 2Q2CA 2EPXA 4BDQA 5CM6A 3TCGA 3N6TA 3Q26A 2L3CA 2ODRD 4QF9A 1HNWE 4B3SE 4JI8E 2G7HA 5FLXC 2D3IA 3MVYA 5ICTA 3E4RA 4BDOA 4P0GA 1YAEA 1WDNA 2FA7A 3DJWA 2Y7IA 1KZ8A 2P1SA 2YU8A 1SI0A 2XHDA 1FRPA 5A6BA 2WEFA 1IIWA 4DMIA 5ADZA 1SQYA 3TDJA 4GL0A 4B3RE 2Y5LA 4EXKA 1JEVA 3FJGA 2EORA 3T1BA 2RKMA 2MDGA 5EYHA 1OIBA 4YU0A 2F35A 2KR0A 4NWCA 5I3SA 5KZTA 3VE1B 2RC9A 1FPGA 3CFXA 4F39A 2THIA 1EZ9A 2Z23A 4F29A 3CHGA 2RCAA
chains in the Genus database with same CATH topology
2XXVA 5KCJA 1MDQA 4N13A 4OETA 4EF1A 3FJ7A 4U1ZA 1QUKA 1SW4A 1PB7A 4HCYA 2WKYA 3EHUA 4LZ7A 1NFTA 1OLAA 3IO6A 1QVSA 2F97A 3CG3A 3G3JA 4U23A 4BDRA 3O29A 5HPQA 1MXVA 2I6EA 3FIRA 2Y7KA 1D9YA 2QSXA 5K2YA 1NKXA 1POY1 2HZKA 5A5XA 1RYOA 4LUBA 1UQWA 2YJPA 1OMPA 1MQGA 3MZ1A 1NL5A 4C1UA 3N6UA 2RC8A 3W15C 1BKAA 2UXAA 4KYSA 4EF2A 3H06B 1ZMGA 5BUUA 4E0XA 1A40A 5L9OA 4ND9A 1Q1KA 4GQOA 1XVYA 2QS3A 4FAJA 1MY2A 2GH9A 4TQUQ 1SBPA 3DELB 4IO6A 5I58A 1L5TA 3I5OA 5KCJB 3SEWA 3TELA 1M5CA 1P99A 1B2HA 1B4HA 3K1PA 2VOZA 3HHFA 3TTMA 3V5AA 3T96B 1Y1MA 4RXLA 3UGWA 2DQVA 2H4IA 5TP9B 1NH7A 4ZECA 5AA4B 3A09A 3RGYA 3SETA 1GGGA 3ZSFA 2QS2A 2UYFA 3L6GA 2F78A 1MXYA 2D21A 3MWBA 3O66A 4IY6A 4U21A 1GVCA 3RUMA 4F19A 4C1TA 2OZZA 4R9GA 4OHNA 4F2OA 3EQ1A 1FTMA 1VE4A 2O1MA 4GD5A 5I56A 4GFRA 3GBAA 5H8HB 1DOTA 4PFUA 2E0SA 4X9TA 5CMMA 3RQTA 2ONSA 4OEVA 4TLLB 4FEBA 2YLNA 4Z7EA 2OWTA 4UACA 1P1NA 4O3CA 1OQHA 2IEEA 3VLVA 1XC1A 1UTHB 2B65A 3B7DA 3MQ9A 1MQDA 1A54A 1S50A 5FTIA 4IY5A 4H6DA 2YPNA 1AIVA 5EHMA 5TPAA 1QJMA 2I49A 1N04A 3MUQA 3THIA 3T9HB 2UVIA 2DYXA 1I6QA 3K4UA 3R26A 1MPCA 1O64A 3T93B 3KSJA 3K6VA 1MDP1 3FJMA 2F7CA 3BBRA 3LSWA 3U72A 3PGFA 1NH8A 4BDNA 1MG1A 3E13X 2H9BA 3VVEA 4KCCA 1IXIA 3LSXA 4JDFA 4JWXA 1B1XA 1P1QA 1Y20A 3FVGA 1LB8A 3LBSA 4GWOA 4H8IA 3TCFA 4R73A 3MC2A 3ZKLA 3R7XA 3O9PA 2NUVA 4XKQA 4QFKA 3C35A 1IZ1A 1EH3A 3FVKA 2XX7A 2XXRA 1URDA 3MVXA 3VVDA 5I2NA 4U4XA 1CE2A 3Q29A 1P1WA 3KFMA 4GXAA 5IKBA 2PVUA 3WAFA 5F7VA 2O68A 3GLBA 3ZS6A 5JTYB 3VFJA 2ZYKA 5BWJA 4E0WA 1I6AA 1SD3A 2AYSA 2B3BA 4PE5B 1MQJA 3K1NA 1JETA 4PQJA 2NVUB 4U22A 2XXHA 4KYEA 3FATA 2G29A 2OJTA 3ILUB 4FJPA 3FVNA 3PMWA 1AL3A 1O7TA 4H5GA 1B5HA 2PMSA 1ATGA 2DE4A 5FHOA 3T66A 3PPPA 4OFLA 1LB9A 3RT6B 4YMBA 3MP8A 1FTJA 1MXUA 1MY1A 4PFYA 3C31A 2VHAA 1P1OA 3KN3A 3C34A 4WEPA 2PX1A 4ZEFA 1EZPA 4NE4A 1FQBA 1LSTA 3ECRA 1KWHA 1Z7NE 4R75A 1FQAA 3R6UA 2F7AA 4G68A 4ZEIA 3KEIA 1Y3NA 5I84A 4G8HA 3MP6A 5KDTB 1Y3PA 5HBCA 1ZIUA 2RCAA 3EF7A 3IOVA 3PUZE 3D4GA 3PUVE 1P1UA 3M3KA 1XT8A 3PMXA 1B6HA 3B6QA 2XXIA 3LR1A 3SEVA 4ECFA 4NF5A 4XKRA 2F6PA 1IXCA 2ZNUA 1XOCA 2A5TA 3IB2A 2XXYA 5EYFA 5CBRA 1AH5A 2Q2AA 4GF8A 1MXWA 4RJZA 2ZYNA 5EHSA 3RT8A 2O7UA 4JSDA 2AIXA 1QW0A 1ZJLA 2XX8A 4OMBA 3KJ7A 1N7WA 5H8NA 3IOTA 3V83A 3KOSA 1PC3A 5CBSA 3KOTA 5DVFA 3HO7A 3Q27A 4R2BA 3O97A 2HCAA 3ODBA 2HEUA 1FQEA 3HCQA 3N94A 2GHAA 1N7XA 4NEDA 4BLAA 3V89B 3WAEA 1B52A 4XTCQ 4G68C 2V3TA 3C33A 1B5JA 3HN0A 5L8DA 1VFDA 4FATA 2DWHA 3SKPA 4EQ9A 1A8EA 1B7ZA 3KG2A 3FXUA 2I48A 2HQ0A 1FQCA 2X7PA 4H8JA 2B3FA 2QL3A 3IB0A 1MY0A 4X48A 1LAXA 3W9WA 1PBQA 1NNTA 2ANJA 3BKIB 4I1DA 5JTYA 4F31B 4YB5A 4YKIA 1LAFE 1MQIA 2A5TB 1US4A 3M3FA 1QKAA 1UTBA 1LBCA 1R9QA 2LAOA 2F36A 4OXVA 1BP5A 4U4SA 3UK4A 2F7BA 3VXCA 4HCWA 3QK6A 3SEUA 2I4BA 4F2QA 1AOVA 3FV1A 3PUYE 1J1NA 2I0CA 3G3IA 3RPWA 3H7MA 4ESWA 2X7QA 4EQBA 4HW8A 3VV5A 2XXTA 5FHMA 3HSTA 2UVHA 2AL4A 3QSLA 4IGRA 5H8FB 4G68B 3RTFB 1SYHA 3CRBA 3CI8A 1GR2A 3ILTB 1IITA 4POXA 3JZJA 1FTOA 2DS9A 3FUZA 3M8UA 5DTBA 5I57B 4Z0IA 4BDMA 1LAGE 3DM0A 4LQ5A 3DLNA 3OEKA 4Q8RA 3KZGA 4ZE8A 5TPAB 3T22A 3CVGA 3T9XB 1WVJA 3BFTA 4LVQA 2GFEA 2QRYA 4F3GA 4K3FA 3UN6A 4LZ5A 1PBPA 1UTHA 4ZS9A 2XD2A 2RCBA 2R9JA 2GRVA 3U8QA 2Y7PA 1TWYA 3UORA 4NF4B 4OVJA 4MLVA 1IXGA 3MVWA 4MLQA 5L9MA 4KYDA 3OEMA 5CMCA 3KN7A 4TLMB 5H8QA 1B40A 2PT2A 4JXIA 1MM6A 4F22A 4LA9A 4ELRA 4IO5A 4G8MA 4KHZE 5CMBA 5I2NB 3O2AA 1US5A 1DMBA 1B32A 4R2FA 2FYIA 5ITOA 3SDFA 2H99A 4MFIA 2QS4A 4QFNA 3EHTA 4RK9A 3VLWA 4OFOA 3H4ZA 5J1DA 3PV0E 4QFOA 1DPEA 1A55A 5H8QB 2Z8DA 3TTRA 3FZVA 1RYXA 1OLCA 3K1MA 5M2VA 1GV8A 5HM4B 3T9UA 4DE8A 1JEUA 5JEIA 3S4UA 2O84X 3FVOA 2BJJX 4R6YA 2ABHA 4KPTA 4DXBA 4BDLA 4C0RA 4ESXA 1NMUA 3GXAA 1T0KA 4ZEDA 2DE2A 3TZAA 1N84A 2DXRA 3CR9A 4Q30B 4F3PA 5FTHA 1LFIA 4F3SA 4MF3A 2ZYMA 3OOAA 2HZLA 3H6TA 3O28A 4QSDA 3EPEA 2F6GA 1B3HA 3FASA 3TTLA 4M4GA 2V3UA 3UP9A 4JWOA 2V93A 1VR5A 5ICQA 3K01A 3IK6B 2ALUA 1FTLA 1ZTYA 2P2AA 5H8NB 2XD3A 1B46A 1UTBB 1TT1A 2UYEA 3LUYA 3MP1A 5DEXA 2DWIA 1B4ZA 2E1SA 3UIFA 4L17A 2QS1A 3UA8A 4DCXA 4POWA 4ELOA 5ITPA 4NWDA 3DP4A 1PEBA 1LBBA 3CSGA 4YICA 4AQ4A 1NNFA 2A5SA 2QPQA 2V3QA 5B70A 1NNPA 4GVOA 1SW5A 1Z7ME 2OK2A 2XXXA 3B6TA 3QUFA 1MM7A 1MXZA 3K02A 3U92A 3S9LC 3U1OA 1ZU0A 1JW4A 3H03A 2I4CA 2F8DA 2R71A 2O6AA 4OESA 4KQPA 5AE4A 5L9SA 1SVXB 3OO6A 2XXUA 3HV1A 4PFWA 4N6PA 2X26A 4DZ1A 3BFUA 1F9BA 3LC8A 4PFTA 4EQ7A 3S9NC 1ZBMA 3G3FA 4ZE9A 2I0BA 4XXUA 3IO4A 1BTJA 1POTA 4FORA 4R6HA 4DLDA 3I6VA 3H3GA 1N3XA 2O69A 3M3LA 2PT1A 3OD7A 5AA2D 3MPLA 5AA3A 1LCFA 1MXXA 2F5XA 4IO2A 2QJEA 3RN8A 3HPIA 2NWJA 5I57A 3PPOA 1LAHE 3TODA 2DWAA 3K6UA 4JBZA 4G4PA 4O3AA 2VD3A 3FXQA 4X1DA 1N76A 2XXPA 4N07A 3PD8A 3TUSA 3MZ9A 3KGCA 3SESA 5F1QA 3S9EA 1FW0A 3K0VA 5DEXB 3QXMA 3S2VA 3MAMA 4P0IA 1HSEA 4GXSB 2ZNTA 3ONMA 1USYE 4WEDA 4I62A 3EN3A 4H0WA 1Y9UA 3IR1A 2CZLA 3KJTA 2QMWA 3OMBA 4YKJA 3OO7A 2PBWA 4ELPA 3FGSA 5KDTA 1B7HA 1DTGA 2Y7RA 1B0HA 4GOTA 1H76A 3RY3A 3G3GA 3TQWA 3EHSA 4U1OA 2O51A 4QSEA 3IOWA 3RTWB 3TAJA 2RINA 3TMGA 4F1VA 3S9MC 1M5DA 3TTNA 1MY3A 5CMKA 4PETA 3MVZA 2OWSA 4F3BA 1VFEA 4RA1A 1B3LA 1MY4A 2P0SA 3K2DA 1ANFA 4JWYA 3TFLA 1Y3QA 3A3UA 1EU8A 3K00A 4XIGQ 4AB5A 4KI0E 1ZLQA 5ISUA 3RLFE 2DVZA 1FQFA 2Q88A 4H1XA 4QFPA 2I3VA 2FNCA 3PU5A 1M5BA 4OYVA 1DTZA 1URGA 1H44A 3G3KA 3N5LA 4LATA 3O6GA 5H8HA 3H6UA 4DCYA 2NOOA 3OXNA 3LSFB 3Q25A 4ONYA 4MH5A 4TOZA 4R6KA 3H6VA 4QSCA 2ESNA 4RPNA 4RY1A 4Q5TA 1PB9A 1SW2A 1B1HA 2NXOA 3IL1B 3PPQA 4XKNA 3IJOB 1SW1A 1LCTA 3C9HA 1H45A 1MQHA 2Z8FA 4GL8A 1OQGA 1MH4A 1IXHA 2D5WA 3OENA 3OSRA 3SEXA 4OFJA 3CIJA 4GLIA 4ZZAA 2ONKE 4RNSA 3VDFA 1LFHA 1IUDA 4THIA 4ZEKA 2ZYOA 3TPAA 4AB6A 3PUWE 1PDAA 1SI1A 2G93A 5H8FA 5I58B 2VD2A 2UVJA 2XXWA 3CFLA 3ZKKA 3I3VA 2O1LA 1S7YA 4DXUA 5I2KA 2HAVA 3F11A 3IX1A 4DXCA 5I56B 4YAHX 3U93A 1A7LA 4LP2B 4QRZA 4DIGA 1D3KA 4FIMA 4OTEA 4YB6A 2CMOA 3TKDA 1M5EA 1XS5A 1BIYA 2REGA 1JVYA 3LSLA 1LGBC 3MW0A 4LZ8A 4R74A 1II5A 1R6ZA 4EXLA 4F18A 2DXYA 3O6HA 1QULA 5IAIA 4U2RA 2RC7A 3CFZA 4OERA 4KFQA 1M5FA 4NTLA 4IO3A 4QHQA 4DDDA 3QAXA 5AA4A 3DP8A 1A8FA 2Q89A 3OSQA 2GHBA 3KSXA 5LOMA 2V25A 2OLBA 2Z8EA 4IO4A 2V84A 2H98A 1I69A 1B3EA 2DSFA 4RYAA 4F1YA 2HXWA 3VLUA 4ZDMA 3IORA 1SYIA 1O63A 3MZBA 1B05A 4KD5A 3QUJA 4KR5A 4OWDA 1FCKA 1HSLA 4RPOA 5TP9A 5I59B 1AMFA 2DWJA 1Y4CA 1B51A 1JVXA 3D4CA 3IAZA 4GRKA 3KN8A 1I6BA 1D4NA 4ZZEA 1ELJA 3FV2A 3GBBA 4I9DA 3QYTA 2H25A 3C32A 1Y4TA 4NF6B 5B7DA 4OENA 1JW1A 5DVJA 1B7UA 1B58A 3MPKA 1CB6A 5CRYA 1GTKA 3USDA 1UIVA 3W9VA 1Q35A 1IQ7A 1N3WA 1XHYA 3CSBA 1YTVA 3DP6A 4FE8A 4GIZA 1JQFA 4YKPA 3MBPA 1LFGA 4OZ9A 3IOUA 1MPBA 4M1VA 1YPNA 5AA1A 1HSJA 1DSNA 1VSOA 2OCUA 1DPPA 3IJXB 3TCHA 1BLFA 1ZKBA 4NF6A 4IO7A 4NF5B 4H67A 4MBPA 5A5XB 1H3DA 1JW5A 1XVXA 2ZMBA 1QKBA 4NMYA 3Q28A 2XXQA 1FQDA 1S9TA 3JYRA 4P11A 5H8SA 2VP1A 1TXFA 3VVFA 3TEPA 1B3FA 2Z22A 1TFDA 4ZEBA 4R9FA 1SDXA 5K2XA 2M8CA 4OEUA 4LONB 1YCJA 4PP0A 4X1BA 1MS7A 5ELVA 3VXBA 3T9VA 2DVCA 3G3HA 3FD3A 2QMXA 4FECA 1QUIA 5TU0A 1A99A 2Q8JA 2UVGA 1B5IA 1OVTA 4EDPA 1MH3A 1Y1ZA 2ONRA 3OO9A 3FXRA 4YKKA 2IA4A 4IB2A 5DT6A 5AA2B 5DYHA 3K6XA 4NF8B 4H65A 3QIMA 1IEJA 5CC2A 4YMAA 2RF1A 2ZXTA 3V8XB 2H5YA 3C36A 3C4MA 2PYYA 4OQOA 3PMVA 4I8CA 4F1UA 1B9JA 1OVBA 2VGQA 1N0TA 3OO8A 1URSA 5I2KB 2DP8A 2DE3A 2Q2CA 2R6GE 3O6IA 4NF4A 3H6WA 3N26A 2HAUA 2XX9A 4G2ZA 4WXJA 2Q9TA 2ZNSA 3TCGA 4BDQA 3MJNA 5CM6A 3SEYA 1R1NA 3A3CA 3TTKA 3G7WA 3RNNA 3N6TA 5AA2A 2Y84A 3Q26A 3PPRA 1TFAA 1QUJA 2F34A 4QF9A 3E9XA 3TYHA 3U94A 1USYH 3IB1A 4LQ2A 5JK4A 4XKPA 2D3IA 5ICTA 3MVYA 3E4RA 3TQLA 4BDOA 1LLSA 2W7YA 3E3KA 3KBRA 3PPNA 1YAEA 1WDNA 2FA7A 4P0GA 4YZZA 2DOJA 2Y7IA 1UIUA 4RK2A 2OBGA 2P1SA 1SI0A 2HFBA 3PUXE 2XHDA 1MRPA 3B6WA 1JNFA 3PD9A 5DVIA 1WODA 4G8NA 4WKMA 1IIWA 3K6WA 1FTKA 4JSOA 1SQYA 4JB7A 3L6HA 1EZOA 1RKMA 3AXFA 5CI5A 3TDJA 4GL0A 4HTGA 4EXKA 1JEVA 3FJGA 3OELA 1R9LA 4KCDA 2KLFA 2RKMA 1MPDA 4H5FA 1OIBA 3JV9A 4YU0A 1D9VA 4IGTA 3P7IA 2I3WA 2F35A 4NWCA 4Q0CA 4EUOA 1PB8A 4G77A 4NF8A 2Y7WA 3GZGA 1H43A 5KZTA 3VE1B 2RC9A 3HHGA 4FEDA 1B0LA 3SERA 4ELQA 3CFXA 2I58A 4F39A 1B3GA 2THIA 2REJA 1NNKA 4UA8A 2AL5A 4ISUA 1EZ9A 4O3BA 2Z23A 4HS7A 4YB7A 5FHNA 4R72A 5I59A 4QFLA 4F29A 2O7IA 3CG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXV A;  5KCJ A;  1MDQ A;  4N13 A;  4OET A;  4EF1 A;  3FJ7 A;  4U1Z A;  1QUK A;  1SW4 A;  1PB7 A;  4HCY A;  2WKY A;  3EHU A;  4LZ7 A;  1NFT A;  1OLA A;  3IO6 A;  1QVS A;  2F97 A;  3CG3 A;  3G3J A;  4U23 A;  4BDR A;  3O29 A;  5HPQ A;  1MXV A;  2I6E A;  3FIR A;  2Y7K A;  1D9Y A;  2QSX A;  5K2Y A;  1NKX A;  1POY 1;  2HZK A;  5A5X A;  1RYO A;  4LUB A;  1UQW A;  2YJP A;  1OMP A;  1MQG A;  3MZ1 A;  1NL5 A;  4C1U A;  3N6U A;  2RC8 A;  3W15 C;  1BKA A;  2UXA A;  4KYS A;  4EF2 A;  3H06 B;  1ZMG A;  5BUU A;  4E0X A;  1A40 A;  5L9O A;  4ND9 A;  1Q1K A;  4GQO A;  1XVY A;  2QS3 A;  4FAJ A;  1MY2 A;  2GH9 A;  4TQU Q;  1SBP A;  3DEL B;  4IO6 A;  5I58 A;  1L5T A;  3I5O A;  5KCJ B;  3SEW A;  3TEL A;  1M5C A;  1P99 A;  1B2H A;  1B4H A;  3K1P A;  2VOZ A;  3HHF A;  3TTM A;  3V5A A;  3T96 B;  1Y1M A;  4RXL A;  3UGW A;  2DQV A;  2H4I A;  5TP9 B;  1NH7 A;  4ZEC A;  5AA4 B;  3A09 A;  3RGY A;  3SET A;  1GGG A;  3ZSF A;  2QS2 A;  2UYF A;  3L6G A;  2F78 A;  1MXY A;  2D21 A;  3MWB A;  3O66 A;  4IY6 A;  4U21 A;  1GVC A;  3RUM A;  4F19 A;  4C1T A;  2OZZ A;  4R9G A;  4OHN A;  4F2O A;  3EQ1 A;  1FTM A;  1VE4 A;  2O1M A;  4GD5 A;  5I56 A;  4GFR A;  3GBA A;  5H8H B;  1DOT A;  4PFU A;  2E0S A;  4X9T A;  5CMM A;  3RQT A;  2ONS A;  4OEV A;  4TLL B;  4FEB A;  2YLN A;  4Z7E A;  2OWT A;  4UAC A;  1P1N A;  4O3C A;  1OQH A;  2IEE A;  3VLV A;  1XC1 A;  1UTH B;  2B65 A;  3B7D A;  3MQ9 A;  1MQD A;  1A54 A;  1S50 A;  5FTI A;  4IY5 A;  4H6D A;  2YPN A;  1AIV A;  5EHM A;  5TPA A;  1QJM A;  2I49 A;  1N04 A;  3MUQ A;  3THI A;  3T9H B;  2UVI A;  2DYX A;  1I6Q A;  3K4U A;  3R26 A;  1MPC A;  1O64 A;  3T93 B;  3KSJ A;  3K6V A;  1MDP 1;  3FJM A;  2F7C A;  3BBR A;  3LSW A;  3U72 A;  3PGF A;  1NH8 A;  4BDN A;  1MG1 A;  3E13 X;  2H9B A;  3VVE A;  4KCC A;  1IXI A;  3LSX A;  4JDF A;  4JWX A;  1B1X A;  1P1Q A;  1Y20 A;  3FVG A;  1LB8 A;  3LBS A;  4GWO A;  4H8I A;  3TCF A;  4R73 A;  3MC2 A;  3ZKL A;  3R7X A;  3O9P A;  2NUV A;  4XKQ A;  4QFK A;  3C35 A;  1IZ1 A;  1EH3 A;  3FVK A;  2XX7 A;  2XXR A;  1URD A;  3MVX A;  3VVD A;  5I2N A;  4U4X A;  1CE2 A;  3Q29 A;  1P1W A;  3KFM A;  4GXA A;  5IKB A;  2PVU A;  3WAF A;  5F7V A;  2O68 A;  3GLB A;  3ZS6 A;  5JTY B;  3VFJ A;  2ZYK A;  5BWJ A;  4E0W A;  1I6A A;  1SD3 A;  2AYS A;  2B3B A;  4PE5 B;  1MQJ A;  3K1N A;  1JET A;  4PQJ A;  2NVU B;  4U22 A;  2XXH A;  4KYE A;  3FAT A;  2G29 A;  2OJT A;  3ILU B;  4FJP A;  3FVN A;  3PMW A;  1AL3 A;  1O7T A;  4H5G A;  1B5H A;  2PMS A;  1ATG A;  2DE4 A;  5FHO A;  3T66 A;  3PPP A;  4OFL A;  1LB9 A;  3RT6 B;  4YMB A;  3MP8 A;  1FTJ A;  1MXU A;  1MY1 A;  4PFY A;  3C31 A;  2VHA A;  1P1O A;  3KN3 A;  3C34 A;  4WEP A;  2PX1 A;  4ZEF A;  1EZP A;  4NE4 A;  1FQB A;  1LST A;  3ECR A;  1KWH A;  1Z7N E;  4R75 A;  1FQA A;  3R6U A;  2F7A A;  4G68 A;  4ZEI A;  3KEI A;  1Y3N A;  5I84 A;  4G8H A;  3MP6 A;  5KDT B;  1Y3P A;  5HBC A;  1ZIU A;  2RCA A;  3EF7 A;  3IOV A;  3PUZ E;  3D4G A;  3PUV E;  1P1U A;  3M3K A;  1XT8 A;  3PMX A;  1B6H A;  3B6Q A;  2XXI A;  3LR1 A;  3SEV A;  4ECF A;  4NF5 A;  4XKR A;  2F6P A;  1IXC A;  2ZNU A;  1XOC A;  2A5T A;  3IB2 A;  2XXY A;  5EYF A;  5CBR A;  1AH5 A;  2Q2A A;  4GF8 A;  1MXW A;  4RJZ A;  2ZYN A;  5EHS A;  3RT8 A;  2O7U A;  4JSD A;  2AIX A;  1QW0 A;  1ZJL A;  2XX8 A;  4OMB A;  3KJ7 A;  1N7W A;  5H8N A;  3IOT A;  3V83 A;  3KOS A;  1PC3 A;  5CBS A;  3KOT A;  5DVF A;  3HO7 A;  3Q27 A;  4R2B A;  3O97 A;  2HCA A;  3ODB A;  2HEU A;  1FQE A;  3HCQ A;  3N94 A;  2GHA A;  1N7X A;  4NED A;  4BLA A;  3V89 B;  3WAE A;  1B52 A;  4XTC Q;  4G68 C;  2V3T A;  3C33 A;  1B5J A;  3HN0 A;  5L8D A;  1VFD A;  4FAT A;  2DWH A;  3SKP A;  4EQ9 A;  1A8E A;  1B7Z A;  3KG2 A;  3FXU A;  2I48 A;  2HQ0 A;  1FQC A;  2X7P A;  4H8J A;  2B3F A;  2QL3 A;  3IB0 A;  1MY0 A;  4X48 A;  1LAX A;  3W9W A;  1PBQ A;  1NNT A;  2ANJ A;  3BKI B;  4I1D A;  5JTY A;  4F31 B;  4YB5 A;  4YKI A;  1LAF E;  1MQI A;  2A5T B;  1US4 A;  3M3F A;  1QKA A;  1UTB A;  1LBC A;  1R9Q A;  2LAO A;  2F36 A;  4OXV A;  1BP5 A;  4U4S A;  3UK4 A;  2F7B A;  3VXC A;  4HCW A;  3QK6 A;  3SEU A;  2I4B A;  4F2Q A;  1AOV A;  3FV1 A;  3PUY E;  1J1N A;  2I0C A;  3G3I A;  3RPW A;  3H7M A;  4ESW A;  2X7Q A;  4EQB A;  4HW8 A;  3VV5 A;  2XXT A;  5FHM A;  3HST A;  2UVH A;  2AL4 A;  3QSL A;  4IGR A;  5H8F B;  4G68 B;  3RTF B;  1SYH A;  3CRB A;  3CI8 A;  1GR2 A;  3ILT B;  1IIT A;  4POX A;  3JZJ A;  1FTO A;  2DS9 A;  3FUZ A;  3M8U A;  5DTB A;  5I57 B;  4Z0I A;  4BDM A;  1LAG E;  3DM0 A;  4LQ5 A;  3DLN A;  3OEK A;  4Q8R A;  3KZG A;  4ZE8 A;  5TPA B;  3T22 A;  3CVG A;  3T9X B;  1WVJ A;  3BFT A;  4LVQ A;  2GFE A;  2QRY A;  4F3G A;  4K3F A;  3UN6 A;  4LZ5 A;  1PBP A;  1UTH A;  4ZS9 A;  2XD2 A;  2RCB A;  2R9J A;  2GRV A;  3U8Q A;  2Y7P A;  1TWY A;  3UOR A;  4NF4 B;  4OVJ A;  4MLV A;  1IXG A;  3MVW A;  4MLQ A;  5L9M A;  4KYD A;  3OEM A;  5CMC A;  3KN7 A;  4TLM B;  5H8Q A;  1B40 A;  2PT2 A;  4JXI A;  1MM6 A;  4F22 A;  4LA9 A;  4ELR A;  4IO5 A;  4G8M A;  4KHZ E;  5CMB A;  5I2N B;  3O2A A;  1US5 A;  1DMB A;  1B32 A;  4R2F A;  2FYI A;  5ITO A;  3SDF A;  2H99 A;  4MFI A;  2QS4 A;  4QFN A;  3EHT A;  4RK9 A;  3VLW A;  4OFO A;  3H4Z A;  5J1D A;  3PV0 E;  4QFO A;  1DPE A;  1A55 A;  5H8Q B;  2Z8D A;  3TTR A;  3FZV A;  1RYX A;  1OLC A;  3K1M A;  5M2V A;  1GV8 A;  5HM4 B;  3T9U A;  4DE8 A;  1JEU A;  5JEI A;  3S4U A;  2O84 X;  3FVO A;  2BJJ X;  4R6Y A;  2ABH A;  4KPT A;  4DXB A;  4BDL A;  4C0R A;  4ESX A;  1NMU A;  3GXA A;  1T0K A;  4ZED A;  2DE2 A;  3TZA A;  1N84 A;  2DXR A;  3CR9 A;  4Q30 B;  4F3P A;  5FTH A;  1LFI A;  4F3S A;  4MF3 A;  2ZYM A;  3OOA A;  2HZL A;  3H6T A;  3O28 A;  4QSD A;  3EPE A;  2F6G A;  1B3H A;  3FAS A;  3TTL A;  4M4G A;  2V3U A;  3UP9 A;  4JWO A;  2V93 A;  1VR5 A;  5ICQ A;  3K01 A;  3IK6 B;  2ALU A;  1FTL A;  1ZTY A;  2P2A A;  5H8N B;  2XD3 A;  1B46 A;  1UTB B;  1TT1 A;  2UYE A;  3LUY A;  3MP1 A;  5DEX A;  2DWI A;  1B4Z A;  2E1S A;  3UIF A;  4L17 A;  2QS1 A;  3UA8 A;  4DCX A;  4POW A;  4ELO A;  5ITP A;  4NWD A;  3DP4 A;  1PEB A;  1LBB A;  3CSG A;  4YIC A;  4AQ4 A;  1NNF A;  2A5S A;  2QPQ A;  2V3Q A;  5B70 A;  1NNP A;  4GVO A;  1SW5 A;  1Z7M E;  2OK2 A;  2XXX A;  3B6T A;  3QUF A;  1MM7 A;  1MXZ A;  3K02 A;  3U92 A;  3S9L C;  3U1O A;  1ZU0 A;  1JW4 A;  3H03 A;  2I4C A;  2F8D A;  2R71 A;  2O6A A;  4OES A;  4KQP A;  5AE4 A;  5L9S A;  1SVX B;  3OO6 A;  2XXU A;  3HV1 A;  4PFW A;  4N6P A;  2X26 A;  4DZ1 A;  3BFU A;  1F9B A;  3LC8 A;  4PFT A;  4EQ7 A;  3S9N C;  1ZBM A;  3G3F A;  4ZE9 A;  2I0B A;  4XXU A;  3IO4 A;  1BTJ A;  1POT A;  4FOR A;  4R6H A;  4DLD A;  3I6V A;  3H3G A;  1N3X A;  2O69 A;  3M3L A;  2PT1 A;  3OD7 A;  5AA2 D;  3MPL A;  5AA3 A;  1LCF A;  1MXX A;  2F5X A;  4IO2 A;  2QJE A;  3RN8 A;  3HPI A;  2NWJ A;  5I57 A;  3PPO A;  1LAH E;  3TOD A;  2DWA A;  3K6U A;  4JBZ A;  4G4P A;  4O3A A;  2VD3 A;  3FXQ A;  4X1D A;  1N76 A;  2XXP A;  4N07 A;  3PD8 A;  3TUS A;  3MZ9 A;  3KGC A;  3SES A;  5F1Q A;  3S9E A;  1FW0 A;  3K0V A;  5DEX B;  3QXM A;  3S2V A;  3MAM A;  4P0I A;  1HSE A;  4GXS B;  2ZNT A;  3ONM A;  1USY E;  4WED A;  4I62 A;  3EN3 A;  4H0W A;  1Y9U A;  3IR1 A;  2CZL A;  3KJT A;  2QMW A;  3OMB A;  4YKJ A;  3OO7 A;  2PBW A;  4ELP A;  3FGS A;  5KDT A;  1B7H A;  1DTG A;  2Y7R A;  1B0H A;  4GOT A;  1H76 A;  3RY3 A;  3G3G A;  3TQW A;  3EHS A;  4U1O A;  2O51 A;  4QSE A;  3IOW A;  3RTW B;  3TAJ A;  2RIN A;  3TMG A;  4F1V A;  3S9M C;  1M5D A;  3TTN A;  1MY3 A;  5CMK A;  4PET A;  3MVZ A;  2OWS A;  4F3B A;  1VFE A;  4RA1 A;  1B3L A;  1MY4 A;  2P0S A;  3K2D A;  1ANF A;  4JWY A;  3TFL A;  1Y3Q A;  3A3U A;  1EU8 A;  3K00 A;  4XIG Q;  4AB5 A;  4KI0 E;  1ZLQ A;  5ISU A;  3RLF E;  2DVZ A;  1FQF A;  2Q88 A;  4H1X A;  4QFP A;  2I3V A;  2FNC A;  3PU5 A;  1M5B A;  4OYV A;  1DTZ A;  1URG A;  1H44 A;  3G3K A;  3N5L A;  4LAT A;  3O6G A;  5H8H A;  3H6U A;  4DCY A;  2NOO A;  3OXN A;  3LSF B;  3Q25 A;  4ONY A;  4MH5 A;  4TOZ A;  4R6K A;  3H6V A;  4QSC A;  2ESN A;  4RPN A;  4RY1 A;  4Q5T A;  1PB9 A;  1SW2 A;  1B1H A;  2NXO A;  3IL1 B;  3PPQ A;  4XKN A;  3IJO B;  1SW1 A;  1LCT A;  3C9H A;  1H45 A;  1MQH A;  2Z8F A;  4GL8 A;  1OQG A;  1MH4 A;  1IXH A;  2D5W A;  3OEN A;  3OSR A;  3SEX A;  4OFJ A;  3CIJ A;  4GLI A;  4ZZA A;  2ONK E;  4RNS A;  3VDF A;  1LFH A;  1IUD A;  4THI A;  4ZEK A;  2ZYO A;  3TPA A;  4AB6 A;  3PUW E;  1PDA A;  1SI1 A;  2G93 A;  5H8F A;  5I58 B;  2VD2 A;  2UVJ A;  2XXW A;  3CFL A;  3ZKK A;  3I3V A;  2O1L A;  1S7Y A;  4DXU A;  5I2K A;  2HAV A;  3F11 A;  3IX1 A;  4DXC A;  5I56 B;  4YAH X;  3U93 A;  1A7L A;  4LP2 B;  4QRZ A;  4DIG A;  1D3K A;  4FIM A;  4OTE A;  4YB6 A;  2CMO A;  3TKD A;  1M5E A;  1XS5 A;  1BIY A;  2REG A;  1JVY A;  3LSL A;  1LGB C;  3MW0 A;  4LZ8 A;  4R74 A;  1II5 A;  1R6Z A;  4EXL A;  4F18 A;  2DXY A;  3O6H A;  1QUL A;  5IAI A;  4U2R A;  2RC7 A;  3CFZ A;  4OER A;  4KFQ A;  1M5F A;  4NTL A;  4IO3 A;  4QHQ A;  4DDD A;  3QAX A;  5AA4 A;  3DP8 A;  1A8F A;  2Q89 A;  3OSQ A;  2GHB A;  3KSX A;  5LOM A;  2V25 A;  2OLB A;  2Z8E A;  4IO4 A;  2V84 A;  2H98 A;  1I69 A;  1B3E A;  2DSF A;  4RYA A;  4F1Y A;  2HXW A;  3VLU A;  4ZDM A;  3IOR A;  1SYI A;  1O63 A;  3MZB A;  1B05 A;  4KD5 A;  3QUJ A;  4KR5 A;  4OWD A;  1FCK A;  1HSL A;  4RPO A;  5TP9 A;  5I59 B;  1AMF A;  2DWJ A;  1Y4C A;  1B51 A;  1JVX A;  3D4C A;  3IAZ A;  4GRK A;  3KN8 A;  1I6B A;  1D4N A;  4ZZE A;  1ELJ A;  3FV2 A;  3GBB A;  4I9D A;  3QYT A;  2H25 A;  3C32 A;  1Y4T A;  4NF6 B;  5B7D A;  4OEN A;  1JW1 A;  5DVJ A;  1B7U A;  1B58 A;  3MPK A;  1CB6 A;  5CRY A;  1GTK A;  3USD A;  1UIV A;  3W9V A;  1Q35 A;  1IQ7 A;  1N3W A;  1XHY A;  3CSB A;  1YTV A;  3DP6 A;  4FE8 A;  4GIZ A;  1JQF A;  4YKP A;  3MBP A;  1LFG A;  4OZ9 A;  3IOU A;  1MPB A;  4M1V A;  1YPN A;  5AA1 A;  1HSJ A;  1DSN A;  1VSO A;  2OCU A;  1DPP A;  3IJX B;  3TCH A;  1BLF A;  1ZKB A;  4NF6 A;  4IO7 A;  4NF5 B;  4H67 A;  4MBP A;  5A5X B;  1H3D A;  1JW5 A;  1XVX A;  2ZMB A;  1QKB A;  4NMY A;  3Q28 A;  2XXQ A;  1FQD A;  1S9T A;  3JYR A;  4P11 A;  5H8S A;  2VP1 A;  1TXF A;  3VVF A;  3TEP A;  1B3F A;  2Z22 A;  1TFD A;  4ZEB A;  4R9F A;  1SDX A;  5K2X A;  2M8C A;  4OEU A;  4LON B;  1YCJ A;  4PP0 A;  4X1B A;  1MS7 A;  5ELV A;  3VXB A;  3T9V A;  2DVC A;  3G3H A;  3FD3 A;  2QMX A;  4FEC A;  1QUI A;  5TU0 A;  1A99 A;  2Q8J A;  2UVG A;  1B5I A;  1OVT A;  4EDP A;  1MH3 A;  1Y1Z A;  2ONR A;  3OO9 A;  3FXR A;  4YKK A;  2IA4 A;  4IB2 A;  5DT6 A;  5AA2 B;  5DYH A;  3K6X A;  4NF8 B;  4H65 A;  3QIM A;  1IEJ A;  5CC2 A;  4YMA A;  2RF1 A;  2ZXT A;  3V8X B;  2H5Y A;  3C36 A;  3C4M A;  2PYY A;  4OQO A;  3PMV A;  4I8C A;  4F1U A;  1B9J A;  1OVB A;  2VGQ A;  1N0T A;  3OO8 A;  1URS A;  5I2K B;  2DP8 A;  2DE3 A;  2Q2C A;  2R6G E;  3O6I A;  4NF4 A;  3H6W A;  3N26 A;  2HAU A;  2XX9 A;  4G2Z A;  4WXJ A;  2Q9T A;  2ZNS A;  3TCG A;  4BDQ A;  3MJN A;  5CM6 A;  3SEY A;  1R1N A;  3A3C A;  3TTK A;  3G7W A;  3RNN A;  3N6T A;  5AA2 A;  2Y84 A;  3Q26 A;  3PPR A;  1TFA A;  1QUJ A;  2F34 A;  4QF9 A;  3E9X A;  3TYH A;  3U94 A;  1USY H;  3IB1 A;  4LQ2 A;  5JK4 A;  4XKP A;  2D3I A;  5ICT A;  3MVY A;  3E4R A;  3TQL A;  4BDO A;  1LLS A;  2W7Y A;  3E3K A;  3KBR A;  3PPN A;  1YAE A;  1WDN A;  2FA7 A;  4P0G A;  4YZZ A;  2DOJ A;  2Y7I A;  1UIU A;  4RK2 A;  2OBG A;  2P1S A;  1SI0 A;  2HFB A;  3PUX E;  2XHD A;  1MRP A;  3B6W A;  1JNF A;  3PD9 A;  5DVI A;  1WOD A;  4G8N A;  4WKM A;  1IIW A;  3K6W A;  1FTK A;  4JSO A;  1SQY A;  4JB7 A;  3L6H A;  1EZO A;  1RKM A;  3AXF A;  5CI5 A;  3TDJ A;  4GL0 A;  4HTG A;  4EXK A;  1JEV A;  3FJG A;  3OEL A;  1R9L A;  4KCD A;  2KLF A;  2RKM A;  1MPD A;  4H5F A;  1OIB A;  3JV9 A;  4YU0 A;  1D9V A;  4IGT A;  3P7I A;  2I3W A;  2F35 A;  4NWC A;  4Q0C A;  4EUO A;  1PB8 A;  4G77 A;  4NF8 A;  2Y7W A;  3GZG A;  1H43 A;  5KZT A;  3VE1 B;  2RC9 A;  3HHG A;  4FED A;  1B0L A;  3SER A;  4ELQ A;  3CFX A;  2I58 A;  4F39 A;  1B3G A;  2THI A;  2REJ A;  1NNK A;  4UA8 A;  2AL5 A;  4ISU A;  1EZ9 A;  4O3B A;  2Z23 A;  4HS7 A;  4YB7 A;  5FHN A;  4R72 A;  5I59 A;  4QFL A;  4F29 A;  2O7I A;  3CG1 A; 
#chains in the Genus database with same CATH topology
 1MDQ A;  4OET A;  2EM8 A;  4X8R A;  1SW4 A;  4J8Z A;  4RY1 A;  1NFT A;  2WCC 3;  3FIR A;  5K2Y A;  1DBZ A;  1L4S A;  3E78 A;  3MZ1 A;  4C1U A;  4EF2 A;  2UXA A;  1ZMG A;  2EN3 A;  4AQY E;  4PC9 A;  4ND9 A;  2QS3 A;  4F9C B;  1NV2 A;  1L5T A;  3TEL A;  2EPR A;  3J7A G;  2WBB A;  4PF8 A;  2F3D A;  2H4I A;  2EMF A;  3RGY A;  1GGG A;  2QS2 A;  3O66 A;  2EOE A;  2OZZ A;  4OHN A;  2N8X A;  2FVZ A;  3HQ1 A;  2EPZ A;  4LF7 E;  4PFU A;  2E0S A;  2V88 A;  4GKJ E;  2ONS A;  2OWT A;  1OQH A;  2B65 A;  2N3H A;  1A54 A;  2YPN A;  2I49 A;  4ZYG A;  3DF6 A;  3T9H B;  2L8T A;  4PAF A;  4JYA E;  3LSW A;  3LSX A;  4JDF A;  1B1X A;  3LBS A;  4OX9 E;  2LRS A;  4GWO A;  3MC2 A;  1IZ1 A;  2XX7 A;  3VVD A;  5I2N A;  5IKB A;  1P1W A;  3WAF A;  5BWJ A;  5JTY B;  3VFJ A;  1SD3 A;  1MQJ A;  4FJP A;  4WPY A;  1LBW A;  1B5H A;  2R8T A;  1ATG A;  2OWZ A;  2ZZX A;  4L5N C;  1MXU A;  3BBG A;  1MY1 A;  5I7I A;  3C31 A;  4R2D A;  2PX1 A;  3R6U A;  2F7A A;  3KEI A;  1Y3P A;  3LLH A;  1ZIU A;  1P1U A;  5LL6 R;  3LR1 A;  2LE2 A;  3SEV A;  4ECF A;  1FBG A;  2YTI A;  3IB2 A;  5CBR A;  4R2S A;  1AH5 A;  4RJZ A;  5EHS A;  4BC9 A;  3RT8 A;  2O7U A;  4DV1 E;  4OMB A;  1N7W A;  4GWY A;  2MKN A;  2RSI A;  3R7X A;  4BCA A;  1FQE A;  2EM2 A;  2EPC A;  4P47 A;  2EM5 A;  4BLA A;  1B52 A;  3K6Q A;  4Q28 A;  4XTC Q;  5J16 A;  2V3T A;  4PFI A;  2FGG A;  3HN0 A;  2DWH A;  2UXB E;  2JWO A;  2I48 A;  2X7P A;  2QL3 A;  1MY0 A;  4X48 A;  1A1F A;  1PBQ A;  4MIJ A;  3BKI B;  4YB5 A;  2ELZ A;  4OXV A;  4U4S A;  1BP5 A;  3UK4 A;  1BBO A;  2F7B A;  4HCW A;  2EM7 A;  1J1N A;  2EL4 A;  2VPN A;  4HW8 A;  3VV5 A;  5FHM A;  2UVH A;  2YZT A;  4G68 B;  1YZ0 A;  1WRJ A;  1IIT A;  1FTO A;  1DQ3 A;  3FUZ A;  3M8U A;  1LAG E;  5T6J A;  4ZE8 A;  5TPA B;  2B9D A;  3CVG A;  4PFB A;  2GFE A;  2QRY A;  1UTH A;  2RCB A;  2CPN A;  4PGN A;  3A29 A;  4MLQ A;  2HGH A;  4KYD A;  4JI3 E;  4I3E A;  5H8Q A;  1B40 A;  4F22 A;  2DMI A;  4JXI A;  4O7M A;  5DNY A;  5CMB A;  2EQ0 A;  1US5 A;  1NI9 A;  5ITO A;  1NV6 A;  1GZ6 A;  2YTN A;  2ENH A;  2YT4 A;  2QS4 A;  3EHT A;  3H4Z A;  1DPE A;  1STU A;  2FHY A;  3TTR A;  1IME A;  1SPI A;  4DE8 A;  5AAS A;  2O84 X;  3KWR A;  2ABH A;  4KPT A;  4ZYH A;  4DXB A;  2EPL X;  4C0R A;  2A25 A;  5TSE A;  5LMU E;  1JK1 A;  2B4L A;  1N84 A;  4F3P A;  5FTH A;  4F3S A;  4F54 A;  2ZYM A;  2HZL A;  4JI4 E;  3TTL A;  4JWO A;  3IK6 B;  1FTL A;  2ENC A;  3LUY A;  3MP1 A;  4L17 A;  5ITP A;  4MX6 A;  1XMO E;  1PEB A;  4AQ4 A;  2A5S A;  2WZO A;  4GVO A;  1A1J A;  2OK2 A;  3S9L C;  1JW4 A;  3H03 A;  4JI1 E;  2R71 A;  3IWB A;  4KQP A;  3OO6 A;  1XNQ E;  4N6P A;  4PFT A;  5IT9 C;  4I40 A;  1T4L B;  1MXX A;  1LAH E;  2WX9 A;  2VD3 A;  3SES A;  3AV0 A;  2EZ6 A;  3S9E A;  1FW0 A;  3K0V A;  5DEX B;  2YTF A;  3ONM A;  1RDX A;  1USY E;  2EN8 A;  4WED A;  4I62 A;  2JXP A;  2Y5K A;  3IR1 A;  4H0W A;  3LUZ A;  2QMW A;  1QNT A;  2LTS A;  1IMB A;  1B7H A;  1DTG A;  4GOT A;  4HE0 A;  3RY3 A;  2L92 A;  4YY3 E;  3S9M C;  2RIN A;  1M5D A;  3TTN A;  4I8O A;  4PET A;  4F3B A;  1VFE A;  4RA1 A;  3F6G A;  4IR8 A;  2P0S A;  4NXM E;  1ANF A;  1EU8 A;  3K00 A;  2DVZ A;  2I3V A;  2FNC A;  1ZBT A;  4LAT A;  3O6G A;  3H6U A;  3MYU A;  4RPN A;  2ESN A;  4WSP A;  2NXO A;  2V87 A;  2V89 A;  1H45 A;  1MQH A;  4GL8 A;  2L3J A;  1IMU A;  4P9K A;  2ONK E;  1WHQ A;  5LTC A;  2DRP A;  2UVJ A;  4JI5 E;  2O1L A;  5I2K A;  2GPI A;  4F31 B;  5H8F A;  1D3K A;  4O24 A;  1M5E A;  4JI2 E;  1BIY A;  4F18 A;  1LGB C;  2F3B A;  5IAI A;  2RC7 A;  3CFZ A;  1IQO A;  2GHB A;  5LOM A;  3QMF A;  4IO4 A;  2KOU A;  1B3E A;  4F1Y A;  3IOR A;  1O63 A;  1B05 A;  4JVI A;  1AMF A;  2DWJ A;  3D4C A;  2EJ4 A;  4ZZE A;  1ELJ A;  2KON A;  3QYT A;  3C32 A;  5ESY A;  5DVJ A;  4DI3 D;  1CB6 A;  4F2Q A;  1IQ7 A;  1N3W A;  4ESW A;  1YTV A;  3MBP A;  4OZ9 A;  1YPN A;  1VSO A;  2QFL A;  2OCU A;  1DPP A;  2WYK A;  4IO7 A;  1QGX A;  1XVX A;  4L8N A;  1TF3 A;  4NMY A;  3Q28 A;  3JYR A;  2VP1 A;  1TXF A;  3VVF A;  1B3F A;  4B3M E;  4PP0 A;  4OEU A;  4LON B;  3VXB A;  4N4U A;  4LF6 E;  2EPU A;  1QUI A;  4DKK A;  2JOX A;  1YYO A;  3FBP A;  3F6H A;  2EOM A;  1B5I A;  1OVT A;  2RSM A;  2IA4 A;  2PCR A;  1YZ9 A;  4NF8 B;  3QIM A;  4YMA A;  3C36 A;  3C4M A;  4OQO A;  4I8C A;  4F1U A;  2VGQ A;  1N0T A;  3VYY A;  2PFZ A;  1URS A;  4TUI A;  4MNI A;  4IJD A;  2DP8 A;  2HAU A;  2XX9 A;  3MJN A;  3SEY A;  3G7W A;  2Y84 A;  4AS4 A;  3PPR A;  2F34 A;  2QVV A;  1O0W A;  1NV5 A;  1DGC A;  3E3K A;  1WJP A;  4YZZ A;  1UIU A;  1LBY A;  3PUX E;  1MRP A;  3B6W A;  1JNF A;  4R2A A;  4WKM A;  1WXR A;  2CEY A;  2WYP A;  4X9J A;  3AXF A;  4HTG A;  1R9L A;  4H5F A;  1FPE A;  4IGT A;  2I3W A;  1I94 E;  4G77 A;  4R2E A;  1H43 A;  1PJS A;  1ZAA C;  3SER A;  5EQA A;  4ELQ A;  2I58 A;  4UA8 A;  2REJ A;  4WXD A;  2O7I A;  5A5X A;  2HHH E;  1PB7 A;  4LZ7 A;  3EHU A;  2EQ3 A;  3IO6 A;  2F97 A;  1NKX A;  1UQW A;  2YJP A;  4DR7 E;  4MNC A;  3W15 C;  1BKA A;  1YYK A;  3ADL A;  4OVS A;  1XVY A;  2GH9 A;  4TQU Q;  5KCJ B;  3SEW A;  1B2H A;  5A69 A;  1B4H A;  2VOZ A;  3T96 B;  3UGW A;  1FBH A;  2EMW A;  3MHS C;  2QVR A;  3ZSF A;  1RMD A;  3PTY A;  4O8M A;  5EYG A;  3AUZ A;  4U21 A;  1LBX A;  3U65 A;  4DI4 B;  4R9G A;  1FTM A;  1VE4 A;  2YTD A;  1DOT A;  4OEV A;  2UU9 E;  4TLL B;  4O3C A;  1S50 A;  4H6D A;  1AIV A;  5EHM A;  4BBY A;  4M30 A;  4P1E A;  1FPJ A;  2LUP B;  1XMQ E;  2UVI A;  1I6Q A;  3K4U A;  4GBW A;  2P3V A;  3K6V A;  1MDP 1;  5IZ3 A;  2F7C A;  3U72 A;  4BDN A;  3PGF A;  1FPI A;  1NH8 A;  5IZ1 A;  2YWQ A;  2LBS B;  4JWX A;  2F8B A;  4H8I A;  1Y20 A;  1LB8 A;  2B7V A;  2GQ1 A;  2YSP A;  4QFK A;  3FVK A;  1URD A;  2WBU A;  1CE2 A;  3Q29 A;  2PVU A;  1IMC A;  2LTR A;  5F7V A;  1T38 A;  2AYS A;  3B50 A;  4PE5 B;  1JET A;  1KA1 A;  4DV0 E;  3FAT A;  2OJT A;  4GBV A;  2V83 A;  1AL3 A;  3T66 A;  3UK3 C;  4OFL A;  3HPS A;  4ZEF A;  1EZP A;  2EOF A;  2WBD A;  1FQB A;  1LST A;  1YYZ A;  1Z7N E;  3MHH C;  3MP6 A;  5KDT B;  1FJG E;  2EOX A;  1FJ6 A;  3T1Y E;  2RS6 A;  2XXI A;  2F6P A;  2MC6 A;  4ZYD A;  2A5T A;  2XXY A;  5IWA E;  4WYQ B;  2VRD A;  2ZYN A;  2AIX A;  1WHN A;  2E1M A;  3KOS A;  1X6E A;  1FPK A;  3HO7 A;  3ODB A;  2P3N A;  2GHA A;  2VQE E;  1N7X A;  3C33 A;  1B5J A;  5KL6 A;  2XXK A;  1A1I A;  4X65 E;  5A6A A;  1FBP A;  1B7Z A;  3KG2 A;  2B3F A;  3IB0 A;  3W9W A;  2ANJ A;  1US4 A;  3M3F A;  1UTB A;  1R9Q A;  4LN5 A;  2LAO A;  2OX3 A;  4GZN C;  3VXC A;  3C4B A;  2EN4 A;  2I4B A;  5F3W A;  4FBP A;  3G3I A;  2FBP A;  2AL4 A;  3QSL A;  3RTF B;  4PGP A;  3HXL A;  3CI8 A;  1GR2 A;  5A5L A;  3ILT B;  2HC5 A;  4POX A;  1Q9D A;  4NF0 A;  4KXP A;  5I57 B;  4Z0I A;  4BDM A;  4DR1 E;  4LQ5 A;  3T9X B;  1GQE A;  4K3F A;  1DK4 A;  2Y7P A;  1TWY A;  4GX4 A;  5L9M A;  2RS7 A;  1A1L A;  5CMC A;  4TLM B;  4KHZ E;  3O2A A;  1DMB A;  1B32 A;  1QU6 A;  3LV0 A;  5J1D A;  4QFO A;  5I5P A;  4NZV A;  1A55 A;  3MST A;  4DV6 E;  3FZV A;  1RYX A;  1SR9 A;  1GV8 A;  1G0I A;  2EL6 A;  1FBF A;  5A6J A;  4ZED A;  2DXR A;  3CR9 A;  5KL5 A;  3EPE A;  2F6G A;  4BMJ A;  3FAS A;  4M4G A;  2BJI A;  5ICQ A;  2ALU A;  3RYD A;  2P2A A;  2XD3 A;  2UYE A;  2CTD A;  4NQ8 A;  2EP3 A;  2DWI A;  1B4Z A;  3UA8 A;  4DCX A;  4NWD A;  3DP4 A;  4QBA A;  3CSG A;  1NCS A;  4H46 A;  1NNF A;  2QPQ A;  5B70 A;  1SW5 A;  1Z7M E;  1SFE A;  2LJH A;  1MM7 A;  1MXZ A;  3QUF A;  4IS1 C;  1LEV A;  4JI7 E;  2O6A A;  4DUZ E;  2EN7 A;  4FK5 C;  3HV1 A;  2YRM A;  4PFW A;  2X26 A;  2EOO A;  3ROJ A;  1IQS A;  4EQ7 A;  2I0B A;  4FOR A;  4DLD A;  3KZY A;  2O69 A;  3M3L A;  4N91 A;  3MPL A;  5AA3 A;  1LCF A;  4IO2 A;  3PPO A;  2DWA A;  3K6U A;  2VPO A;  4P3L A;  2XXP A;  3PD8 A;  2XWK A;  5KL4 A;  3QXM A;  4P0I A;  1HSE A;  4GXS B;  4MJO A;  4X66 E;  1Y9U A;  2PBW A;  4AS5 A;  4ELP A;  5KDT A;  4TUG A;  1LBV A;  1B0H A;  1F2I G;  1HNX E;  1H76 A;  3TQW A;  2EPN A;  3EHS A;  2O51 A;  1FJ9 A;  3TMG A;  4F1V A;  2ZM6 E;  2WBT A;  2JJK A;  1MY3 A;  3MVZ A;  4DV7 E;  2ELY A;  1MY4 A;  4JWY A;  4NGU A;  2LVH A;  5KL2 A;  4DR6 E;  1ZLQ A;  1FQF A;  4QFP A;  4JVC A;  1VDW A;  3N5L A;  4MMP A;  4DCY A;  2VT5 A;  4ONY A;  4R6K A;  4QSC A;  1LBZ A;  4O4K A;  2B3T B;  3IL1 B;  3PPQ A;  2EMK A;  3IJO B;  1SW1 A;  1IXH A;  3OSR A;  2B7T A;  3SEX A;  3T1H E;  3VDF A;  1LFH A;  1IUD A;  1YUJ A;  1SI1 A;  3IFA A;  2LMZ A;  2MC5 A;  3I3V A;  3ZKK A;  4DXU A;  5I56 B;  4YAH X;  3U93 A;  1A7L A;  4LP2 B;  4OTE A;  4YB6 A;  2CMO A;  3TKD A;  4R74 A;  3LSL A;  4BS9 A;  4LZ8 A;  2DXY A;  4HE2 A;  4JI6 E;  4KFQ A;  5AA4 A;  1EYK A;  4LF9 E;  3QAX A;  3DP8 A;  2Q89 A;  2CT1 A;  2V84 A;  4RYA A;  3VLU A;  4ZDM A;  4OWD A;  2M4I A;  2ODR C;  3BIG A;  4KD5 A;  1FCK A;  1HSL A;  1B51 A;  1JVX A;  1XI6 A;  1B69 A;  1I6B A;  3KN8 A;  3GBB A;  4NF6 B;  1Y4T A;  5B7D A;  1B58 A;  3MPK A;  2F4V E;  5CRY A;  1GTK A;  4Z7E A;  1UIV A;  1Q35 A;  3CSB A;  4N17 A;  1EKZ A;  4YKP A;  2V85 A;  1JQF A;  1MPB A;  1N34 E;  3IJX B;  1G2F C;  4NF6 A;  4NF5 B;  1JW5 A;  1QKB A;  4H45 A;  4OAN A;  1IMD A;  4ZEB A;  4R9F A;  5K2X A;  3EKI A;  3ISP A;  3T9V A;  3FD3 A;  2Q8U A;  4PTK A;  5TU0 A;  3D1R A;  4EDP A;  1Y1Z A;  2ONR A;  2DLQ A;  4YKK A;  4O94 A;  4WFT A;  3K6X A;  2UUC E;  1IEJ A;  5CC2 A;  1X6F A;  2ZXT A;  3V8X B;  2PYY A;  5A2Q C;  3VHT B;  1B9J A;  1DI2 A;  1OVB A;  2DE3 A;  4F6M A;  3N26 A;  4G2Z A;  2Q9T A;  2ZNS A;  3TTK A;  1TFA A;  3U94 A;  3E9X A;  1USY H;  3IB1 A;  1IMF A;  4X04 A;  5JK4 A;  4XKP A;  1LLS A;  3KBR A;  1NV0 A;  2V86 A;  1INP A;  2DOJ A;  4RK2 A;  2HFB A;  5DVI A;  4O43 A;  1N36 E;  2YU5 A;  3K6W A;  2H36 X;  3QG5 C;  3LML A;  2NAB A;  4JB7 A;  3L6H A;  5CI5 A;  2MKD A;  3C4T A;  3OEL A;  4KCD A;  1X6H A;  1MPD A;  1J26 A;  3JV9 A;  2EMC A;  1G2D C;  1D9V A;  3P7I A;  4Q0C A;  4EUO A;  3J7Y p;  1RDZ A;  4NF8 A;  3GZG A;  3HHG A;  1PJT A;  1B0L A;  5EQ7 A;  1EH8 A;  4ISU A;  3J81 C;  5FHN A;  5I59 A;  5BUU A;  2Z8F A;  2EOQ A;  1QUK A;  4HCY A;  2LV2 A;  4DDD A;  1IBM E;  3CG3 A;  4P56 A;  5HPQ A;  3KZZ A;  1MXV A;  5EQ9 A;  4LU9 A;  1BBG A;  4XF5 A;  2CZH A;  1NL5 A;  2YTO A;  3N6U A;  1EYI A;  4KYS A;  1YUI A;  2GLI A;  4E0X A;  4R8O A;  4NHB A;  1Q1K A;  4GQO A;  1MGT A;  1MY2 A;  4IO6 A;  3NOH A;  1M5C A;  1FBC A;  4JVD A;  3IFC A;  4GX6 A;  3HHF A;  3ADG A;  4ZEC A;  1NH7 A;  1NV3 A;  3SET A;  5AE1 A;  2F78 A;  1MXY A;  3MWB A;  3RUM A;  4C1T A;  4F2O A;  3EQ1 A;  2XWI A;  3GBA A;  2DIX A;  2EML A;  4MCO A;  5CMM A;  2BBG A;  4UAC A;  1P1N A;  3VLV A;  1XC1 A;  1UTH B;  4MNP A;  2Q8M A;  5TPA A;  1QJM A;  3THI A;  3R26 A;  3EPL A;  5IM2 A;  2EOZ A;  1MPC A;  2ENA A;  1O64 A;  3FJM A;  2I13 A;  3BBR A;  2DLK A;  1MG1 A;  3VVE A;  1IXI A;  4OOG C;  3VYX A;  1DCU A;  2L33 A;  3FVG A;  1P1Q A;  3TCF A;  3ZKL A;  3P1X A;  3O9P A;  4XKQ A;  4R03 A;  5AC5 A;  1EH3 A;  3H09 A;  4U4X A;  4GXA A;  2O68 A;  3GLB A;  3ZS6 A;  2ZYK A;  4F6N A;  3THN A;  4HE1 A;  4E0W A;  2Q74 A;  3K1N A;  4PQJ A;  3EPH A;  5AE2 A;  4U22 A;  2NVU B;  4KYE A;  1IBL E;  3FVN A;  3PMW A;  4H5G A;  1O7T A;  2LT7 A;  2DE4 A;  2PMS A;  4YMB A;  3MP8 A;  1FTJ A;  4PFY A;  4WSG A;  2LJU A;  3KN3 A;  3EPJ A;  2DB2 A;  4NE4 A;  3ECR A;  1KWH A;  5I84 A;  4MEV A;  4ZEI A;  1RQ0 A;  4G8H A;  2MKZ A;  5KL3 A;  3IOV A;  3EF7 A;  3PUZ E;  3PUV E;  1MEY C;  1XT8 A;  3PMX A;  1NEI A;  2EN2 A;  3BID A;  4NF5 A;  2ZNU A;  1XOC A;  2EN1 A;  4GF8 A;  1QW0 A;  1ZJL A;  2L5V A;  2XX8 A;  2QVU A;  3KJ7 A;  1NV1 A;  5A6B D;  4N6K A;  2EOJ A;  5CBS A;  3KOT A;  3Q27 A;  4R2B A;  2HCA A;  3HCQ A;  3N94 A;  1KA0 A;  2HHM A;  3TQM A;  4NED A;  3WAE A;  4BHB A;  4G68 C;  4X8W A;  1KJK A;  1NUW A;  1VFD A;  4FAT A;  1A8E A;  2YRK A;  4NN3 A;  1FQC A;  4H8J A;  4PAI A;  1NNT A;  3L00 A;  1NV4 A;  5JTY A;  2EM0 A;  1BK4 A;  1LAF E;  1MQI A;  2A5T B;  2UXC E;  3RPL B;  2DGC A;  3SEU A;  4BC7 A;  1X48 A;  2YTE A;  2XXT A;  3HST A;  3M99 B;  3IWC A;  5AC4 A;  3CRB A;  4JV5 E;  2YTG A;  3DM0 A;  4DV5 E;  3T22 A;  1WVJ A;  3BFT A;  1X47 A;  3FIG A;  1PBP A;  4ZS9 A;  2XD2 A;  2YTP A;  3U8Q A;  2EMB A;  4NF4 B;  4OVJ A;  3MVW A;  1IXG A;  3OEM A;  3HFU A;  1MM6 A;  4LA9 A;  4ELR A;  4IO5 A;  4G8M A;  4NAP A;  4R2F A;  2FYI A;  3SDF A;  2H99 A;  4MFI A;  4RK9 A;  3VLW A;  4OFO A;  3BF2 A;  3EPK A;  3PV0 E;  1ZBQ A;  5H8Q B;  2Z8D A;  1UIL A;  1OLC A;  4DUY E;  3K1M A;  4KWY A;  5IZ3 B;  5M2V A;  3T9U A;  1JEU A;  5JEI A;  1A1K A;  4ESX A;  2E72 A;  1NMU A;  3GXA A;  1T0K A;  3TZA A;  4Q30 B;  4MF3 A;  3OOA A;  3O28 A;  4QSD A;  1B3H A;  4DV2 E;  2V3U A;  2V93 A;  3K01 A;  1YSA C;  1ZTY A;  5H8N B;  3RPL A;  1LLM C;  3C6K A;  1HR0 E;  2E1S A;  3UIF A;  2QS1 A;  4POW A;  4ELO A;  1LBB A;  4YIC A;  4OVR A;  1NNP A;  2XXX A;  1P47 A;  2EMX A;  3U1O A;  1ZU0 A;  2PRT A;  2NUF A;  2I4C A;  2F8D A;  4OES A;  2XXU A;  2L2M A;  4RH8 A;  4DZ1 A;  3T0J A;  3BFU A;  4P8B A;  3LC8 A;  2JVA A;  4XXU A;  3IO4 A;  1POT A;  2EM4 A;  1N3X A;  5AA2 D;  3HPI A;  2NWJ A;  4R2R A;  2EM9 A;  2EPM X;  1N76 A;  3KGC A;  3S2V A;  5IGA A;  4LF8 E;  2CZL A;  3KJT A;  4P78 A;  3OMB A;  4ZYE A;  4DR2 E;  4N81 A;  3FGS A;  2FTX B;  3TAJ A;  3RTW B;  4HXV A;  1PJQ A;  5CMK A;  2OWS A;  2EL5 A;  2JYA A;  4JI0 E;  1Y3Q A;  4O7I A;  3A3U A;  4XIG Q;  4KI0 E;  5ISU A;  2Q88 A;  4PE3 A;  2EQ1 A;  3PU5 A;  2EMI A;  3IWD A;  5CFF E;  1M5B A;  4OYV A;  1DTZ A;  1URG A;  1H44 A;  5H8H A;  3B8B A;  3OXN A;  2EPA A;  5A6K A;  1EH6 A;  4M9V C;  3H6V A;  4N15 A;  4Q5T A;  2LCE A;  1B1H A;  4PBH A;  1LCT A;  1MH4 A;  3OEN A;  4DV4 E;  2D5W A;  4OFJ A;  2E5L E;  3CIJ A;  4GLI A;  4ZZA A;  4P7D A;  5T3J A;  4THI A;  5I57 A;  4AB6 A;  3PUW E;  2G93 A;  5I58 B;  2VD2 A;  2XXW A;  3CFL A;  1S7Y A;  2HAV A;  3IX1 A;  2EMG A;  4DIG A;  4FIM A;  2VF1 A;  1IMA A;  4EXL A;  3MW0 A;  1K9Y A;  3MSW A;  4U2R A;  2NUG A;  4OER A;  1M5F A;  4NTL A;  4QHQ A;  4DR5 E;  5LMN E;  1A8F A;  3KSX A;  2OLB A;  2Z8E A;  4OVP A;  2H98 A;  2DSF A;  2HXW A;  1SYI A;  1D9Q A;  4KR5 A;  1T4N A;  1Y4C A;  2ZZW A;  4MAG A;  1FBE A;  3FV2 A;  1RDY A;  2VE7 C;  1B7U A;  2RQL A;  2JP9 A;  2YRH A;  2JOB A;  3V83 A;  3DP6 A;  4RHB B;  4FE8 A;  4GIZ A;  2DDK A;  3IOU A;  4M1V A;  1YFH A;  2EMZ A;  1HSJ A;  1DSN A;  3TCH A;  1BLF A;  4MBP A;  2NUE A;  1FQD A;  4P11 A;  3TEP A;  4O5G A;  2Z22 A;  1N32 E;  1SDX A;  2M8C A;  4GX3 A;  4DR4 E;  2GHF A;  5LDZ A;  3G3H A;  4FEC A;  3ADI A;  1A99 A;  3GYY A;  3OO9 A;  2YSO A;  3FXR A;  4IB2 A;  5AA2 B;  2H5Y A;  3PMV A;  1UN6 B;  5I2K B;  4PF6 A;  4LTY A;  2R6G E;  4WXJ A;  4NF4 A;  3H6W A;  2L6M A;  2IHR 1;  2EOY A;  2D9H A;  2EM6 A;  1R1N A;  3A3C A;  3RNN A;  5AA2 A;  1QUJ A;  3TYH A;  4LQ2 A;  2EPK X;  1X5W A;  3TQL A;  2W7Y A;  3PPN A;  1KYQ A;  2OBG A;  4GEQ B;  4R2C A;  3PD9 A;  2EWL A;  1WOD A;  4G8N A;  2BB8 A;  1FTK A;  4PBQ A;  4JSO A;  1FSA A;  4LFA E;  1EZO A;  1RKM A;  3JU0 A;  2PFY A;  2KLF A;  1PB8 A;  2Y7W A;  2CZI A;  4FED A;  2LO3 A;  4PCD A;  1FPB A;  1B3G A;  2CZK A;  2EOS A;  1NNK A;  2AL5 A;  4YB7 A;  3THO B;  4O3B A;  4HS7 A;  4DR3 E;  4R72 A;  4QFL A;  3JTZ A;  3CG1 A;  2XXV A;  5KCJ A;  4N13 A;  4EF1 A;  3FJ7 A;  4U1Z A;  1X3C A;  2WKY A;  5EYF A;  4BDR A;  1OLA A;  1QVS A;  4U23 A;  3G3J A;  4I3Y A;  3O29 A;  2I6E A;  2Y7K A;  3HTX A;  1D9Y A;  2QSX A;  5FBP A;  1POY 1;  2HZK A;  1J5E E;  3RMP A;  1RYO A;  4LUB A;  2UUB E;  1OMP A;  1MQG A;  2EPO A;  2RC8 A;  4PFR A;  2R1F A;  3H06 B;  1A40 A;  5L9O A;  2N3G A;  4BHC A;  4FAJ A;  4WX9 A;  1SBP A;  3DEL B;  5I58 A;  4LFB E;  2R76 A;  3I5O A;  1P99 A;  2KQZ A;  2M9A A;  3K1P A;  3TTM A;  3V5A A;  1Y1M A;  4RXL A;  2DQV A;  1ZR9 A;  5TP9 B;  5ET8 A;  5AA4 B;  3A09 A;  4XFE A;  2UYF A;  4Q35 B;  3L6G A;  2D21 A;  4IY6 A;  1GVC A;  4F19 A;  2HJJ A;  2O1M A;  4GD5 A;  5I56 A;  4GFR A;  5H8H B;  2JR1 A;  4X9T A;  3RQT A;  4F9A B;  4FEB A;  2YLN A;  3J80 C;  1A1G A;  2IEE A;  3MQ9 A;  1AAY A;  3B7D A;  1MQD A;  5FTI A;  4IY5 A;  5F24 A;  4UAB A;  1FTA A;  1N04 A;  3MUQ A;  3SZP A;  2DYX A;  2UUA E;  4YHH E;  3T93 B;  3KSJ A;  3E13 X;  2H9B A;  4KCC A;  2LUQ A;  4N8Y A;  4R73 A;  2NUV A;  3C35 A;  4GWS A;  5LLQ A;  2XXR A;  4PAK A;  3MVX A;  3KFM A;  1BB8 A;  2WBS A;  1I6A A;  2B3B A;  4N4R B;  2V4C A;  2CEX A;  1FBD A;  2XXH A;  2EPP A;  2G29 A;  4R2Q A;  3ILU B;  4N8G A;  4GWZ A;  5FHO A;  2EM3 A;  3PPP A;  1LB9 A;  3RT6 B;  3C6M A;  1NV7 A;  2VHA A;  4GWU A;  1P1O A;  1YXI A;  3C34 A;  4N6D A;  4WEP A;  4R75 A;  2EMY A;  1FQA A;  4G68 A;  1Y3N A;  5HBC A;  2L2K B;  4F2J C;  3E79 A;  5KL7 A;  3D4G A;  2EN6 A;  3M3K A;  2J7J A;  1B6H A;  3B6Q A;  2FV4 B;  4G61 A;  4XKR A;  5ET5 A;  4QXD A;  1IXC A;  1TF6 A;  4HEI A;  2Q2A A;  1MXW A;  4JSD A;  2FIX A;  1G0H A;  2EOI A;  5H8N A;  3IOT A;  1PC3 A;  5DVF A;  3O97 A;  2HEU A;  4X64 E;  2I9I A;  3V89 B;  4OVT A;  5L8D A;  3SKP A;  2FIE A;  4EQ9 A;  1RC7 A;  3FXU A;  2HQ0 A;  1TN9 A;  1LAX A;  4I1D A;  4OVQ A;  4YKI A;  1QKA A;  1LBC A;  2F36 A;  3QK6 A;  1AOV A;  3FV1 A;  3PUY E;  2I0C A;  3RPW A;  3H7M A;  2X7Q A;  4EQB A;  4LF4 E;  4IGR A;  5H8F B;  1NUY A;  1SYH A;  3JZJ A;  2EMA A;  2DS9 A;  5DTB A;  2HPG A;  4PDD A;  1JK2 A;  3DLN A;  3OEK A;  5IXM B;  3KZG A;  4LFC E;  4Q8R A;  4GKK E;  2UXD E;  4NXN E;  4LVQ A;  4F3G A;  2NA2 A;  4P1L A;  4LZ5 A;  3UN6 A;  2R9J A;  2GRV A;  2M7Q A;  3UOR A;  4MLV A;  3KN7 A;  2PT2 A;  3KC0 A;  5I2N B;  4B3T E;  4R2P A;  4QFN A;  2EOH A;  5HM4 B;  3KBZ A;  3S4U A;  3FVO A;  2BJJ X;  4R6Y A;  1FPL A;  4BDL A;  3KC1 A;  5ET6 A;  2DE2 A;  1LFI A;  3H6T A;  1FPF A;  2RPC A;  1A1H A;  3ZOQ B;  3UP9 A;  1VR5 A;  4M2Z A;  4OA4 A;  1B46 A;  1UTB B;  4X62 E;  1TT1 A;  5DEX A;  4NHR A;  2V3Q A;  3B6T A;  3K02 A;  3U92 A;  1EYJ A;  1XNR E;  5AE4 A;  5L9S A;  4K0K E;  1SVX B;  2ADR A;  1K9Z A;  1F9B A;  3S9N C;  4NX1 A;  1ZBM A;  1JP4 A;  3G3F A;  4ZE9 A;  1BTJ A;  4R6H A;  3I6V A;  3H3G A;  4GWX A;  2PT1 A;  3OD7 A;  5IV8 B;  2F5X A;  2QJE A;  3RN8 A;  2K4V A;  3TOD A;  4JBZ A;  4G4P A;  4O3A A;  3FXQ A;  4X1D A;  4N07 A;  3TUS A;  3MZ9 A;  5F1Q A;  3MAM A;  2JPA A;  2ZNT A;  3EN3 A;  1YYW A;  4YKJ A;  3OO7 A;  3JAM C;  5DW8 A;  2Y7R A;  3BIH A;  3G3G A;  4U1O A;  4QSE A;  3IOW A;  1HNZ E;  4KHP E;  1NUX A;  1B3L A;  2M1S A;  3K2D A;  3TFL A;  2XWO A;  1FPD A;  3BGH A;  4F9B B;  4AB5 A;  4MHF A;  3RLF E;  4H1X A;  3FXB A;  1IBK E;  2DSY A;  1FKA E;  3G3K A;  2K7I A;  2NOO A;  1X49 A;  3LSF B;  3Q25 A;  4MH5 A;  4TOZ A;  4WXC A;  1ZU1 A;  1T39 A;  1EH7 A;  1PB9 A;  1SW2 A;  1AWB A;  4XKN A;  3C9H A;  2EE8 A;  1OQG A;  2L2N A;  1N3G A;  4M0V A;  4RNS A;  2EMH A;  4ZEK A;  2ZYO A;  3TPA A;  1PDA A;  3F11 A;  4DXC A;  3VK6 A;  5AE3 A;  5BR8 E;  4QRZ A;  1NUZ A;  2XA5 A;  3HPZ A;  4KZS A;  2DMY A;  2REG A;  1XS5 A;  1JVY A;  1II5 A;  1R6Z A;  4XEQ A;  3O6H A;  1QUL A;  4GWW A;  4IO3 A;  5EQ8 A;  3OSQ A;  1N33 E;  2V25 A;  2XWV A;  1UHZ A;  2VQF E;  2YTJ A;  1I69 A;  3OML A;  3MZB A;  5I59 B;  3QUJ A;  4RPO A;  5TP9 A;  4GRK A;  3IAZ A;  2CSH A;  4NG7 A;  4PDH A;  1D4N A;  4I9D A;  2H25 A;  4OEN A;  1JW1 A;  1Z1B A;  3USD A;  3W9V A;  1XHY A;  1LFG A;  3ADJ A;  2JY9 A;  5AA1 A;  2HXR A;  1UBD C;  1ZKB A;  4H67 A;  2RTX A;  5A5X B;  1H3D A;  2ZMB A;  2XXQ A;  2V8Q B;  1S9T A;  5H8S A;  5IZZ A;  1TFD A;  4DV3 E;  1YCJ A;  2ZZV A;  1MS7 A;  4X1B A;  5ELV A;  2DVC A;  2QMX A;  1T4O A;  1CNQ A;  2YTQ A;  2Q8J A;  2UVG A;  2KHX A;  1MH3 A;  1PKP A;  5DT6 A;  5DYH A;  4H65 A;  2B4M A;  2RF1 A;  3OTO E;  5ET7 A;  2MDR A;  4LF5 E;  3OO8 A;  3O6I A;  2Q2C A;  2EPX A;  4BDQ A;  5CM6 A;  3TCG A;  3N6T A;  3Q26 A;  2L3C A;  2ODR D;  4QF9 A;  1HNW E;  4B3S E;  4JI8 E;  2G7H A;  5FLX C;  2D3I A;  3MVY A;  5ICT A;  3E4R A;  4BDO A;  4P0G A;  1YAE A;  1WDN A;  2FA7 A;  3DJW A;  2Y7I A;  1KZ8 A;  2P1S A;  2YU8 A;  1SI0 A;  2XHD A;  1FRP A;  5A6B A;  2WEF A;  1IIW A;  4DMI A;  5ADZ A;  1SQY A;  3TDJ A;  4GL0 A;  4B3R E;  2Y5L A;  4EXK A;  1JEV A;  3FJG A;  2EOR A;  3T1B A;  2RKM A;  2MDG A;  5EYH A;  1OIB A;  4YU0 A;  2F35 A;  2KR0 A;  4NWC A;  5I3S A;  5KZT A;  3VE1 B;  2RC9 A;  1FPG A;  3CFX A;  4F39 A;  2THI A;  1EZ9 A;  2Z23 A;  4F29 A;  3CHG A;  2RCA A; 
#chains in the Genus database with same CATH homology
 2XXV A;  5KCJ A;  1MDQ A;  4N13 A;  4OET A;  4EF1 A;  3FJ7 A;  4U1Z A;  1QUK A;  1SW4 A;  1PB7 A;  4HCY A;  2WKY A;  3EHU A;  4LZ7 A;  1NFT A;  1OLA A;  3IO6 A;  1QVS A;  2F97 A;  3CG3 A;  3G3J A;  4U23 A;  4BDR A;  3O29 A;  5HPQ A;  1MXV A;  2I6E A;  3FIR A;  2Y7K A;  1D9Y A;  2QSX A;  5K2Y A;  1NKX A;  1POY 1;  2HZK A;  5A5X A;  1RYO A;  4LUB A;  1UQW A;  2YJP A;  1OMP A;  1MQG A;  3MZ1 A;  1NL5 A;  4C1U A;  3N6U A;  2RC8 A;  3W15 C;  1BKA A;  2UXA A;  4KYS A;  4EF2 A;  3H06 B;  1ZMG A;  5BUU A;  4E0X A;  1A40 A;  5L9O A;  4ND9 A;  1Q1K A;  4GQO A;  1XVY A;  2QS3 A;  4FAJ A;  1MY2 A;  2GH9 A;  4TQU Q;  1SBP A;  3DEL B;  4IO6 A;  5I58 A;  1L5T A;  3I5O A;  5KCJ B;  3SEW A;  3TEL A;  1M5C A;  1P99 A;  1B2H A;  1B4H A;  3K1P A;  2VOZ A;  3HHF A;  3TTM A;  3V5A A;  3T96 B;  1Y1M A;  4RXL A;  3UGW A;  2DQV A;  2H4I A;  5TP9 B;  1NH7 A;  4ZEC A;  5AA4 B;  3A09 A;  3RGY A;  3SET A;  1GGG A;  3ZSF A;  2QS2 A;  2UYF A;  3L6G A;  2F78 A;  1MXY A;  2D21 A;  3MWB A;  3O66 A;  4IY6 A;  4U21 A;  1GVC A;  3RUM A;  4F19 A;  4C1T A;  2OZZ A;  4R9G A;  4OHN A;  4F2O A;  3EQ1 A;  1FTM A;  1VE4 A;  2O1M A;  4GD5 A;  5I56 A;  4GFR A;  3GBA A;  5H8H B;  1DOT A;  4PFU A;  2E0S A;  4X9T A;  5CMM A;  3RQT A;  2ONS A;  4OEV A;  4TLL B;  4FEB A;  2YLN A;  4Z7E A;  2OWT A;  4UAC A;  1P1N A;  4O3C A;  1OQH A;  2IEE A;  3VLV A;  1XC1 A;  1UTH B;  2B65 A;  3B7D A;  3MQ9 A;  1MQD A;  1A54 A;  1S50 A;  5FTI A;  4IY5 A;  4H6D A;  2YPN A;  1AIV A;  5EHM A;  5TPA A;  1QJM A;  2I49 A;  1N04 A;  3MUQ A;  3THI A;  3T9H B;  2UVI A;  2DYX A;  1I6Q A;  3K4U A;  3R26 A;  1MPC A;  1O64 A;  3T93 B;  3KSJ A;  3K6V A;  1MDP 1;  3FJM A;  2F7C A;  3BBR A;  3LSW A;  3U72 A;  3PGF A;  1NH8 A;  4BDN A;  1MG1 A;  3E13 X;  2H9B A;  3VVE A;  4KCC A;  1IXI A;  3LSX A;  4JDF A;  4JWX A;  1B1X A;  1P1Q A;  1Y20 A;  3FVG A;  1LB8 A;  3LBS A;  4GWO A;  4H8I A;  3TCF A;  4R73 A;  3MC2 A;  3ZKL A;  3R7X A;  3O9P A;  2NUV A;  4XKQ A;  4QFK A;  3C35 A;  1IZ1 A;  1EH3 A;  3FVK A;  2XX7 A;  2XXR A;  1URD A;  3MVX A;  3VVD A;  5I2N A;  4U4X A;  1CE2 A;  3Q29 A;  1P1W A;  3KFM A;  4GXA A;  5IKB A;  2PVU A;  3WAF A;  5F7V A;  2O68 A;  3GLB A;  3ZS6 A;  5JTY B;  3VFJ A;  2ZYK A;  5BWJ A;  4E0W A;  1I6A A;  1SD3 A;  2AYS A;  2B3B A;  4PE5 B;  1MQJ A;  3K1N A;  1JET A;  4PQJ A;  2NVU B;  4U22 A;  2XXH A;  4KYE A;  3FAT A;  2G29 A;  2OJT A;  3ILU B;  4FJP A;  3FVN A;  3PMW A;  1AL3 A;  1O7T A;  4H5G A;  1B5H A;  2PMS A;  1ATG A;  2DE4 A;  5FHO A;  3T66 A;  3PPP A;  4OFL A;  1LB9 A;  3RT6 B;  4YMB A;  3MP8 A;  1FTJ A;  1MXU A;  1MY1 A;  4PFY A;  3C31 A;  2VHA A;  1P1O A;  3KN3 A;  3C34 A;  4WEP A;  2PX1 A;  4ZEF A;  1EZP A;  4NE4 A;  1FQB A;  1LST A;  3ECR A;  1KWH A;  1Z7N E;  4R75 A;  1FQA A;  3R6U A;  2F7A A;  4G68 A;  4ZEI A;  3KEI A;  1Y3N A;  5I84 A;  4G8H A;  3MP6 A;  5KDT B;  1Y3P A;  5HBC A;  1ZIU A;  2RCA A;  3EF7 A;  3IOV A;  3PUZ E;  3D4G A;  3PUV E;  1P1U A;  3M3K A;  1XT8 A;  3PMX A;  1B6H A;  3B6Q A;  2XXI A;  3LR1 A;  3SEV A;  4ECF A;  4NF5 A;  4XKR A;  2F6P A;  1IXC A;  2ZNU A;  1XOC A;  2A5T A;  3IB2 A;  2XXY A;  5EYF A;  5CBR A;  1AH5 A;  2Q2A A;  4GF8 A;  1MXW A;  4RJZ A;  2ZYN A;  5EHS A;  3RT8 A;  2O7U A;  4JSD A;  2AIX A;  1QW0 A;  1ZJL A;  2XX8 A;  4OMB A;  3KJ7 A;  1N7W A;  5H8N A;  3IOT A;  3V83 A;  3KOS A;  1PC3 A;  5CBS A;  3KOT A;  5DVF A;  3HO7 A;  3Q27 A;  4R2B A;  3O97 A;  2HCA A;  3ODB A;  2HEU A;  1FQE A;  3HCQ A;  3N94 A;  2GHA A;  1N7X A;  4NED A;  4BLA A;  3V89 B;  3WAE A;  1B52 A;  4XTC Q;  4G68 C;  2V3T A;  3C33 A;  1B5J A;  3HN0 A;  5L8D A;  1VFD A;  4FAT A;  2DWH A;  3SKP A;  4EQ9 A;  1A8E A;  1B7Z A;  3KG2 A;  3FXU A;  2I48 A;  2HQ0 A;  1FQC A;  2X7P A;  4H8J A;  2B3F A;  2QL3 A;  3IB0 A;  1MY0 A;  4X48 A;  1LAX A;  3W9W A;  1PBQ A;  1NNT A;  2ANJ A;  3BKI B;  4I1D A;  5JTY A;  4F31 B;  4YB5 A;  4YKI A;  1LAF E;  1MQI A;  2A5T B;  1US4 A;  3M3F A;  1QKA A;  1UTB A;  1LBC A;  1R9Q A;  2LAO A;  2F36 A;  4OXV A;  1BP5 A;  4U4S A;  3UK4 A;  2F7B A;  3VXC A;  4HCW A;  3QK6 A;  3SEU A;  2I4B A;  4F2Q A;  1AOV A;  3FV1 A;  3PUY E;  1J1N A;  2I0C A;  3G3I A;  3RPW A;  3H7M A;  4ESW A;  2X7Q A;  4EQB A;  4HW8 A;  3VV5 A;  2XXT A;  5FHM A;  3HST A;  2UVH A;  2AL4 A;  3QSL A;  4IGR A;  5H8F B;  4G68 B;  3RTF B;  1SYH A;  3CRB A;  3CI8 A;  1GR2 A;  3ILT B;  1IIT A;  4POX A;  3JZJ A;  1FTO A;  2DS9 A;  3FUZ A;  3M8U A;  5DTB A;  5I57 B;  4Z0I A;  4BDM A;  1LAG E;  3DM0 A;  4LQ5 A;  3DLN A;  3OEK A;  4Q8R A;  3KZG A;  4ZE8 A;  5TPA B;  3T22 A;  3CVG A;  3T9X B;  1WVJ A;  3BFT A;  4LVQ A;  2GFE A;  2QRY A;  4F3G A;  4K3F A;  3UN6 A;  4LZ5 A;  1PBP A;  1UTH A;  4ZS9 A;  2XD2 A;  2RCB A;  2R9J A;  2GRV A;  3U8Q A;  2Y7P A;  1TWY A;  3UOR A;  4NF4 B;  4OVJ A;  4MLV A;  1IXG A;  3MVW A;  4MLQ A;  5L9M A;  4KYD A;  3OEM A;  5CMC A;  3KN7 A;  4TLM B;  5H8Q A;  1B40 A;  2PT2 A;  4JXI A;  1MM6 A;  4F22 A;  4LA9 A;  4ELR A;  4IO5 A;  4G8M A;  4KHZ E;  5CMB A;  5I2N B;  3O2A A;  1US5 A;  1DMB A;  1B32 A;  4R2F A;  2FYI A;  5ITO A;  3SDF A;  2H99 A;  4MFI A;  2QS4 A;  4QFN A;  3EHT A;  4RK9 A;  3VLW A;  4OFO A;  3H4Z A;  5J1D A;  3PV0 E;  4QFO A;  1DPE A;  1A55 A;  5H8Q B;  2Z8D A;  3TTR A;  3FZV A;  1RYX A;  1OLC A;  3K1M A;  5M2V A;  1GV8 A;  5HM4 B;  3T9U A;  4DE8 A;  1JEU A;  5JEI A;  3S4U A;  2O84 X;  3FVO A;  2BJJ X;  4R6Y A;  2ABH A;  4KPT A;  4DXB A;  4BDL A;  4C0R A;  4ESX A;  1NMU A;  3GXA A;  1T0K A;  4ZED A;  2DE2 A;  3TZA A;  1N84 A;  2DXR A;  3CR9 A;  4Q30 B;  4F3P A;  5FTH A;  1LFI A;  4F3S A;  4MF3 A;  2ZYM A;  3OOA A;  2HZL A;  3H6T A;  3O28 A;  4QSD A;  3EPE A;  2F6G A;  1B3H A;  3FAS A;  3TTL A;  4M4G A;  2V3U A;  3UP9 A;  4JWO A;  2V93 A;  1VR5 A;  5ICQ A;  3K01 A;  3IK6 B;  2ALU A;  1FTL A;  1ZTY A;  2P2A A;  5H8N B;  2XD3 A;  1B46 A;  1UTB B;  1TT1 A;  2UYE A;  3LUY A;  3MP1 A;  5DEX A;  2DWI A;  1B4Z A;  2E1S A;  3UIF A;  4L17 A;  2QS1 A;  3UA8 A;  4DCX A;  4POW A;  4ELO A;  5ITP A;  4NWD A;  3DP4 A;  1PEB A;  1LBB A;  3CSG A;  4YIC A;  4AQ4 A;  1NNF A;  2A5S A;  2QPQ A;  2V3Q A;  5B70 A;  1NNP A;  4GVO A;  1SW5 A;  1Z7M E;  2OK2 A;  2XXX A;  3B6T A;  3QUF A;  1MM7 A;  1MXZ A;  3K02 A;  3U92 A;  3S9L C;  3U1O A;  1ZU0 A;  1JW4 A;  3H03 A;  2I4C A;  2F8D A;  2R71 A;  2O6A A;  4OES A;  4KQP A;  5AE4 A;  5L9S A;  1SVX B;  3OO6 A;  2XXU A;  3HV1 A;  4PFW A;  4N6P A;  2X26 A;  4DZ1 A;  3BFU A;  1F9B A;  3LC8 A;  4PFT A;  4EQ7 A;  3S9N C;  1ZBM A;  3G3F A;  4ZE9 A;  2I0B A;  4XXU A;  3IO4 A;  1BTJ A;  1POT A;  4FOR A;  4R6H A;  4DLD A;  3I6V A;  3H3G A;  1N3X A;  2O69 A;  3M3L A;  2PT1 A;  3OD7 A;  5AA2 D;  3MPL A;  5AA3 A;  1LCF A;  1MXX A;  2F5X A;  4IO2 A;  2QJE A;  3RN8 A;  3HPI A;  2NWJ A;  5I57 A;  3PPO A;  1LAH E;  3TOD A;  2DWA A;  3K6U A;  4JBZ A;  4G4P A;  4O3A A;  2VD3 A;  3FXQ A;  4X1D A;  1N76 A;  2XXP A;  4N07 A;  3PD8 A;  3TUS A;  3MZ9 A;  3KGC A;  3SES A;  5F1Q A;  3S9E A;  1FW0 A;  3K0V A;  5DEX B;  3QXM A;  3S2V A;  3MAM A;  4P0I A;  1HSE A;  4GXS B;  2ZNT A;  3ONM A;  1USY E;  4WED A;  4I62 A;  3EN3 A;  4H0W A;  1Y9U A;  3IR1 A;  2CZL A;  3KJT A;  2QMW A;  3OMB A;  4YKJ A;  3OO7 A;  2PBW A;  4ELP A;  3FGS A;  5KDT A;  1B7H A;  1DTG A;  2Y7R A;  1B0H A;  4GOT A;  1H76 A;  3RY3 A;  3G3G A;  3TQW A;  3EHS A;  4U1O A;  2O51 A;  4QSE A;  3IOW A;  3RTW B;  3TAJ A;  2RIN A;  3TMG A;  4F1V A;  3S9M C;  1M5D A;  3TTN A;  1MY3 A;  5CMK A;  4PET A;  3MVZ A;  2OWS A;  4F3B A;  1VFE A;  4RA1 A;  1B3L A;  1MY4 A;  2P0S A;  3K2D A;  1ANF A;  4JWY A;  3TFL A;  1Y3Q A;  3A3U A;  1EU8 A;  3K00 A;  4XIG Q;  4AB5 A;  4KI0 E;  1ZLQ A;  5ISU A;  3RLF E;  2DVZ A;  1FQF A;  2Q88 A;  4H1X A;  4QFP A;  2I3V A;  2FNC A;  3PU5 A;  1M5B A;  4OYV A;  1DTZ A;  1URG A;  1H44 A;  3G3K A;  3N5L A;  4LAT A;  3O6G A;  5H8H A;  3H6U A;  4DCY A;  2NOO A;  3OXN A;  3LSF B;  3Q25 A;  4ONY A;  4MH5 A;  4TOZ A;  4R6K A;  3H6V A;  4QSC A;  2ESN A;  4RPN A;  4RY1 A;  4Q5T A;  1PB9 A;  1SW2 A;  1B1H A;  2NXO A;  3IL1 B;  3PPQ A;  4XKN A;  3IJO B;  1SW1 A;  1LCT A;  3C9H A;  1H45 A;  1MQH A;  2Z8F A;  4GL8 A;  1OQG A;  1MH4 A;  1IXH A;  2D5W A;  3OEN A;  3OSR A;  3SEX A;  4OFJ A;  3CIJ A;  4GLI A;  4ZZA A;  2ONK E;  4RNS A;  3VDF A;  1LFH A;  1IUD A;  4THI A;  4ZEK A;  2ZYO A;  3TPA A;  4AB6 A;  3PUW E;  1PDA A;  1SI1 A;  2G93 A;  5H8F A;  5I58 B;  2VD2 A;  2UVJ A;  2XXW A;  3CFL A;  3ZKK A;  3I3V A;  2O1L A;  1S7Y A;  4DXU A;  5I2K A;  2HAV A;  3F11 A;  3IX1 A;  4DXC A;  5I56 B;  4YAH X;  3U93 A;  1A7L A;  4LP2 B;  4QRZ A;  4DIG A;  1D3K A;  4FIM A;  4OTE A;  4YB6 A;  2CMO A;  3TKD A;  1M5E A;  1XS5 A;  1BIY A;  2REG A;  1JVY A;  3LSL A;  1LGB C;  3MW0 A;  4LZ8 A;  4R74 A;  1II5 A;  1R6Z A;  4EXL A;  4F18 A;  2DXY A;  3O6H A;  1QUL A;  5IAI A;  4U2R A;  2RC7 A;  3CFZ A;  4OER A;  4KFQ A;  1M5F A;  4NTL A;  4IO3 A;  4QHQ A;  4DDD A;  3QAX A;  5AA4 A;  3DP8 A;  1A8F A;  2Q89 A;  3OSQ A;  2GHB A;  3KSX A;  5LOM A;  2V25 A;  2OLB A;  2Z8E A;  4IO4 A;  2V84 A;  2H98 A;  1I69 A;  1B3E A;  2DSF A;  4RYA A;  4F1Y A;  2HXW A;  3VLU A;  4ZDM A;  3IOR A;  1SYI A;  1O63 A;  3MZB A;  1B05 A;  4KD5 A;  3QUJ A;  4KR5 A;  4OWD A;  1FCK A;  1HSL A;  4RPO A;  5TP9 A;  5I59 B;  1AMF A;  2DWJ A;  1Y4C A;  1B51 A;  1JVX A;  3D4C A;  3IAZ A;  4GRK A;  3KN8 A;  1I6B A;  1D4N A;  4ZZE A;  1ELJ A;  3FV2 A;  3GBB A;  4I9D A;  3QYT A;  2H25 A;  3C32 A;  1Y4T A;  4NF6 B;  5B7D A;  4OEN A;  1JW1 A;  5DVJ A;  1B7U A;  1B58 A;  3MPK A;  1CB6 A;  5CRY A;  1GTK A;  3USD A;  1UIV A;  3W9V A;  1Q35 A;  1IQ7 A;  1N3W A;  1XHY A;  3CSB A;  1YTV A;  3DP6 A;  4FE8 A;  4GIZ A;  1JQF A;  4YKP A;  3MBP A;  1LFG A;  4OZ9 A;  3IOU A;  1MPB A;  4M1V A;  1YPN A;  5AA1 A;  1HSJ A;  1DSN A;  1VSO A;  2OCU A;  1DPP A;  3IJX B;  3TCH A;  1BLF A;  1ZKB A;  4NF6 A;  4IO7 A;  4NF5 B;  4H67 A;  4MBP A;  5A5X B;  1H3D A;  1JW5 A;  1XVX A;  2ZMB A;  1QKB A;  4NMY A;  3Q28 A;  2XXQ A;  1FQD A;  1S9T A;  3JYR A;  4P11 A;  5H8S A;  2VP1 A;  1TXF A;  3VVF A;  3TEP A;  1B3F A;  2Z22 A;  1TFD A;  4ZEB A;  4R9F A;  1SDX A;  5K2X A;  2M8C A;  4OEU A;  4LON B;  1YCJ A;  4PP0 A;  4X1B A;  1MS7 A;  5ELV A;  3VXB A;  3T9V A;  2DVC A;  3G3H A;  3FD3 A;  2QMX A;  4FEC A;  1QUI A;  5TU0 A;  1A99 A;  2Q8J A;  2UVG A;  1B5I A;  1OVT A;  4EDP A;  1MH3 A;  1Y1Z A;  2ONR A;  3OO9 A;  3FXR A;  4YKK A;  2IA4 A;  4IB2 A;  5DT6 A;  5AA2 B;  5DYH A;  3K6X A;  4NF8 B;  4H65 A;  3QIM A;  1IEJ A;  5CC2 A;  4YMA A;  2RF1 A;  2ZXT A;  3V8X B;  2H5Y A;  3C36 A;  3C4M A;  2PYY A;  4OQO A;  3PMV A;  4I8C A;  4F1U A;  1B9J A;  1OVB A;  2VGQ A;  1N0T A;  3OO8 A;  1URS A;  5I2K B;  2DP8 A;  2DE3 A;  2Q2C A;  2R6G E;  3O6I A;  4NF4 A;  3H6W A;  3N26 A;  2HAU A;  2XX9 A;  4G2Z A;  4WXJ A;  2Q9T A;  2ZNS A;  3TCG A;  4BDQ A;  3MJN A;  5CM6 A;  3SEY A;  1R1N A;  3A3C A;  3TTK A;  3G7W A;  3RNN A;  3N6T A;  5AA2 A;  2Y84 A;  3Q26 A;  3PPR A;  1TFA A;  1QUJ A;  2F34 A;  4QF9 A;  3E9X A;  3TYH A;  3U94 A;  1USY H;  3IB1 A;  4LQ2 A;  5JK4 A;  4XKP A;  2D3I A;  5ICT A;  3MVY A;  3E4R A;  3TQL A;  4BDO A;  1LLS A;  2W7Y A;  3E3K A;  3KBR A;  3PPN A;  1YAE A;  1WDN A;  2FA7 A;  4P0G A;  4YZZ A;  2DOJ A;  2Y7I A;  1UIU A;  4RK2 A;  2OBG A;  2P1S A;  1SI0 A;  2HFB A;  3PUX E;  2XHD A;  1MRP A;  3B6W A;  1JNF A;  3PD9 A;  5DVI A;  1WOD A;  4G8N A;  4WKM A;  1IIW A;  3K6W A;  1FTK A;  4JSO A;  1SQY A;  4JB7 A;  3L6H A;  1EZO A;  1RKM A;  3AXF A;  5CI5 A;  3TDJ A;  4GL0 A;  4HTG A;  4EXK A;  1JEV A;  3FJG A;  3OEL A;  1R9L A;  4KCD A;  2KLF A;  2RKM A;  1MPD A;  4H5F A;  1OIB A;  3JV9 A;  4YU0 A;  1D9V A;  4IGT A;  3P7I A;  2I3W A;  2F35 A;  4NWC A;  4Q0C A;  4EUO A;  1PB8 A;  4G77 A;  4NF8 A;  2Y7W A;  3GZG A;  1H43 A;  5KZT A;  3VE1 B;  2RC9 A;  3HHG A;  4FED A;  1B0L A;  3SER A;  4ELQ A;  3CFX A;  2I58 A;  4F39 A;  1B3G A;  2THI A;  2REJ A;  1NNK A;  4UA8 A;  2AL5 A;  4ISU A;  1EZ9 A;  4O3B A;  2Z23 A;  4HS7 A;  4YB7 A;  5FHN A;  4R72 A;  5I59 A;  4QFL A;  4F29 A;  2O7I A;  3CG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...