3EQ1A

The crystal structure of human porphobilinogen deaminase at 2.8a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
338
structure length
312
Chain Sequence
RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPQHEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structure of human porphobilinogen deaminase at 2.8 A: the molecular basis of acute intermittent porphyria
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 312
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3eq1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A02
2QMWA 4H1XA 1FTKA 5DTBA 2RCBA 4RPNA 3TUSA 3IR1A 4X9TA 2GHBA 4HTGA 2OJTA 3KOSA 3I5OA 2V84A 3DELB 2DVCA 1GV8A 3FGSA 3TTRA 2HQ0A 1MY3A 2REJA 2D3IA 3MUQA 3MPKA 1B7ZA 3TCHA 1I6AA 4QFNA 4YMBA 1LBBA 5KZTA 4FAJA 5ICQA 3SEYA 2AL4A 4EQBA 1NNPA 3UORA 2A5TA 1MG1A 3V8XB 2F97A 3IX1A 4G68C 1MRPA 1UQWA 4U1OA 4WKMA 1YAEA 1D9VA 4WEDA 3TZAA 4F19A 1SW2A 2XHDA 2GRVA 2I6EA 3DP8A 4ONYA 2UVJA 4G68B 4QFPA 3C4MA 4F2OA 3PUVE 3MPLA 1NH8A 1SW4A 2OWTA 2O7IA 1MXVA 3GZGA 3SEUA 2HAVA 1URDA 3OEMA 1M5CA 2ONKE 1IEJA 1R1NA 1N3WA 1A7LA 2AIXA 3MVWA 4LZ5A 3RTFB 3FVGA 3TYHA 4EUOA 3PMVA 1IXIA 1MPDA 4Q30B 3M8UA 3R7XA 4LUBA 2RKMA 4UA8A 2F36A 1PEBA 3OOAA 3K6UA 2I4CA 4NMYA 3QYTA 2FA7A 3OMBA 3PD9A 2I4BA 1GTKA 4F22A 1FTOA 4BDNA 5B70A 3TCFA 3RGYA 5AA4A 3Q29A 3V89B 4EQ9A 2XXPA 3PU5A 3U93A 4LZ8A 3IOWA 4JSOA 4Q5TA 3IORA 3FZVA 1AL3A 4M4GA 2DOJA 5AA2A 4ZZAA 1UIUA 1B32A 1LB8A 1MXUA 1BIYA 3ZSFA 2B3FA 2Q9TA 2QS2A 3MZ9A 3ZS6A 1S50A 3ODBA 2V3QA 2Z8EA 2M8CA 2Y7IA 1HSEA 4POXA 3DP6A 3PD8A 3P7IA 3D4GA 1MY0A 1H44A 5H8QA 1DTZA 2Y7WA 4XTCQ 2OWSA 3OSRA 1LAHE 2OBGA 3UIFA 3FUZA 2ZNSA 3V83A 3FXQA 5EHSA 3H6WA 4RNSA 1Y1ZA 1MM7A 3O6GA 4QSCA 4BDOA 4PP0A 4MF3A 3JYRA 4OFJA 4QFOA 3KJ7A 4NF5B 1ZJLA 2VP1A 5KCJB 5AE4A 3T9VA 1BKAA 5JTYA 4YU0A 4KR5A 5DVFA 5H8FA 3N94A 3K1PA 4C0RA 1MY2A 2QMXA 3TEPA 1XVXA 1XC1A 3L6HA 3OENA 1R9LA 3N26A 3PPNA 1MPBA 2ZXTA 1GVCA 2O51A 4F3SA 5CMMA 1Z7NE 5I56A 1Z7ME 5H8NB 2RC7A 4U4SA 4G8NA 1P1NA 1EZOA 5IKBA 1MQIA 1MXWA 4F1YA 4YB7A 1VSOA 3MVYA 1B58A 1URGA 1I69A 1KWHA 1JEUA 4OEUA 3QUFA 3VVEA 4NTLA 4EF2A 4ZECA 1ZIUA 2NXOA 4DCXA 5I84A 3M3FA 2F7CA 4R6HA 2XD3A 3FVOA 5CRYA 3KSJA 2VD2A 4Z0IA 1D9YA 2HXWA 5TP9A 2H9BA 3TMGA 4OVJA 4DXBA 4YAHX 1FQBA 3SKPA 2NVUB 2P1SA 4BDRA 2HEUA 2HZLA 2HFBA 5KDTB 1UTHA 5L9OA 4GL0A 4POWA 3W15C 1MQDA 3IB1A 1JW1A 1FTLA 1ZTYA 1M5FA 4G77A 3MWBA 1URSA 1USYE 1UIVA 4G8MA 2D5WA 3KN8A 4K3FA 5ITOA 2DE3A 2OLBA 5DEXA 3CR9A 2F6PA 3TQWA 3S9LC 4AB5A 4P11A 3TFLA 2O68A 4RJZA 4YKJA 4OMBA 1D3KA 4GXAA 4OETA 3S2VA 3U94A 2Y7RA 4EXLA 2HAUA 2XXYA 4OWDA 4JWOA 4MLQA 1B3GA 4NEDA 5TPAB 3U92A 4YKPA 2V25A 2V3UA 1NL5A 4MH5A 3AXFA 3FVKA 3S9EA 1CE2A 4YICA 3UP9A 4KD5A 2Q8JA 2ZNTA 3GBBA 4ZEBA 3S4UA 2B65A 1FQAA 4OERA 4ZE8A 3RLFE 2B3BA 3BFTA 3SDFA 5EYFA 3PUZE 5IAIA 4IO7A 4NF8A 1I6BA 1D4NA 1EU8A 1OQHA 4FATA 4I62A 4IO3A 2ANJA 3GBAA 4ELRA 1B52A 2FNCA 3S9NC 3CFLA 3MVZA 3MZBA 3G3GA 1Y3NA 4JWXA 3IK6B 5A5XA 3OSQA 4I9DA 4HCWA 1A40A 4IO5A 1B3HA 2D21A 4ISUA 5FHMA 3VLUA 3K1NA 3R26A 1DPPA 2I58A 2GH9A 2V93A 4KFQA 2H25A 3GXAA 4EDPA 5M2VA 1IXHA 2H99A 4Z7EA 4XKPA 1QULA 1SYHA 3EN3A 1FCKA 3K1MA 2V3TA 3TKDA 3QAXA 2DQVA 5I59A 2F6GA 3K0VA 5CMCA 2CMOA 1EH3A 3OELA 4JXIA 1SDXA 2F8DA 2XXTA 4H67A 2HZKA 4EQ7A 3K4UA 4IGTA 1A8FA 2UYEA 2X7PA 2ZMBA 4LZ7A 3KBRA 4JDFA 3R6UA 3MZ1A 4AQ4A 1QKBA 5I2NB 3IOVA 5BUUA 3QXMA 3LSWA 1FQFA 1OQGA 3KJTA 3OD7A 1Y3QA 4OTEA 5F1QA 1MH3A 1B1XA 4NF6B 1OLAA 3KEIA 4LP2B 1IXCA 1PC3A 1NNTA 1MQGA 3IOUA 4F1VA 1SD3A 1P1WA 3TTKA 3PPOA 1P1UA 1VR5A 3RN8A 4NE4A 4DZ1A 3E4RA 3H7MA 1MPCA 2VGQA 2Y84A 2F7BA 3U8QA 4GF8A 1IUDA 3MJNA 3I3VA 3DLNA 3RQTA 1LFHA 4U1ZA 1QUKA 3FVNA 4I1DA 3RT8A 4RK9A 2QJEA 5DVJA 1ZKBA 3U72A 2XX9A 1POY1 3FJMA 4PFUA 3M3KA 3B6WA 1JVYA 1SW5A 4FEDA 4GLIA 2BJJX 1SBPA 4X48A 4YB5A 1P1OA 1PB7A 1M5BA 1ANFA 4QF9A 2YPNA 3PPQA 5EHMA 4QSEA 1AOVA 3TQLA 4KPTA 4GVOA 4OENA 2R71A 1N04A 3EQ1A 1VE4A 1YCJA 3BBRA 1EZ9A 4X1DA 3K01A 2I0BA 2NUVA 3GLBA 4IO2A 4TLMB 4IO4A 4U22A 3RTWB 4KI0E 3FV2A 2Y7KA 5ICTA 1PBPA 5JK4A 1FQDA 4DXUA 1SVXB 2FYIA 4R72A 4ND9A 1A99A 4XKRA 3QIMA 3LR1A 3MW0A 1US4A 4PE5B 2QS3A 4YKIA 1B5HA 4XKNA 4IB2A 4HS7A 3SETA 5I58B 1TT1A 3HO7A 4BDQA 2DXRA 3PGFA 3N6UA 1DMBA 2RC9A 1JEVA 4GXSB 3KGCA 3SEVA 1H3DA 4ECFA 4JWYA 1N3XA 1AMFA 1MXXA 3FXRA 5CBRA 1SQYA 3G3KA 4OHNA 4WXJA 1N7WA 1ZMGA 2QSXA 4R2FA 2O1LA 4G2ZA 2F7AA 3LSXA 2REGA 1NNFA 4R2BA 3FASA 1UTBA 2A5SA 2HCAA 3CVGA 2G93A 2ALUA 2XXWA 2ONRA 4OXVA 1LLSA 1QJMA 4KQPA 5AA1A 4ESXA 3C33A 1B3EA 1MDQA 4DDDA 1OVBA 1IXGA 2W7YA 2X26A 3FXUA 5TPAA 2XXHA 3MC2A 2UVIA 1DSNA 3USDA 2DWIA 1T0KA 4ZEIA 4KYSA 4TQUQ 1B40A 2G29A 4FECA 5H8HA 3ILTB 5L9MA 1FQEA 4GQOA 2UVHA 1RKMA 2PBWA 1TFDA 2PVUA 3EHSA 3KZGA 4LQ5A 3CG3A 5TU0A 3HHGA 3A3UA 4KHZE 4DE8A 3ECRA 2IEEA 2I3WA 2R6GE 1LBCA 3LBSA 3HPIA 2ABHA 4NF4A 1B05A 2XX8A 1A8EA 3V5AA 1B3LA 5I2KB 3VDFA 1LSTA 2ONSA 2PX1A 2DWAA 1OVTA 3KFMA 2O1MA 3CSGA 4XKQA 1H45A 4IY6A 1M5EA 3PMWA 5DVIA 4FIMA 3UN6A 3EPEA 4EF1A 4P0GA 4N6PA 5AA4B 1QW0A 4DLDA 3UGWA 3CFZA 3DM0A 2UVGA 4F1UA 4RA1A 1GR2A 4ZEFA 3ZKKA 3TAJA 5AA3A 2XXRA 4ZEKA 2I3VA 4LQ2A 4QHQA 2Y7PA 2E1SA 4PFWA 4BDMA 5AA2B 1ZU0A 1A55A 2P2AA 1QUIA 3RY3A 3OEKA 1ATGA 4ZEDA 1DOTA 1QUJA 4GFRA 4R73A 3A3CA 1F9BA 4X1BA 3G3JA 4QFLA 1B5IA 4RY1A 3E9XA 5H8QB 3O97A 3HSTA 3CFXA 3MAMA 1TFAA 4F2QA 3TCGA 1AIVA 2DVZA 5I2NA 5K2YA 5FTHA 4FJPA 5ITPA 1QKAA 1B4HA 2DWJA 1MXYA 1Y4CA 2VHAA 1XHYA 3B6TA 1I6QA 4YKKA 4BDLA 4R9FA 2YLNA 3ZKLA 3LC8A 3W9WA 2KLFA 1B51A 3MP6A 2OZZA 1NMUA 3WAEA 3K02A 2I49A 4U4XA 1O63A 3K6XA 1WVJA 3UA8A 2VOZA 1IIWA 1NH7A 1VFEA 4JSDA 1B46A 3TDJA 5J1DA 4QRZA 3TPAA 5H8FB 4F29A 4KYDA 2H98A 2RINA 1XOCA 3G3FA 3H4ZA 2XXQA 1H76A 4G68A 1JQFA 3Q28A 3VFJA 3PUYE 2WKYA 3IB2A 5CI5A 5I56B 1NKXA 4G8HA 2Z22A 2I0CA 5K2XA 2NWJA 4OFOA 1LCFA 1O64A 2OK2A 3L6GA 4R6KA 4LVQA 1HSJA 4R74A 4XXUA 3CSBA 3TTLA 2DSFA 5CMBA 3T9UA 3RNNA 2F35A 4PFTA 5JEIA 4U23A 2XD2A 3OO7A 3VLVA 4PQJA 3EF7A 2X7QA 3T93B 1OIBA 5H8SA 1Y3PA 2Z8FA 1Y20A 3PPRA 3KN7A 4C1TA 1PBQA 2DE2A 1O7TA 1LGBC 5DT6A 1BLFA 4JBZA 5TP9B 2GHAA 1EZPA 2Z23A 2DE4A 4QFKA 2F78A 1VFDA 3C32A 3VLWA 1ZLQA 1MM6A 4GIZA 2RC8A 3H3GA 1Y1MA 2PYYA 3LSFB 1UTHB 3T66A 4F31B 2PT2A 1MXZA 1B7UA 4F3GA 4UACA 2F5XA 1XVYA 2DP8A 2QS4A 3B6QA 3BFUA 3PUWE 5AA2D 4U21A 1FTMA 3RUMA 5F7VA 4GOTA 4H6DA 1BTJA 3H03A 5DEXB 2O6AA 4FE8A 4MLVA 2GFEA 3H06B 4H5FA 4GWOA 3K6WA 3T9HB 3K6VA 3PMXA 3IJXB 1B0LA 2H4IA 3O28A 3SEXA 2CZLA 3EHTA 3UK4A 1A54A 1B6HA 4FEBA 4H65A 1LFGA 1B3FA 4RYAA 4LATA 5HPQA 3FJGA 3ONMA 2PT1A 1LAFE 3VXBA 1B9JA 1QVSA 2UXAA 1PDAA 2XXIA 3PPPA 4P0IA 2QRYA 5CC2A 4Q0CA 1ZBMA 1Q35A 4NF5A 2DS9A 5FTIA 5KCJA 4KYEA 3IL1B 4OESA 2Q89A 1WDNA 3SESA 2QPQA 1P1QA 3M3LA 4F18A 3N5LA 4NF8B 3VE1B 3U1OA 1XT8A 4ELPA 1N7XA 4KCCA 5I57B 4DIGA 1MDP1 1AH5A 2ZYMA 1JW5A 5H8NA 4WEPA 4DXCA 3O29A 5A5XB 1OLCA 2Q2AA 1B7HA 4IY5A 2DXYA 5I2KA 3LUYA 1TXFA 1Y4TA 3WAFA 4ESWA 4OZ9A 4F39A 4YZZA 3BKIB 2ZYNA 3HN0A 3CI8A 2R9JA 2VD3A 4N07A 1XS5A 3Q25A 2NOOA 4MBPA 3CIJA 3KOTA 4AB6A 5I59B 3S9MC 1S7YA 2RCAA 3O6IA 3E3KA 3TELA 1J1NA 2UYFA 5KDTA 3VVFA 3IB0A 4O3BA 3SERA 4EXKA 4IO6A 3RPWA 1RYOA 4ZZEA 3Q27A 1LFIA 2RF1A 3FV1A 4OYVA 4R6YA 3O66A 1IZ1A 1FW0A 4IGRA 5FHOA 2F34A 2ZYKA 3OO9A 3VV5A 1LAXA 3D4CA 1YTVA 3PUXE 4R9GA 1MY1A 1USYH 3O6HA 3OXNA 3LSLA 3SEWA 3A09A 4YB6A 1IQ7A 2A5TB 1Q1KA 3EHUA 1SYIA 3H6TA 3IJOB 5CBSA 1RYXA 4M1VA 3TTMA 1US5A 3C34A 5CM6A 3O9PA 4C1UA 2Z8DA 3JZJA 4O3CA 2LAOA 3C35A 4OFLA 1ELJA 4Q8RA 4F3PA 1MS7A 3KN3A 3DP4A 3HCQA 3E13X 1FTJA 1OMPA 4ELOA 4THIA 4TLLB 3IO6A 2H5YA 3T96B 4BLAA 2YJPA 3I6VA 5ISUA 3QSLA 1JNFA 3C31A 3G7WA 5B7DA 2Q2CA 1MH4A 1YPNA 3OO8A 1LB9A 4R75A 4H0WA 3T22A 4QSDA 2PMSA 3H6VA 3TODA 1S9TA 3G3IA 1B0HA 1MQHA 1NFTA 5HBCA 3HHFA 3W9VA 4TOZA 1HSLA 4I8CA 1LAGE 2XX7A 1POTA 2QL3A 1B2HA 2THIA 4U2RA 3KG2A 4L17A 1JVXA 3RT6B 4LONB 3ILUB 1B4ZA 5CMKA 4H5GA 4DCYA 1H43A 2O7UA 2Q88A 3K2DA 5HM4B 1BP5A 3JV9A 1Y9UA 3IAZA 1LCTA 1TWYA 4GL8A 3MP1A 3N6TA 2AL5A 4N13A 2IA4A 1B1HA 2I48A 1JW4A 3C36A 4G4PA 5FHNA 4ZS9A 4GRKA 4KCDA 1FQCA 4YMAA 2O69A 3IO4A 4FORA 4HCYA 3KSXA 1UTBB 3MQ9A 4NF6A 1DTGA 2OCUA 5L8DA 4NWDA 1GGGA 1SW1A 5BWJA 4OQOA 3CG1A 3FD3A 3T9XB 2XXUA 4RXLA 1JETA 1N0TA 3PV0E 1PB8A 2DWHA 4H8JA 1MQJA 4NWCA 5JTYB 4MFIA 3THIA 5L9SA 2AYSA 4E0XA 1DPEA 2QS1A 4LA9A 1WODA 4RPOA 4ELQA 2ESNA 3MBPA 1PB9A 5DYHA 3MP8A 1B5JA 1SI0A 3QK6A 1SI1A 3IOTA 5H8HB 4E0WA 2O84X 4JB7A 2P0SA 3F11A 3TTNA 3QUJA 4HW8A 1N84A 2XXXA 1MY4A 3FATA 1L5TA 3Q26A 5I57A 4GD5A 4PFYA 3C9HA 3B7DA 3FIRA 4NF4B 5ELVA 1P99A 2ZYOA 4OEVA 4H8IA 3VXCA 1R9QA 1IITA 3G3HA 4XIGQ 4O3AA 3K00A 4ZE9A 1R6ZA 3O2AA 3MVXA 3OO6A 3FJ7A 4F3BA 1CB6A 2XXVA 4ZDMA 3H6UA 3CRBA 3HV1A 1N76A 3VVDA 4RK2A 1NNKA 2ZNUA 4PETA 2DYXA 5I58A 1II5A 5LOMA 1M5DA 2E0SA
chains in the Genus database with same CATH superfamily
1N33E 2QMWA 2LT7A 4DMIA 4H1XA 1K9ZA 1FTKA 2Q74A 5DTBA 2RCBA 4RPNA 3TUSA 3IR1A 4X9TA 4TUGA 4P47A 4R2DA 4PAKA 2GHBA 2M1SA 4HTGA 3C4BA 2OJTA 2WYKA 3KOSA 3I5OA 2V84A 4BHBA 3KBZA 4YY3E 3DELB 2B7TA 2DVCA 1GV8A 3FGSA 1N3GA 5KL3A 4M9VC 3TTRA 2HQ0A 1MY3A 1FBPA 2V83A 2REJA 2D3IA 2B4LA 3MUQA 3MPKA 2UXDE 1B7ZA 2KONA 3TCHA 1I6AA 1XMQE 4QFNA 4YMBA 3KZZA 1LBBA 5KZTA 4FAJA 5ICQA 3SEYA 2AL4A 4EQBA 1NNPA 5KL2A 2A5TA 1MG1A 3UORA 2F97A 3V8XB 3IX1A 4G68C 1ZR9A 1MRPA 1UQWA 2YU5A 4U1OA 3E78A 1TF3A 2Q8MA 2L92A 1NEIA 2J7JA 5A6AA 4WKMA 1YAEA 1D9VA 2N8XA 4WEDA 4BC9A 1X6EA 3TZAA 4F19A 1SW2A 2XHDA 2GRVA 1J26A 4NHRA 2I6EA 2HHHE 3DP8A 4ONYA 3T1HE 2EM6A 2UVJA 4G68B 4QFPA 4R2AA 3C4MA 4F2OA 3PUVE 3MPLA 1NH8A 1SW4A 2OWTA 2NUFA 2HJJA 2O7IA 4JVIA 1DCUA 4DV6E 1MXVA 4L5NC 3GZGA 3SEUA 2HAVA 3J7Yp 2YTEA 1URDA 1X49A 3OEMA 4QBAA 1M5CA 2ONKE 2Q8UA 1IEJA 1R1NA 1N3WA 4PC9A 3QG5C 1A7LA 2AIXA 4N4UA 3MVWA 4LZ5A 3RTFB 1RQ0A 3FVGA 3TYHA 2LRSA 3J7AG 2YTQA 4EUOA 3PMVA 1KA1A 1IXIA 1MPDA 4Q30B 3M8UA 1HNZE 3R7XA 4LUBA 4UABA 1G2FC 2RKMA 1TN9A 4P7DA 4UA8A 2F36A 2LCEA 1PEBA 3OOAA 5IT9C 2P3NA 3K6UA 1YYOA 2I4CA 4NMYA 3QYTA 5A6BA 4N81A 2FA7A 2L2KB 1NV5A 4PF6A 3OMBA 1X6FA 3PD9A 2I4BA 4F54A 3LMLA 3EKIA 2EPCA 1GTKA 2Y5LA 1FTOA 2EOSA 2MC6A 4BDNA 4F22A 4NG7A 5B70A 5IM2A 3TCFA 5AC5A 3RGYA 5AA4A 3Q29A 4J8ZA 3V89B 4EQ9A 1NV6A 3RMPA 2XXPA 3PU5A 3U93A 4LZ8A 4N6KA 3IOWA 4JSOA 4Q5TA 3ADIA 1O0WA 1T39A 3IORA 3FZVA 1AL3A 4M4GA 2YSOA 2DOJA 2UU9E 5AA2A 4ZZAA 1UIUA 1N34E 1B32A 1LB8A 1JP4A 4O7IA 1MXUA 2MKZA 1BIYA 4MNIA 3ZSFA 1X5WA 4XEQA 2BBGA 2B3FA 2Q9TA 2QS2A 3MZ9A 3ZS6A 1S50A 3ODBA 2V3QA 2Z8EA 2M8CA 2EMFA 2Y7IA 2M4IA 1HSEA 4POXA 3DP6A 3PD8A 3MHSC 3P7IA 2E5LE 3D4GA 1MY0A 1H44A 5BR8E 5H8QA 4ZYEA 2DRPA 1DTZA 2Y7WA 5EQ8A 5IZ1A 3T0JA 4GZNC 1TF6A 4XTCQ 2YTIA 1EH8A 2OWSA 2DIXA 3OSRA 1LAHE 2OBGA 3UIFA 4R2EA 2V85A 3FUZA 2ZNSA 2EPPA 2BB8A 3V83A 3FXQA 4X9JA 2EMKA 3T1BA 5EHSA 3H6WA 1YFHA 4RNSA 4KWYA 3ADJA 1Y1ZA 1MM7A 3O6GA 4QSCA 4B3ME 2YTNA 4BDOA 2NUEA 4PP0A 4MF3A 1HR0E 3JYRA 3AUZA 4OFJA 4QFOA 2KQZA 2R1FA 2XXKA 3KJ7A 4NF5B 1ZJLA 2VP1A 4OVQA 5KCJB 5AE4A 3T9VA 1BKAA 5JTYA 2FIEA 4YU0A 4KR5A 5DVFA 3HFUA 3C6KA 5H8FA 1KA0A 3N94A 3K1PA 3ADLA 4C0RA 1MY2A 2QMXA 3TEPA 5ET8A 2EN8A 1XVXA 1XC1A 3L6HA 3OENA 3KWRA 1FBGA 1R9LA 4DV7E 4DV0E 2F3DA 3N26A 3PPNA 1MPBA 2ZXTA 1GVCA 2N3HA 2O51A 4F3SA 2YTJA 5CMMA 1Z7NE 5I56A 1Z7ME 4PDHA 5H8NB 4MNCA 2RC7A 1IBLE 3J81C 4IJDA 4G8NA 4U4SA 1P1NA 4OVTA 3THNA 2FTXB 1EZOA 1NV1A 5IKBA 4DV1E 2DB2A 1RDYA 1MQIA 1A1FA 1MXWA 5IV8B 4F1YA 4YB7A 1VSOA 2FIXA 3MVYA 4WSPA 1B58A 1URGA 2JJKA 4PGNA 2HPGA 3IWDA 4HE2A 2JOXA 1I69A 1KWHA 1JEUA 4OEUA 2L8TA 3QUFA 3VVEA 4NX1A 3QMFA 4NTLA 2WEFA 5LTCA 4P1LA 4EF2A 1IMAA 3THOB 4OVSA 4ZECA 1ZIUA 2NXOA 4DCXA 5I84A 3M3FA 3F6HA 4P8BA 4I8OA 2F7CA 4R6HA 5T3JA 2EMWA 2XD3A 2JYAA 4FBPA 3FVOA 2VRDA 5CRYA 3KSJA 4HEIA 2VD2A 1J5EE 4Z0IA 1D9YA 2HXWA 5TP9A 2H9BA 3TMGA 2ENHA 4OVJA 3ADGA 4DXBA 3LLHA 4YAHX 1FQBA 3SKPA 2NVUB 2JOBA 2P1SA 4BDRA 1N36E 2EOOA 3LUZA 4MEVA 2HEUA 2HZLA 2HFBA 4LN5A 5KDTB 1UTHA 2WCC3 5L9OA 4WX9A 4F9BB 1YYZA 2WZOA 4GL0A 3JU0A 4POWA 5KL6A 2JPAA 2FBPA 3W15C 1MQDA 4NF0A 3IB1A 1JW1A 1FTLA 2EN1A 1ZTYA 1M5FA 4G77A 3MWBA 1URSA 1USYE 2EORA 2ZZXA 1UIVA 4JI8E 4G8MA 2D5WA 3KN8A 4K3FA 5ITOA 2DE3A 2OLBA 5DEXA 3VYYA 1YZ9A 5I3SA 3CR9A 5IZ3A 5EQAA 3HQ1A 2F6PA 4R2CA 2VT5A 3TQWA 3S9LC 4AB5A 4P11A 2VE7C 3C6MA 1PJSA 4DR3E 3TFLA 3T1YE 2O68A 3EPJA 4RJZA 2EMYA 4YKJA 4OMBA 1IQSA 1D3KA 4GXAA 1WHQA 4OETA 3S2VA 1RMDA 2WBDA 3U94A 2EOJA 2Y7RA 3FXBA 1VDWA 4EXLA 5AE2A 4FK5C 2HAUA 2XXYA 4OWDA 2YSPA 4JWOA 2UUBE 1DI2A 4MLQA 1B3GA 2JP9A 4NEDA 5TPAB 3U92A 4YKPA 2V25A 2V3UA 2VQEE 1NL5A 2LE2A 4MH5A 2XWKA 3AXFA 3FVKA 3S9EA 2L3CA 1CE2A 4NQ8A 4YICA 3UP9A 4KD5A 2Q8JA 2R8TA 2ZNTA 3GBBA 4H46A 4ZEBA 3S4UA 2B65A 1KYQA 1FQAA 1FKAE 1STUA 5TSEA 2M9AA 4OERA 4ZE8A 3RLFE 2B3BA 3BFTA 3SDFA 2I13A 5EYFA 3PUZE 5IAIA 4IO7A 2F8BA 4NF8A 2CTDA 2EN2A 4RHBB 4BHCA 1I6BA 3CHGA 1D4NA 4GEQB 1UBDC 1EU8A 1OQHA 4FATA 4BCAA 3HTXA 4I62A 4IO3A 2ANJA 3GBAA 4MJOA 2RS6A 4ELRA 1B52A 5ET7A 1IMEA 2FNCA 3S9NC 5A69A 3CFLA 3MVZA 3MZBA 5AC4A 3G3GA 1Y3NA 4JWXA 3IK6B 5A5XA 2EM4A 1A1LA 3OSQA 3JTZA 4HCWA 4I9DA 3BBGA 5ADZA 1A40A 4IO5A 1B3HA 2D21A 1FPEA 4ISUA 5FHMA 3VLUA 3K1NA 1XMOE 3R26A 3VHTB 1DPPA 2I58A 2GH9A 3EPHA 2V93A 4KFQA 5A6KA 2H25A 2MDRA 2YTGA 1WRJA 3GXAA 2HHMA 4EDPA 4PBHA 5M2VA 1IXHA 1IMFA 3KC0A 2EMBA 2LUPB 1NI9A 1YYKA 2H99A 4XKPA 1QULA 4Z7EA 1SYHA 3EN3A 1FCKA 2FGGA 3K1MA 2V3TA 4G61A 2F3BA 3TKDA 4GKKE 5LLQA 3QAXA 2DQVA 5I59A 4GWYA 1RDXA 2F6GA 3K0VA 3C4TA 2L33A 5CMCA 2CMOA 1UN6B 2NABA 2LO3A 1EH3A 3OELA 4JXIA 1SDXA 2F8DA 2XXTA 4H67A 2HZKA 4EQ7A 2ENAA 1FPFA 3K4UA 2K4VA 4IGTA 1A8FA 2UYEA 2X7PA 2ZMBA 4LZ7A 3KBRA 2EQ1A 4AS5A 4JDFA 3R6UA 3MZ1A 4AQ4A 2EP3A 1QKBA 5I2NB 3IOVA 1WJPA 4IS1C 5BUUA 3QXMA 3LSWA 2RTXA 1FQFA 4PTKA 5T6JA 1OQGA 1A1IA 3KJTA 1LBYA 3OD7A 1Y3QA 4OTEA 2JY9A 5F1QA 1KZ8A 1MH3A 3K6QA 4JV5E 1B1XA 4NF6B 1OLAA 3KEIA 4LP2B 1IXCA 1A1JA 1PC3A 1MGTA 1NNTA 4JYAE 1MQGA 3IOUA 4F1VA 3UK3C 1SD3A 1P1WA 2QFLA 3DF6A 3TTKA 3PPOA 1P1UA 1VR5A 3RN8A 4NE4A 4P78A 2P3VA 1YXIA 4DZ1A 3M99B 3E4RA 3H7MA 1MPCA 2DDKA 2VGQA 2Y84A 2JXPA 2B7VA 2V86A 2F7BA 3U8QA 4GF8A 1IUDA 3MJNA 3I3VA 3DLNA 3RQTA 4OA4A 1LFHA 4U1ZA 1YSAC 4OX9E 1QUKA 2L5VA 3FVNA 2QVUA 4I1DA 1FPLA 3RT8A 2CSHA 4RK9A 2I9IA 3VK6A 2QJEA 2M7QA 5A5LA 5DVJA 1ZKBA 5CFFE 3U72A 2LUQA 1L4SA 2XX9A 1POY1 3FJMA 2RPCA 1Z1BA 3M3KA 4MCOA 4PFUA 3B6WA 3MHHC 1JVYA 1SW5A 4FEDA 4GLIA 1BK4A 2BJJX 1SBPA 4X48A 4YB5A 1P1OA 1PB7A 1M5BA 1ANFA 4QF9A 2YPNA 4I3EA 3PPQA 5EHMA 4QSEA 1AOVA 3TQLA 4P56A 4TUIA 4KPTA 4GVOA 4OENA 2R71A 1N04A 3EQ1A 1VE4A 1YCJA 3BBRA 1A1GA 1EZ9A 1NUXA 4X1DA 1K9YA 3K01A 2I0BA 2NUVA 3GLBA 4IO2A 4TLMB 4IO4A 4U22A 3RTWB 4DV3E 4KI0E 3FIGA 3FV2A 5DNYA 4JI7E 4ZYGA 1ZAAC 2GPIA 2Y7KA 4Q35B 2MKNA 5ICTA 1PBPA 2NA2A 4PAIA 5JK4A 1FQDA 3IFCA 4DXUA 1SVXB 4GWXA 2FYIA 4R72A 1CNQA 4ND9A 1EH6A 1A99A 4XKRA 3QIMA 5KL4A 3LR1A 4O4KA 3MW0A 1US4A 4N4RB 4PE5B 2QS3A 4YKIA 1B5HA 4XKNA 1FPKA 4IB2A 4HS7A 3SETA 5I58B 1TT1A 3HO7A 4BDQA 4NXNE 4I3YA 2DXRA 1X47A 3PGFA 3N6UA 1DMBA 2RC9A 2D9HA 2EOXA 2LTRA 1JEVA 4P9KA 4GXSB 3KGCA 3SEVA 1FJ9A 1H3DA 3ROJA 4ECFA 4WXCA 4JWYA 2KR0A 1QNTA 1N3XA 1QGXA 1AMFA 1MXXA 3FXRA 5CBRA 1SQYA 2FV4B 2V87A 3G3KA 4OHNA 4WXJA 1N7WA 1ZMGA 1N32E 2QSXA 4R2FA 2O1LA 4G2ZA 1ZBTA 2F7AA 3LSXA 1T4LB 5LL6R 2REGA 1T4NA 1NNFA 4R2BA 1FPIA 4WPYA 5EQ7A 3FASA 1UTBA 2A5SA 2LVHA 2HCAA 3CVGA 2YTFA 2UUCE 4PBQA 2EN7A 2G93A 2ALUA 4R2RA 2WBSA 2XXWA 5IXMB 2ONRA 2V4CA 5AASA 4OXVA 1LLSA 2EPKX 1QJMA 4KQPA 5AA1A 4ESXA 3C33A 1B3EA 3EPKA 2HC5A 2BJIA 4DR1E 1MDQA 4DDDA 1OVBA 1IXGA 2EOMA 2EPLX 1NUZA 4LF5E 1Q9DA 1IMBA 2W7YA 2X26A 3FXUA 4HE0A 5TPAA 2LTSA 2XXHA 4DV5E 3MC2A 2UVIA 1DSNA 3USDA 2DWIA 1T0KA 2YTPA 4ZEIA 4KYSA 4TQUQ 4DR6E 1B40A 2G29A 4FECA 2JR1A 5H8HA 3ILTB 2XWVA 5L9MA 2ELZA 1FQEA 4GQOA 2YWQA 2UVHA 1RKMA 2PBWA 1TFDA 2PVUA 2ZZWA 3EHSA 3KZGA 4LQ5A 3CG3A 2H36X 5TU0A 3HHGA 3MYUA 3A3UA 4KHZE 4DR2E 4F6MA 1XI6A 3A29A 4NXME 2QVVA 4DE8A 4O7MA 2R76A 3ECRA 2IEEA 2I3WA 2R6GE 2FVZA 1LBCA 2CZIA 4LFBE 3LBSA 3HPIA 2EQ3A 1XNQE 2ABHA 2K7IA 4NF4A 4JI4E 2EM2A 1B05A 2XX8A 3OMLA 1NV7A 2EL4A 1A8EA 3V5AA 1B3LA 5I2KB 2RS7A 3VDFA 1ZBQA 2UXBE 1LSTA 2KHXA 2ONSA 2PX1A 2MKDA 2L3JA 2DWAA 2DSYA 1OVTA 3KFMA 2O1MA 3CSGA 4XKQA 1H45A 2JWOA 4IY6A 1M5EA 2EL5A 1UHZA 1NV3A 5FBPA 2CT1A 1ZU1A 1EH7A 2EM8A 3PMWA 5DVIA 4FIMA 3UN6A 3EPEA 4EF1A 4P0GA 4N6PA 5AA4B 1QW0A 2DGCA 4LFAE 4DLDA 1IMCA 2PRTA 1NUYA 3UGWA 3CFZA 3DM0A 2UVGA 4F1UA 4RA1A 1GR2A 4ZEFA 3ZKKA 3TAJA 5AA3A 2XXRA 4ZEKA 2EMIA 4HE1A 2I3VA 4JVCA 2HXRA 4LQ2A 4NGUA 4QHQA 2Y7PA 2E1SA 4PFWA 4BDMA 5AA2B 5LDZA 1ZU0A 3RPLA 1A55A 2GLIA 2EJ4A 1FBDA 2RSIA 2P2AA 4K0KE 1QUIA 2FHYA 3RY3A 4MAGA 3OEKA 1ATGA 4ZEDA 1DOTA 2EN6A 1QUJA 4GFRA 4R73A 3A3CA 1GZ6A 4LF9E 1F9BA 4X1BA 3G3JA 4QFLA 2HGHA 1B5IA 4RY1A 4R2SA 2YU8A 4N15A 3E9XA 1IMUA 1FTAA 1G0HA 5H8QB 4JVDA 3PTYA 3BGHA 3O97A 3HSTA 4NN3A 3CFXA 3MAMA 3HPSA 1TFAA 4F2QA 3TCGA 5I7IA 1AIVA 2DVZA 5I2NA 1EYIA 5K2YA 5FTHA 4FJPA 1FPDA 5ITPA 1QKAA 1B4HA 2V88A 2DWJA 2EPZA 2EOFA 5EYHA 4R8OA 1MXYA 1Y4CA 5EYGA 1FJGE 2VHAA 1XHYA 3B6TA 1I6QA 4YKKA 1I94E 2ELYA 1AWBA 4BDLA 4R9FA 3EPLA 2YLNA 1G2DC 3ZKLA 3LC8A 3W9WA 2KLFA 1B51A 3MP6A 2OZZA 1NMUA 2EM3A 2WBTA 3WAEA 3K02A 2I49A 4U4XA 1BBOA 1O63A 3K6XA 1DGCA 1WVJA 3UA8A 2YTDA 2VOZA 1IIWA 1NH7A 1VFEA 4MHFA 4JSDA 1B46A 3TDJA 5J1DA 3ISPA 1KJKA 4QRZA 3TPAA 5H8FB 4F29A 2XWOA 4KYDA 4R2PA 4B3TE 4PFRA 2H98A 5ET5A 2L6MA 2RINA 1XOCA 3G3FA 3H4ZA 2EOYA 2XXQA 1H76A 4G68A 1JQFA 2CPNA 3Q28A 3VFJA 2GQ1A 3PUYE 2WKYA 1LLMC 2EE8A 2IHR1 4P1EA 3IB2A 5CI5A 5I56B 4X66E 1NKXA 2EPOA 4G8HA 2Z22A 2I0CA 4GX4A 5K2XA 2NWJA 4OFOA 2MDGA 1LCFA 1O64A 2EPRA 2OK2A 3L6GA 4R6KA 2RSMA 4LVQA 4N6DA 1D9QA 4BMJA 1HSJA 4R74A 4XXUA 3CSBA 2WX9A 4B3SE 3TTLA 4MMPA 2DSFA 5CMBA 2EMXA 3T9UA 3RNNA 2F35A 4PFTA 5JEIA 4U23A 1X48A 4JI2E 2XD2A 3OO7A 3VLVA 4PQJA 3EF7A 2X7QA 3T93B 1OIBA 5H8SA 4LTYA 3ZOQB 1Y3PA 2Z8FA 1Y20A 3PPRA 3KN7A 3DJWA 4C1TA 1PBQA 1A1KA 2DE2A 1JK2A 1O7TA 1LGBC 2PFYA 1BLFA 2EMHA 4JBZA 5DT6A 4KZSA 2YTOA 2GHAA 5TP9B 1EZPA 4M0VA 2Z23A 2DE4A 4QFKA 4GKJE 2F78A 1IQOA 1VFDA 3C32A 3VLWA 4X64E 4JI0E 1ZLQA 1MM6A 3IWBA 4GIZA 2RC8A 3H3GA 3MSTA 1NV2A 1Y1MA 2G7HA 2EL6A 2PYYA 3LSFB 2DMYA 1UTHB 4PFBA 3T66A 4F31B 2PT2A 2ENCA 1RC7A 1MXZA 1B7UA 4F3GA 4DV4E 4UACA 2F5XA 1XVYA 2DP8A 4NAPA 2L2NA 2QS4A 3B6QA 3BFUA 3PUWE 1DQ3A 4DV2E 2EOHA 1JK1A 5AA2D 4U21A 1UILA 1FTMA 4DUZE 3RUMA 2EOZA 2OX3A 4PGPA 4BC7A 5F7VA 4GOTA 2EM9A 4H6DA 1FBFA 2ZM6E 1BTJA 4JI5E 3H03A 5DEXB 2O6AA 5IZ3B 4FE8A 4WYQB 4MLVA 1FBHA 2GFEA 3H06B 4H5FA 4GWOA 4L8NA 4XF5A 3K6WA 4Q28A 4OVRA 3T9HB 3K6VA 3PMXA 2GHFA 2RQLA 2B9DA 3IJXB 1B0LA 2H4IA 3BF2A 3SZPA 2UUAE 3O28A 3SEXA 2CZLA 3EHTA 3UK4A 4B3RE 5A2QC 5IZZA 1A54A 1B6HA 4X04A 2EQ0A 4FEBA 4H65A 1LFGA 1B3FA 4RYAA 1X6HA 4LATA 5HPQA 3FJGA 3ONMA 2PT1A 1LAFE 3VXBA 1B9JA 1QVSA 2UXAA 1PDAA 2XXIA 3PPPA 3AV0A 4P0IA 2QRYA 4DR4E 5CC2A 4Q0CA 1FBCA 1ZBMA 2ADRA 4F9AB 1Q35A 2EN3A 4NF5A 2DS9A 5FTIA 5KCJA 4KYEA 3IL1B 4OESA 2Q89A 4PCDA 4PDDA 3J80C 1WDNA 1F2IG 2LJUA 3SESA 3RYDA 2QPQA 1P1QA 3M3LA 4F18A 3N5LA 4NF8B 3VE1B 2L2MA 1FBEA 3U1OA 1XT8A 4ELPA 1LBVA 3L00A 1N7XA 5J16A 4KCCA 1RDZA 4GWWA 4N91A 5I57B 1YZ0A 3MSWA 4DIGA 1MDP1 1AH5A 2ZYMA 1JW5A 5H8NA 2DLKA 1IBKE 4WEPA 1LBWA 4PE3A 3F6GA 4DXCA 3O29A 2EM5A 3JAMC 5A5XB 1BB8A 4DKKA 1OLCA 2Q2AA 1B7HA 4PAFA 4IY5A 1SR9A 3P1XA 1LBZA 4LFCE 4X62E 2DXYA 2F4VE 5I2KA 3LUYA 1TXFA 1Y4TA 2ODRC 3WAFA 4ESWA 4MX6A 4OZ9A 4F39A 4RH8A 2EOQA 4YZZA 3BKIB 3LV0A 4AS4A 1WXRA 1SPIA 2MC5A 2ZYNA 1EYKA 3HN0A 3CI8A 2R9JA 2VD3A 4GWUA 4N07A 3IFAA 1XS5A 3Q25A 2NOOA 4MBPA 2EPMX 3CIJA 4MNPA 3KOTA 4AB6A 5I59B 3TQMA 2QVRA 3S9MC 2JVAA 4PF8A 2DMIA 1S7YA 2RCAA 4MIJA 3O6IA 4X8RA 1WHNA 3E3KA 3TELA 1EKZA 4YHHE 1J1NA 2YRMA 2UYFA 3VYXA 5KDTA 3VVFA 3BIHA 5F3WA 1XNRE 4X65E 2B3TB 3IB0A 1FJ6A 4O3BA 3SERA 4EXKA 4IO6A 3RPWA 2EMCA 1RYOA 4ZZEA 3Q27A 4ZYHA 1LFIA 2RF1A 3FV1A 4OYVA 4R6YA 3O66A 1IZ1A 1FW0A 4IGRA 5FHOA 2F34A 2ZYKA 3OO9A 2A25A 3VV5A 3U65A 5ET6A 2EZ6A 1LAXA 3D4CA 3KZYA 5KL5A 1YTVA 3PUXE 3BIDA 4R9GA 1MY1A 1USYH 3O6HA 1BBGA 4DI4B 1PKPA 2CZHA 3OXNA 5AE3A 3LSLA 3SEWA 2LJHA 4OOGC 3A09A 4YB6A 2YZTA 1IQ7A 4GWSA 2A5TB 1Q1KA 2VPNA 3EHUA 1SFEA 2NUGA 1SYIA 2WBBA 1FPBA 1FPJA 2EMLA 3H6TA 4KHPE 3IJOB 4M2ZA 1YUIA 5CBSA 1RYXA 4M1VA 3TTMA 1US5A 3C34A 5CM6A 3O9PA 4C1UA 4OVPA 2Z8DA 2E72A 3JZJA 4O3CA 2N3GA 2LAOA 3C35A 4OFLA 1ELJA 2V89A 4Q8RA 2E1MA 2EN4A 2LBSB 2EPAA 1FSAA 4F3PA 1MS7A 3KN3A 3DP4A 3HCQA 3E13X 4ZYDA 1FTJA 1OMPA 4F9CB 1G0IA 4ELOA 4N17A 4THIA 5EQ9A 4PFIA 4TLLB 2PFZA 3IO6A 2EM7A 4F6NA 2H5YA 3T96B 1HNXE 1FPGA 4KXPA 4BLAA 2YJPA 4WSGA 2YRKA 3I6VA 1PJTA 5ISUA 3QSLA 1JNFA 2PCRA 1T38A 3C31A 1GQEA 2ZZVA 2EM0A 2CZKA 3G7WA 2VQFE 5B7DA 4WXDA 4O8MA 2Q2CA 2EOIA 1MH4A 1P47A 1YPNA 3OO8A 4NZVA 1LB9A 1HNWE 4R75A 1NCSA 4HXVA 4H0WA 3T22A 2EPXA 2PMSA 3H6VA 4QSDA 2EMZA 4WFTA 3TODA 4JI1E 1S9TA 4JI6E 2EPUA 2YRHA 5FLXC 2EWLA 3G3IA 1B0HA 1MQHA 1IMDA 1NFTA 5HBCA 3HHFA 1T4OA 3W9VA 4TOZA 1HSLA 4I8CA 1LAGE 2LMZA 2EOEA 2XX7A 2XA5A 1POTA 2QL3A 1LEVA 5DW8A 1B2HA 1DK4A 2THIA 4IR8A 5I5PA 1IBME 4U2RA 3BIGA 5A6JA 1MEYC 3KG2A 4L17A 2KOUA 1JVXA 2EMAA 3RT6B 4LONB 3ILUB 4M30A 1B4ZA 3D1RA 5CMKA 4H5GA 4DCYA 1H43A 5KL7A 4JI3E 2WYPA 2O7UA 2Q88A 3K2DA 4NHBA 1NV0A 5HM4B 4R03A 5F24A 2LV2A 3FBPA 1BP5A 3JV9A 1QU6A 1Y9UA 3IAZA 1LCTA 1TWYA 5IGAA 2ODRD 4BS9A 4GL8A 3MP1A 3N6TA 2AL5A 4R2QA 2CEXA 2Y5KA 4N13A 2IA4A 4GX3A 1B1HA 2I48A 1JW4A 3C36A 4G4PA 4GX6A 4XFEA 5FHNA 1PJQA 4ZS9A 2XWIA 4GRKA 4KCDA 4N8GA 1FQCA 3H09A 4OANA 4YMAA 4QXDA 2CEYA 2O69A 3IO4A 4FORA 1LBXA 2B4MA 4HCYA 3KSXA 1UTBB 4BBYA 4LF8E 4X8WA 3MQ9A 1YYWA 4NF6A 4P3LA 1DTGA 2OCUA 5L8DA 4NWDA 1GGGA 1SW1A 3E79A 4GWZA 5BWJA 5LMUE 4OQOA 3HPZA 3CG1A 3FD3A 3T9XB 4DR5E 2XXUA 4RXLA 1JETA 1NV4A 1N0TA 3PV0E 5AE1A 4F2JC 1PB8A 2DWHA 4H8JA 1MQJA 4NWCA 5JTYB 4MFIA 3THIA 5L9SA 2AYSA 4E0XA 2OWZA 1DPEA 2QS1A 4H45A 3GYYA 4LA9A 1WODA 1INPA 4RPOA 4ELQA 1B69A 2DLQA 2ESNA 3MBPA 1PB9A 5DYHA 4LU9A 3MP8A 4LF6E 1B5JA 1X3CA 4AQYE 4DI3D 1SI0A 1FRPA 3QK6A 1SI1A 3IOTA 1NUWA 5H8HB 4E0WA 2O84X 4DR7E 3NOHA 4JB7A 2P0SA 3F11A 3TTNA 2UXCE 2VF1A 3QUJA 5LMNE 4HW8A 1N84A 4O5GA 3KC1A 2XXXA 1MY4A 2EPNA 3FATA 1L5TA 4N8YA 2V8QB 3Q26A 5I57A 2WBUA 4GD5A 4PFYA 4LF4E 2EMGA 3C9HA 3B7DA 3FIRA 4NF4B 5ELVA 1P99A 1AAYA 2ZYOA 4OEVA 4GBWA 4H8IA 3VXCA 4O43A 4I40A 1R9QA 1IITA 3G3HA 4XIGQ 1A1HA 4O3AA 3K00A 4ZE9A 4GBVA 1EYJA 1R6ZA 3O2AA 3MVXA 3B8BA 5A6BD 4LF7E 3OO6A 3B50A 3FJ7A 4F3BA 1CB6A 2YT4A 2XXVA 4O94A 4ZDMA 3H6UA 3CRBA 3HV1A 3OTOE 1N76A 3VVDA 5ESYA 3HXLA 2VPOA 4DUYE 3IWCA 1YUJA 4RK2A 1NNKA 1DBZA 2ZNUA 4PETA 2DYXA 5IWAE 5I58A 1II5A 3RPLB 5LOMA 4O24A 1M5DA 2E0SA
chains in the Genus database with same CATH topology
2QMWA 4H1XA 1FTKA 5DTBA 2RCBA 4RPNA 3TUSA 3IR1A 4X9TA 2GHBA 4HTGA 2OJTA 3KOSA 3I5OA 2V84A 3DELB 2DVCA 1GV8A 3FGSA 3TTRA 2HQ0A 1MY3A 2REJA 2D3IA 3MUQA 3MPKA 1B7ZA 3TCHA 1I6AA 4QFNA 4YMBA 1LBBA 5KZTA 4FAJA 5ICQA 3SEYA 2AL4A 4EQBA 1NNPA 3UORA 2A5TA 1MG1A 3V8XB 2F97A 3IX1A 4G68C 1MRPA 1UQWA 4U1OA 4WKMA 1YAEA 1D9VA 4WEDA 3TZAA 4F19A 1SW2A 2XHDA 2GRVA 2I6EA 3DP8A 4ONYA 2UVJA 4G68B 4QFPA 3C4MA 4F2OA 3PUVE 3MPLA 1NH8A 1SW4A 2OWTA 2O7IA 1MXVA 3GZGA 3SEUA 2HAVA 1URDA 3OEMA 1M5CA 2ONKE 1IEJA 1R1NA 1N3WA 1A7LA 2AIXA 3MVWA 4LZ5A 3RTFB 3FVGA 3TYHA 4EUOA 3PMVA 1IXIA 1MPDA 4Q30B 3M8UA 3R7XA 4LUBA 2RKMA 4UA8A 2F36A 1PEBA 3OOAA 3K6UA 2I4CA 4NMYA 3QYTA 2FA7A 3OMBA 3PD9A 2I4BA 1GTKA 4F22A 1FTOA 4BDNA 5B70A 3TCFA 3RGYA 5AA4A 3Q29A 3V89B 4EQ9A 2XXPA 3PU5A 3U93A 4LZ8A 3IOWA 4JSOA 4Q5TA 3IORA 3FZVA 1AL3A 4M4GA 2DOJA 5AA2A 4ZZAA 1UIUA 1B32A 1LB8A 1MXUA 1BIYA 3ZSFA 2B3FA 2Q9TA 2QS2A 3MZ9A 3ZS6A 1S50A 3ODBA 2V3QA 2Z8EA 2M8CA 2Y7IA 1HSEA 4POXA 3DP6A 3PD8A 3P7IA 3D4GA 1MY0A 1H44A 5H8QA 1DTZA 2Y7WA 4XTCQ 2OWSA 3OSRA 1LAHE 2OBGA 3UIFA 3FUZA 2ZNSA 3V83A 3FXQA 5EHSA 3H6WA 4RNSA 1Y1ZA 1MM7A 3O6GA 4QSCA 4BDOA 4PP0A 4MF3A 3JYRA 4OFJA 4QFOA 3KJ7A 4NF5B 1ZJLA 2VP1A 5KCJB 5AE4A 3T9VA 1BKAA 5JTYA 4YU0A 4KR5A 5DVFA 5H8FA 3N94A 3K1PA 4C0RA 1MY2A 2QMXA 3TEPA 1XVXA 1XC1A 3L6HA 3OENA 1R9LA 3N26A 3PPNA 1MPBA 2ZXTA 1GVCA 2O51A 4F3SA 5CMMA 1Z7NE 5I56A 1Z7ME 5H8NB 2RC7A 4U4SA 4G8NA 1P1NA 1EZOA 5IKBA 1MQIA 1MXWA 4F1YA 4YB7A 1VSOA 3MVYA 1B58A 1URGA 1I69A 1KWHA 1JEUA 4OEUA 3QUFA 3VVEA 4NTLA 4EF2A 4ZECA 1ZIUA 2NXOA 4DCXA 5I84A 3M3FA 2F7CA 4R6HA 2XD3A 3FVOA 5CRYA 3KSJA 2VD2A 4Z0IA 1D9YA 2HXWA 5TP9A 2H9BA 3TMGA 4OVJA 4DXBA 4YAHX 1FQBA 3SKPA 2NVUB 2P1SA 4BDRA 2HEUA 2HZLA 2HFBA 5KDTB 1UTHA 5L9OA 4GL0A 4POWA 3W15C 1MQDA 3IB1A 1JW1A 1FTLA 1ZTYA 1M5FA 4G77A 3MWBA 1URSA 1USYE 1UIVA 4G8MA 2D5WA 3KN8A 4K3FA 5ITOA 2DE3A 2OLBA 5DEXA 3CR9A 2F6PA 3TQWA 3S9LC 4AB5A 4P11A 3TFLA 2O68A 4RJZA 4YKJA 4OMBA 1D3KA 4GXAA 4OETA 3S2VA 3U94A 2Y7RA 4EXLA 2HAUA 2XXYA 4OWDA 4JWOA 4MLQA 1B3GA 4NEDA 5TPAB 3U92A 4YKPA 2V25A 2V3UA 1NL5A 4MH5A 3AXFA 3FVKA 3S9EA 1CE2A 4YICA 3UP9A 4KD5A 2Q8JA 2ZNTA 3GBBA 4ZEBA 3S4UA 2B65A 1FQAA 4OERA 4ZE8A 3RLFE 2B3BA 3BFTA 3SDFA 5EYFA 3PUZE 5IAIA 4IO7A 4NF8A 1I6BA 1D4NA 1EU8A 1OQHA 4FATA 4I62A 4IO3A 2ANJA 3GBAA 4ELRA 1B52A 2FNCA 3S9NC 3CFLA 3MVZA 3MZBA 3G3GA 1Y3NA 4JWXA 3IK6B 5A5XA 3OSQA 4I9DA 4HCWA 1A40A 4IO5A 1B3HA 2D21A 4ISUA 5FHMA 3VLUA 3K1NA 3R26A 1DPPA 2I58A 2GH9A 2V93A 4KFQA 2H25A 3GXAA 4EDPA 5M2VA 1IXHA 2H99A 4Z7EA 4XKPA 1QULA 1SYHA 3EN3A 1FCKA 3K1MA 2V3TA 3TKDA 3QAXA 2DQVA 5I59A 2F6GA 3K0VA 5CMCA 2CMOA 1EH3A 3OELA 4JXIA 1SDXA 2F8DA 2XXTA 4H67A 2HZKA 4EQ7A 3K4UA 4IGTA 1A8FA 2UYEA 2X7PA 2ZMBA 4LZ7A 3KBRA 4JDFA 3R6UA 3MZ1A 4AQ4A 1QKBA 5I2NB 3IOVA 5BUUA 3QXMA 3LSWA 1FQFA 1OQGA 3KJTA 3OD7A 1Y3QA 4OTEA 5F1QA 1MH3A 1B1XA 4NF6B 1OLAA 3KEIA 4LP2B 1IXCA 1PC3A 1NNTA 1MQGA 3IOUA 4F1VA 1SD3A 1P1WA 3TTKA 3PPOA 1P1UA 1VR5A 3RN8A 4NE4A 4DZ1A 3E4RA 3H7MA 1MPCA 2VGQA 2Y84A 2F7BA 3U8QA 4GF8A 1IUDA 3MJNA 3I3VA 3DLNA 3RQTA 1LFHA 4U1ZA 1QUKA 3FVNA 4I1DA 3RT8A 4RK9A 2QJEA 5DVJA 1ZKBA 3U72A 2XX9A 1POY1 3FJMA 4PFUA 3M3KA 3B6WA 1JVYA 1SW5A 4FEDA 4GLIA 2BJJX 1SBPA 4X48A 4YB5A 1P1OA 1PB7A 1M5BA 1ANFA 4QF9A 2YPNA 3PPQA 5EHMA 4QSEA 1AOVA 3TQLA 4KPTA 4GVOA 4OENA 2R71A 1N04A 3EQ1A 1VE4A 1YCJA 3BBRA 1EZ9A 4X1DA 3K01A 2I0BA 2NUVA 3GLBA 4IO2A 4TLMB 4IO4A 4U22A 3RTWB 4KI0E 3FV2A 2Y7KA 5ICTA 1PBPA 5JK4A 1FQDA 4DXUA 1SVXB 2FYIA 4R72A 4ND9A 1A99A 4XKRA 3QIMA 3LR1A 3MW0A 1US4A 4PE5B 2QS3A 4YKIA 1B5HA 4XKNA 4IB2A 4HS7A 3SETA 5I58B 1TT1A 3HO7A 4BDQA 2DXRA 3PGFA 3N6UA 1DMBA 2RC9A 1JEVA 4GXSB 3KGCA 3SEVA 1H3DA 4ECFA 4JWYA 1N3XA 1AMFA 1MXXA 3FXRA 5CBRA 1SQYA 3G3KA 4OHNA 4WXJA 1N7WA 1ZMGA 2QSXA 4R2FA 2O1LA 4G2ZA 2F7AA 3LSXA 2REGA 1NNFA 4R2BA 3FASA 1UTBA 2A5SA 2HCAA 3CVGA 2G93A 2ALUA 2XXWA 2ONRA 4OXVA 1LLSA 1QJMA 4KQPA 5AA1A 4ESXA 3C33A 1B3EA 1MDQA 4DDDA 1OVBA 1IXGA 2W7YA 2X26A 3FXUA 5TPAA 2XXHA 3MC2A 2UVIA 1DSNA 3USDA 2DWIA 1T0KA 4ZEIA 4KYSA 4TQUQ 1B40A 2G29A 4FECA 5H8HA 3ILTB 5L9MA 1FQEA 4GQOA 2UVHA 1RKMA 2PBWA 1TFDA 2PVUA 3EHSA 3KZGA 4LQ5A 3CG3A 5TU0A 3HHGA 3A3UA 4KHZE 4DE8A 3ECRA 2IEEA 2I3WA 2R6GE 1LBCA 3LBSA 3HPIA 2ABHA 4NF4A 1B05A 2XX8A 1A8EA 3V5AA 1B3LA 5I2KB 3VDFA 1LSTA 2ONSA 2PX1A 2DWAA 1OVTA 3KFMA 2O1MA 3CSGA 4XKQA 1H45A 4IY6A 1M5EA 3PMWA 5DVIA 4FIMA 3UN6A 3EPEA 4EF1A 4P0GA 4N6PA 5AA4B 1QW0A 4DLDA 3UGWA 3CFZA 3DM0A 2UVGA 4F1UA 4RA1A 1GR2A 4ZEFA 3ZKKA 3TAJA 5AA3A 2XXRA 4ZEKA 2I3VA 4LQ2A 4QHQA 2Y7PA 2E1SA 4PFWA 4BDMA 5AA2B 1ZU0A 1A55A 2P2AA 1QUIA 3RY3A 3OEKA 1ATGA 4ZEDA 1DOTA 1QUJA 4GFRA 4R73A 3A3CA 1F9BA 4X1BA 3G3JA 4QFLA 1B5IA 4RY1A 3E9XA 5H8QB 3O97A 3HSTA 3CFXA 3MAMA 1TFAA 4F2QA 3TCGA 1AIVA 2DVZA 5I2NA 5K2YA 5FTHA 4FJPA 5ITPA 1QKAA 1B4HA 2DWJA 1MXYA 1Y4CA 2VHAA 1XHYA 3B6TA 1I6QA 4YKKA 4BDLA 4R9FA 2YLNA 3ZKLA 3LC8A 3W9WA 2KLFA 1B51A 3MP6A 2OZZA 1NMUA 3WAEA 3K02A 2I49A 4U4XA 1O63A 3K6XA 1WVJA 3UA8A 2VOZA 1IIWA 1NH7A 1VFEA 4JSDA 1B46A 3TDJA 5J1DA 4QRZA 3TPAA 5H8FB 4F29A 4KYDA 2H98A 2RINA 1XOCA 3G3FA 3H4ZA 2XXQA 1H76A 4G68A 1JQFA 3Q28A 3VFJA 3PUYE 2WKYA 3IB2A 5CI5A 5I56B 1NKXA 4G8HA 2Z22A 2I0CA 5K2XA 2NWJA 4OFOA 1LCFA 1O64A 2OK2A 3L6GA 4R6KA 4LVQA 1HSJA 4R74A 4XXUA 3CSBA 3TTLA 2DSFA 5CMBA 3T9UA 3RNNA 2F35A 4PFTA 5JEIA 4U23A 2XD2A 3OO7A 3VLVA 4PQJA 3EF7A 2X7QA 3T93B 1OIBA 5H8SA 1Y3PA 2Z8FA 1Y20A 3PPRA 3KN7A 4C1TA 1PBQA 2DE2A 1O7TA 1LGBC 5DT6A 1BLFA 4JBZA 5TP9B 2GHAA 1EZPA 2Z23A 2DE4A 4QFKA 2F78A 1VFDA 3C32A 3VLWA 1ZLQA 1MM6A 4GIZA 2RC8A 3H3GA 1Y1MA 2PYYA 3LSFB 1UTHB 3T66A 4F31B 2PT2A 1MXZA 1B7UA 4F3GA 4UACA 2F5XA 1XVYA 2DP8A 2QS4A 3B6QA 3BFUA 3PUWE 5AA2D 4U21A 1FTMA 3RUMA 5F7VA 4GOTA 4H6DA 1BTJA 3H03A 5DEXB 2O6AA 4FE8A 4MLVA 2GFEA 3H06B 4H5FA 4GWOA 3K6WA 3T9HB 3K6VA 3PMXA 3IJXB 1B0LA 2H4IA 3O28A 3SEXA 2CZLA 3EHTA 3UK4A 1A54A 1B6HA 4FEBA 4H65A 1LFGA 1B3FA 4RYAA 4LATA 5HPQA 3FJGA 3ONMA 2PT1A 1LAFE 3VXBA 1B9JA 1QVSA 2UXAA 1PDAA 2XXIA 3PPPA 4P0IA 2QRYA 5CC2A 4Q0CA 1ZBMA 1Q35A 4NF5A 2DS9A 5FTIA 5KCJA 4KYEA 3IL1B 4OESA 2Q89A 1WDNA 3SESA 2QPQA 1P1QA 3M3LA 4F18A 3N5LA 4NF8B 3VE1B 3U1OA 1XT8A 4ELPA 1N7XA 4KCCA 5I57B 4DIGA 1MDP1 1AH5A 2ZYMA 1JW5A 5H8NA 4WEPA 4DXCA 3O29A 5A5XB 1OLCA 2Q2AA 1B7HA 4IY5A 2DXYA 5I2KA 3LUYA 1TXFA 1Y4TA 3WAFA 4ESWA 4OZ9A 4F39A 4YZZA 3BKIB 2ZYNA 3HN0A 3CI8A 2R9JA 2VD3A 4N07A 1XS5A 3Q25A 2NOOA 4MBPA 3CIJA 3KOTA 4AB6A 5I59B 3S9MC 1S7YA 2RCAA 3O6IA 3E3KA 3TELA 1J1NA 2UYFA 5KDTA 3VVFA 3IB0A 4O3BA 3SERA 4EXKA 4IO6A 3RPWA 1RYOA 4ZZEA 3Q27A 1LFIA 2RF1A 3FV1A 4OYVA 4R6YA 3O66A 1IZ1A 1FW0A 4IGRA 5FHOA 2F34A 2ZYKA 3OO9A 3VV5A 1LAXA 3D4CA 1YTVA 3PUXE 4R9GA 1MY1A 1USYH 3O6HA 3OXNA 3LSLA 3SEWA 3A09A 4YB6A 1IQ7A 2A5TB 1Q1KA 3EHUA 1SYIA 3H6TA 3IJOB 5CBSA 1RYXA 4M1VA 3TTMA 1US5A 3C34A 5CM6A 3O9PA 4C1UA 2Z8DA 3JZJA 4O3CA 2LAOA 3C35A 4OFLA 1ELJA 4Q8RA 4F3PA 1MS7A 3KN3A 3DP4A 3HCQA 3E13X 1FTJA 1OMPA 4ELOA 4THIA 4TLLB 3IO6A 2H5YA 3T96B 4BLAA 2YJPA 3I6VA 5ISUA 3QSLA 1JNFA 3C31A 3G7WA 5B7DA 2Q2CA 1MH4A 1YPNA 3OO8A 1LB9A 4R75A 4H0WA 3T22A 4QSDA 2PMSA 3H6VA 3TODA 1S9TA 3G3IA 1B0HA 1MQHA 1NFTA 5HBCA 3HHFA 3W9VA 4TOZA 1HSLA 4I8CA 1LAGE 2XX7A 1POTA 2QL3A 1B2HA 2THIA 4U2RA 3KG2A 4L17A 1JVXA 3RT6B 4LONB 3ILUB 1B4ZA 5CMKA 4H5GA 4DCYA 1H43A 2O7UA 2Q88A 3K2DA 5HM4B 1BP5A 3JV9A 1Y9UA 3IAZA 1LCTA 1TWYA 4GL8A 3MP1A 3N6TA 2AL5A 4N13A 2IA4A 1B1HA 2I48A 1JW4A 3C36A 4G4PA 5FHNA 4ZS9A 4GRKA 4KCDA 1FQCA 4YMAA 2O69A 3IO4A 4FORA 4HCYA 3KSXA 1UTBB 3MQ9A 4NF6A 1DTGA 2OCUA 5L8DA 4NWDA 1GGGA 1SW1A 5BWJA 4OQOA 3CG1A 3FD3A 3T9XB 2XXUA 4RXLA 1JETA 1N0TA 3PV0E 1PB8A 2DWHA 4H8JA 1MQJA 4NWCA 5JTYB 4MFIA 3THIA 5L9SA 2AYSA 4E0XA 1DPEA 2QS1A 4LA9A 1WODA 4RPOA 4ELQA 2ESNA 3MBPA 1PB9A 5DYHA 3MP8A 1B5JA 1SI0A 3QK6A 1SI1A 3IOTA 5H8HB 4E0WA 2O84X 4JB7A 2P0SA 3F11A 3TTNA 3QUJA 4HW8A 1N84A 2XXXA 1MY4A 3FATA 1L5TA 3Q26A 5I57A 4GD5A 4PFYA 3C9HA 3B7DA 3FIRA 4NF4B 5ELVA 1P99A 2ZYOA 4OEVA 4H8IA 3VXCA 1R9QA 1IITA 3G3HA 4XIGQ 4O3AA 3K00A 4ZE9A 1R6ZA 3O2AA 3MVXA 3OO6A 3FJ7A 4F3BA 1CB6A 2XXVA 4ZDMA 3H6UA 3CRBA 3HV1A 1N76A 3VVDA 4RK2A 1NNKA 2ZNUA 4PETA 2DYXA 5I58A 1II5A 5LOMA 1M5DA 2E0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMW A;  4H1X A;  1FTK A;  5DTB A;  2RCB A;  4RPN A;  3TUS A;  3IR1 A;  4X9T A;  2GHB A;  4HTG A;  2OJT A;  3KOS A;  3I5O A;  2V84 A;  3DEL B;  2DVC A;  1GV8 A;  3FGS A;  3TTR A;  2HQ0 A;  1MY3 A;  2REJ A;  2D3I A;  3MUQ A;  3MPK A;  1B7Z A;  3TCH A;  1I6A A;  4QFN A;  4YMB A;  1LBB A;  5KZT A;  4FAJ A;  5ICQ A;  3SEY A;  2AL4 A;  4EQB A;  1NNP A;  3UOR A;  2A5T A;  1MG1 A;  3V8X B;  2F97 A;  3IX1 A;  4G68 C;  1MRP A;  1UQW A;  4U1O A;  4WKM A;  1YAE A;  1D9V A;  4WED A;  3TZA A;  4F19 A;  1SW2 A;  2XHD A;  2GRV A;  2I6E A;  3DP8 A;  4ONY A;  2UVJ A;  4G68 B;  4QFP A;  3C4M A;  4F2O A;  3PUV E;  3MPL A;  1NH8 A;  1SW4 A;  2OWT A;  2O7I A;  1MXV A;  3GZG A;  3SEU A;  2HAV A;  1URD A;  3OEM A;  1M5C A;  2ONK E;  1IEJ A;  1R1N A;  1N3W A;  1A7L A;  2AIX A;  3MVW A;  4LZ5 A;  3RTF B;  3FVG A;  3TYH A;  4EUO A;  3PMV A;  1IXI A;  1MPD A;  4Q30 B;  3M8U A;  3R7X A;  4LUB A;  2RKM A;  4UA8 A;  2F36 A;  1PEB A;  3OOA A;  3K6U A;  2I4C A;  4NMY A;  3QYT A;  2FA7 A;  3OMB A;  3PD9 A;  2I4B A;  1GTK A;  4F22 A;  1FTO A;  4BDN A;  5B70 A;  3TCF A;  3RGY A;  5AA4 A;  3Q29 A;  3V89 B;  4EQ9 A;  2XXP A;  3PU5 A;  3U93 A;  4LZ8 A;  3IOW A;  4JSO A;  4Q5T A;  3IOR A;  3FZV A;  1AL3 A;  4M4G A;  2DOJ A;  5AA2 A;  4ZZA A;  1UIU A;  1B32 A;  1LB8 A;  1MXU A;  1BIY A;  3ZSF A;  2B3F A;  2Q9T A;  2QS2 A;  3MZ9 A;  3ZS6 A;  1S50 A;  3ODB A;  2V3Q A;  2Z8E A;  2M8C A;  2Y7I A;  1HSE A;  4POX A;  3DP6 A;  3PD8 A;  3P7I A;  3D4G A;  1MY0 A;  1H44 A;  5H8Q A;  1DTZ A;  2Y7W A;  4XTC Q;  2OWS A;  3OSR A;  1LAH E;  2OBG A;  3UIF A;  3FUZ A;  2ZNS A;  3V83 A;  3FXQ A;  5EHS A;  3H6W A;  4RNS A;  1Y1Z A;  1MM7 A;  3O6G A;  4QSC A;  4BDO A;  4PP0 A;  4MF3 A;  3JYR A;  4OFJ A;  4QFO A;  3KJ7 A;  4NF5 B;  1ZJL A;  2VP1 A;  5KCJ B;  5AE4 A;  3T9V A;  1BKA A;  5JTY A;  4YU0 A;  4KR5 A;  5DVF A;  5H8F A;  3N94 A;  3K1P A;  4C0R A;  1MY2 A;  2QMX A;  3TEP A;  1XVX A;  1XC1 A;  3L6H A;  3OEN A;  1R9L A;  3N26 A;  3PPN A;  1MPB A;  2ZXT A;  1GVC A;  2O51 A;  4F3S A;  5CMM A;  1Z7N E;  5I56 A;  1Z7M E;  5H8N B;  2RC7 A;  4U4S A;  4G8N A;  1P1N A;  1EZO A;  5IKB A;  1MQI A;  1MXW A;  4F1Y A;  4YB7 A;  1VSO A;  3MVY A;  1B58 A;  1URG A;  1I69 A;  1KWH A;  1JEU A;  4OEU A;  3QUF A;  3VVE A;  4NTL A;  4EF2 A;  4ZEC A;  1ZIU A;  2NXO A;  4DCX A;  5I84 A;  3M3F A;  2F7C A;  4R6H A;  2XD3 A;  3FVO A;  5CRY A;  3KSJ A;  2VD2 A;  4Z0I A;  1D9Y A;  2HXW A;  5TP9 A;  2H9B A;  3TMG A;  4OVJ A;  4DXB A;  4YAH X;  1FQB A;  3SKP A;  2NVU B;  2P1S A;  4BDR A;  2HEU A;  2HZL A;  2HFB A;  5KDT B;  1UTH A;  5L9O A;  4GL0 A;  4POW A;  3W15 C;  1MQD A;  3IB1 A;  1JW1 A;  1FTL A;  1ZTY A;  1M5F A;  4G77 A;  3MWB A;  1URS A;  1USY E;  1UIV A;  4G8M A;  2D5W A;  3KN8 A;  4K3F A;  5ITO A;  2DE3 A;  2OLB A;  5DEX A;  3CR9 A;  2F6P A;  3TQW A;  3S9L C;  4AB5 A;  4P11 A;  3TFL A;  2O68 A;  4RJZ A;  4YKJ A;  4OMB A;  1D3K A;  4GXA A;  4OET A;  3S2V A;  3U94 A;  2Y7R A;  4EXL A;  2HAU A;  2XXY A;  4OWD A;  4JWO A;  4MLQ A;  1B3G A;  4NED A;  5TPA B;  3U92 A;  4YKP A;  2V25 A;  2V3U A;  1NL5 A;  4MH5 A;  3AXF A;  3FVK A;  3S9E A;  1CE2 A;  4YIC A;  3UP9 A;  4KD5 A;  2Q8J A;  2ZNT A;  3GBB A;  4ZEB A;  3S4U A;  2B65 A;  1FQA A;  4OER A;  4ZE8 A;  3RLF E;  2B3B A;  3BFT A;  3SDF A;  5EYF A;  3PUZ E;  5IAI A;  4IO7 A;  4NF8 A;  1I6B A;  1D4N A;  1EU8 A;  1OQH A;  4FAT A;  4I62 A;  4IO3 A;  2ANJ A;  3GBA A;  4ELR A;  1B52 A;  2FNC A;  3S9N C;  3CFL A;  3MVZ A;  3MZB A;  3G3G A;  1Y3N A;  4JWX A;  3IK6 B;  5A5X A;  3OSQ A;  4I9D A;  4HCW A;  1A40 A;  4IO5 A;  1B3H A;  2D21 A;  4ISU A;  5FHM A;  3VLU A;  3K1N A;  3R26 A;  1DPP A;  2I58 A;  2GH9 A;  2V93 A;  4KFQ A;  2H25 A;  3GXA A;  4EDP A;  5M2V A;  1IXH A;  2H99 A;  4Z7E A;  4XKP A;  1QUL A;  1SYH A;  3EN3 A;  1FCK A;  3K1M A;  2V3T A;  3TKD A;  3QAX A;  2DQV A;  5I59 A;  2F6G A;  3K0V A;  5CMC A;  2CMO A;  1EH3 A;  3OEL A;  4JXI A;  1SDX A;  2F8D A;  2XXT A;  4H67 A;  2HZK A;  4EQ7 A;  3K4U A;  4IGT A;  1A8F A;  2UYE A;  2X7P A;  2ZMB A;  4LZ7 A;  3KBR A;  4JDF A;  3R6U A;  3MZ1 A;  4AQ4 A;  1QKB A;  5I2N B;  3IOV A;  5BUU A;  3QXM A;  3LSW A;  1FQF A;  1OQG A;  3KJT A;  3OD7 A;  1Y3Q A;  4OTE A;  5F1Q A;  1MH3 A;  1B1X A;  4NF6 B;  1OLA A;  3KEI A;  4LP2 B;  1IXC A;  1PC3 A;  1NNT A;  1MQG A;  3IOU A;  4F1V A;  1SD3 A;  1P1W A;  3TTK A;  3PPO A;  1P1U A;  1VR5 A;  3RN8 A;  4NE4 A;  4DZ1 A;  3E4R A;  3H7M A;  1MPC A;  2VGQ A;  2Y84 A;  2F7B A;  3U8Q A;  4GF8 A;  1IUD A;  3MJN A;  3I3V A;  3DLN A;  3RQT A;  1LFH A;  4U1Z A;  1QUK A;  3FVN A;  4I1D A;  3RT8 A;  4RK9 A;  2QJE A;  5DVJ A;  1ZKB A;  3U72 A;  2XX9 A;  1POY 1;  3FJM A;  4PFU A;  3M3K A;  3B6W A;  1JVY A;  1SW5 A;  4FED A;  4GLI A;  2BJJ X;  1SBP A;  4X48 A;  4YB5 A;  1P1O A;  1PB7 A;  1M5B A;  1ANF A;  4QF9 A;  2YPN A;  3PPQ A;  5EHM A;  4QSE A;  1AOV A;  3TQL A;  4KPT A;  4GVO A;  4OEN A;  2R71 A;  1N04 A;  3EQ1 A;  1VE4 A;  1YCJ A;  3BBR A;  1EZ9 A;  4X1D A;  3K01 A;  2I0B A;  2NUV A;  3GLB A;  4IO2 A;  4TLM B;  4IO4 A;  4U22 A;  3RTW B;  4KI0 E;  3FV2 A;  2Y7K A;  5ICT A;  1PBP A;  5JK4 A;  1FQD A;  4DXU A;  1SVX B;  2FYI A;  4R72 A;  4ND9 A;  1A99 A;  4XKR A;  3QIM A;  3LR1 A;  3MW0 A;  1US4 A;  4PE5 B;  2QS3 A;  4YKI A;  1B5H A;  4XKN A;  4IB2 A;  4HS7 A;  3SET A;  5I58 B;  1TT1 A;  3HO7 A;  4BDQ A;  2DXR A;  3PGF A;  3N6U A;  1DMB A;  2RC9 A;  1JEV A;  4GXS B;  3KGC A;  3SEV A;  1H3D A;  4ECF A;  4JWY A;  1N3X A;  1AMF A;  1MXX A;  3FXR A;  5CBR A;  1SQY A;  3G3K A;  4OHN A;  4WXJ A;  1N7W A;  1ZMG A;  2QSX A;  4R2F A;  2O1L A;  4G2Z A;  2F7A A;  3LSX A;  2REG A;  1NNF A;  4R2B A;  3FAS A;  1UTB A;  2A5S A;  2HCA A;  3CVG A;  2G93 A;  2ALU A;  2XXW A;  2ONR A;  4OXV A;  1LLS A;  1QJM A;  4KQP A;  5AA1 A;  4ESX A;  3C33 A;  1B3E A;  1MDQ A;  4DDD A;  1OVB A;  1IXG A;  2W7Y A;  2X26 A;  3FXU A;  5TPA A;  2XXH A;  3MC2 A;  2UVI A;  1DSN A;  3USD A;  2DWI A;  1T0K A;  4ZEI A;  4KYS A;  4TQU Q;  1B40 A;  2G29 A;  4FEC A;  5H8H A;  3ILT B;  5L9M A;  1FQE A;  4GQO A;  2UVH A;  1RKM A;  2PBW A;  1TFD A;  2PVU A;  3EHS A;  3KZG A;  4LQ5 A;  3CG3 A;  5TU0 A;  3HHG A;  3A3U A;  4KHZ E;  4DE8 A;  3ECR A;  2IEE A;  2I3W A;  2R6G E;  1LBC A;  3LBS A;  3HPI A;  2ABH A;  4NF4 A;  1B05 A;  2XX8 A;  1A8E A;  3V5A A;  1B3L A;  5I2K B;  3VDF A;  1LST A;  2ONS A;  2PX1 A;  2DWA A;  1OVT A;  3KFM A;  2O1M A;  3CSG A;  4XKQ A;  1H45 A;  4IY6 A;  1M5E A;  3PMW A;  5DVI A;  4FIM A;  3UN6 A;  3EPE A;  4EF1 A;  4P0G A;  4N6P A;  5AA4 B;  1QW0 A;  4DLD A;  3UGW A;  3CFZ A;  3DM0 A;  2UVG A;  4F1U A;  4RA1 A;  1GR2 A;  4ZEF A;  3ZKK A;  3TAJ A;  5AA3 A;  2XXR A;  4ZEK A;  2I3V A;  4LQ2 A;  4QHQ A;  2Y7P A;  2E1S A;  4PFW A;  4BDM A;  5AA2 B;  1ZU0 A;  1A55 A;  2P2A A;  1QUI A;  3RY3 A;  3OEK A;  1ATG A;  4ZED A;  1DOT A;  1QUJ A;  4GFR A;  4R73 A;  3A3C A;  1F9B A;  4X1B A;  3G3J A;  4QFL A;  1B5I A;  4RY1 A;  3E9X A;  5H8Q B;  3O97 A;  3HST A;  3CFX A;  3MAM A;  1TFA A;  4F2Q A;  3TCG A;  1AIV A;  2DVZ A;  5I2N A;  5K2Y A;  5FTH A;  4FJP A;  5ITP A;  1QKA A;  1B4H A;  2DWJ A;  1MXY A;  1Y4C A;  2VHA A;  1XHY A;  3B6T A;  1I6Q A;  4YKK A;  4BDL A;  4R9F A;  2YLN A;  3ZKL A;  3LC8 A;  3W9W A;  2KLF A;  1B51 A;  3MP6 A;  2OZZ A;  1NMU A;  3WAE A;  3K02 A;  2I49 A;  4U4X A;  1O63 A;  3K6X A;  1WVJ A;  3UA8 A;  2VOZ A;  1IIW A;  1NH7 A;  1VFE A;  4JSD A;  1B46 A;  3TDJ A;  5J1D A;  4QRZ A;  3TPA A;  5H8F B;  4F29 A;  4KYD A;  2H98 A;  2RIN A;  1XOC A;  3G3F A;  3H4Z A;  2XXQ A;  1H76 A;  4G68 A;  1JQF A;  3Q28 A;  3VFJ A;  3PUY E;  2WKY A;  3IB2 A;  5CI5 A;  5I56 B;  1NKX A;  4G8H A;  2Z22 A;  2I0C A;  5K2X A;  2NWJ A;  4OFO A;  1LCF A;  1O64 A;  2OK2 A;  3L6G A;  4R6K A;  4LVQ A;  1HSJ A;  4R74 A;  4XXU A;  3CSB A;  3TTL A;  2DSF A;  5CMB A;  3T9U A;  3RNN A;  2F35 A;  4PFT A;  5JEI A;  4U23 A;  2XD2 A;  3OO7 A;  3VLV A;  4PQJ A;  3EF7 A;  2X7Q A;  3T93 B;  1OIB A;  5H8S A;  1Y3P A;  2Z8F A;  1Y20 A;  3PPR A;  3KN7 A;  4C1T A;  1PBQ A;  2DE2 A;  1O7T A;  1LGB C;  5DT6 A;  1BLF A;  4JBZ A;  5TP9 B;  2GHA A;  1EZP A;  2Z23 A;  2DE4 A;  4QFK A;  2F78 A;  1VFD A;  3C32 A;  3VLW A;  1ZLQ A;  1MM6 A;  4GIZ A;  2RC8 A;  3H3G A;  1Y1M A;  2PYY A;  3LSF B;  1UTH B;  3T66 A;  4F31 B;  2PT2 A;  1MXZ A;  1B7U A;  4F3G A;  4UAC A;  2F5X A;  1XVY A;  2DP8 A;  2QS4 A;  3B6Q A;  3BFU A;  3PUW E;  5AA2 D;  4U21 A;  1FTM A;  3RUM A;  5F7V A;  4GOT A;  4H6D A;  1BTJ A;  3H03 A;  5DEX B;  2O6A A;  4FE8 A;  4MLV A;  2GFE A;  3H06 B;  4H5F A;  4GWO A;  3K6W A;  3T9H B;  3K6V A;  3PMX A;  3IJX B;  1B0L A;  2H4I A;  3O28 A;  3SEX A;  2CZL A;  3EHT A;  3UK4 A;  1A54 A;  1B6H A;  4FEB A;  4H65 A;  1LFG A;  1B3F A;  4RYA A;  4LAT A;  5HPQ A;  3FJG A;  3ONM A;  2PT1 A;  1LAF E;  3VXB A;  1B9J A;  1QVS A;  2UXA A;  1PDA A;  2XXI A;  3PPP A;  4P0I A;  2QRY A;  5CC2 A;  4Q0C A;  1ZBM A;  1Q35 A;  4NF5 A;  2DS9 A;  5FTI A;  5KCJ A;  4KYE A;  3IL1 B;  4OES A;  2Q89 A;  1WDN A;  3SES A;  2QPQ A;  1P1Q A;  3M3L A;  4F18 A;  3N5L A;  4NF8 B;  3VE1 B;  3U1O A;  1XT8 A;  4ELP A;  1N7X A;  4KCC A;  5I57 B;  4DIG A;  1MDP 1;  1AH5 A;  2ZYM A;  1JW5 A;  5H8N A;  4WEP A;  4DXC A;  3O29 A;  5A5X B;  1OLC A;  2Q2A A;  1B7H A;  4IY5 A;  2DXY A;  5I2K A;  3LUY A;  1TXF A;  1Y4T A;  3WAF A;  4ESW A;  4OZ9 A;  4F39 A;  4YZZ A;  3BKI B;  2ZYN A;  3HN0 A;  3CI8 A;  2R9J A;  2VD3 A;  4N07 A;  1XS5 A;  3Q25 A;  2NOO A;  4MBP A;  3CIJ A;  3KOT A;  4AB6 A;  5I59 B;  3S9M C;  1S7Y A;  2RCA A;  3O6I A;  3E3K A;  3TEL A;  1J1N A;  2UYF A;  5KDT A;  3VVF A;  3IB0 A;  4O3B A;  3SER A;  4EXK A;  4IO6 A;  3RPW A;  1RYO A;  4ZZE A;  3Q27 A;  1LFI A;  2RF1 A;  3FV1 A;  4OYV A;  4R6Y A;  3O66 A;  1IZ1 A;  1FW0 A;  4IGR A;  5FHO A;  2F34 A;  2ZYK A;  3OO9 A;  3VV5 A;  1LAX A;  3D4C A;  1YTV A;  3PUX E;  4R9G A;  1MY1 A;  1USY H;  3O6H A;  3OXN A;  3LSL A;  3SEW A;  3A09 A;  4YB6 A;  1IQ7 A;  2A5T B;  1Q1K A;  3EHU A;  1SYI A;  3H6T A;  3IJO B;  5CBS A;  1RYX A;  4M1V A;  3TTM A;  1US5 A;  3C34 A;  5CM6 A;  3O9P A;  4C1U A;  2Z8D A;  3JZJ A;  4O3C A;  2LAO A;  3C35 A;  4OFL A;  1ELJ A;  4Q8R A;  4F3P A;  1MS7 A;  3KN3 A;  3DP4 A;  3HCQ A;  3E13 X;  1FTJ A;  1OMP A;  4ELO A;  4THI A;  4TLL B;  3IO6 A;  2H5Y A;  3T96 B;  4BLA A;  2YJP A;  3I6V A;  5ISU A;  3QSL A;  1JNF A;  3C31 A;  3G7W A;  5B7D A;  2Q2C A;  1MH4 A;  1YPN A;  3OO8 A;  1LB9 A;  4R75 A;  4H0W A;  3T22 A;  4QSD A;  2PMS A;  3H6V A;  3TOD A;  1S9T A;  3G3I A;  1B0H A;  1MQH A;  1NFT A;  5HBC A;  3HHF A;  3W9V A;  4TOZ A;  1HSL A;  4I8C A;  1LAG E;  2XX7 A;  1POT A;  2QL3 A;  1B2H A;  2THI A;  4U2R A;  3KG2 A;  4L17 A;  1JVX A;  3RT6 B;  4LON B;  3ILU B;  1B4Z A;  5CMK A;  4H5G A;  4DCY A;  1H43 A;  2O7U A;  2Q88 A;  3K2D A;  5HM4 B;  1BP5 A;  3JV9 A;  1Y9U A;  3IAZ A;  1LCT A;  1TWY A;  4GL8 A;  3MP1 A;  3N6T A;  2AL5 A;  4N13 A;  2IA4 A;  1B1H A;  2I48 A;  1JW4 A;  3C36 A;  4G4P A;  5FHN A;  4ZS9 A;  4GRK A;  4KCD A;  1FQC A;  4YMA A;  2O69 A;  3IO4 A;  4FOR A;  4HCY A;  3KSX A;  1UTB B;  3MQ9 A;  4NF6 A;  1DTG A;  2OCU A;  5L8D A;  4NWD A;  1GGG A;  1SW1 A;  5BWJ A;  4OQO A;  3CG1 A;  3FD3 A;  3T9X B;  2XXU A;  4RXL A;  1JET A;  1N0T A;  3PV0 E;  1PB8 A;  2DWH A;  4H8J A;  1MQJ A;  4NWC A;  5JTY B;  4MFI A;  3THI A;  5L9S A;  2AYS A;  4E0X A;  1DPE A;  2QS1 A;  4LA9 A;  1WOD A;  4RPO A;  4ELQ A;  2ESN A;  3MBP A;  1PB9 A;  5DYH A;  3MP8 A;  1B5J A;  1SI0 A;  3QK6 A;  1SI1 A;  3IOT A;  5H8H B;  4E0W A;  2O84 X;  4JB7 A;  2P0S A;  3F11 A;  3TTN A;  3QUJ A;  4HW8 A;  1N84 A;  2XXX A;  1MY4 A;  3FAT A;  1L5T A;  3Q26 A;  5I57 A;  4GD5 A;  4PFY A;  3C9H A;  3B7D A;  3FIR A;  4NF4 B;  5ELV A;  1P99 A;  2ZYO A;  4OEV A;  4H8I A;  3VXC A;  1R9Q A;  1IIT A;  3G3H A;  4XIG Q;  4O3A A;  3K00 A;  4ZE9 A;  1R6Z A;  3O2A A;  3MVX A;  3OO6 A;  3FJ7 A;  4F3B A;  1CB6 A;  2XXV A;  4ZDM A;  3H6U A;  3CRB A;  3HV1 A;  1N76 A;  3VVD A;  4RK2 A;  1NNK A;  2ZNU A;  4PET A;  2DYX A;  5I58 A;  1II5 A;  5LOM A;  1M5D A;  2E0S A; 
#chains in the Genus database with same CATH topology
 1N33 E;  2QMW A;  2LT7 A;  4DMI A;  4H1X A;  1K9Z A;  1FTK A;  2Q74 A;  5DTB A;  2RCB A;  4RPN A;  3TUS A;  3IR1 A;  4X9T A;  4TUG A;  4P47 A;  4R2D A;  4PAK A;  2GHB A;  2M1S A;  4HTG A;  3C4B A;  2OJT A;  2WYK A;  3KOS A;  3I5O A;  2V84 A;  4BHB A;  3KBZ A;  4YY3 E;  3DEL B;  2B7T A;  2DVC A;  1GV8 A;  3FGS A;  1N3G A;  5KL3 A;  4M9V C;  3TTR A;  2HQ0 A;  1MY3 A;  1FBP A;  2V83 A;  2REJ A;  2D3I A;  2B4L A;  3MUQ A;  3MPK A;  2UXD E;  1B7Z A;  2KON A;  3TCH A;  1I6A A;  1XMQ E;  4QFN A;  4YMB A;  3KZZ A;  1LBB A;  5KZT A;  4FAJ A;  5ICQ A;  3SEY A;  2AL4 A;  4EQB A;  1NNP A;  5KL2 A;  2A5T A;  1MG1 A;  3UOR A;  2F97 A;  3V8X B;  3IX1 A;  4G68 C;  1ZR9 A;  1MRP A;  1UQW A;  2YU5 A;  4U1O A;  3E78 A;  1TF3 A;  2Q8M A;  2L92 A;  1NEI A;  2J7J A;  5A6A A;  4WKM A;  1YAE A;  1D9V A;  2N8X A;  4WED A;  4BC9 A;  1X6E A;  3TZA A;  4F19 A;  1SW2 A;  2XHD A;  2GRV A;  1J26 A;  4NHR A;  2I6E A;  2HHH E;  3DP8 A;  4ONY A;  3T1H E;  2EM6 A;  2UVJ A;  4G68 B;  4QFP A;  4R2A A;  3C4M A;  4F2O A;  3PUV E;  3MPL A;  1NH8 A;  1SW4 A;  2OWT A;  2NUF A;  2HJJ A;  2O7I A;  4JVI A;  1DCU A;  4DV6 E;  1MXV A;  4L5N C;  3GZG A;  3SEU A;  2HAV A;  3J7Y p;  2YTE A;  1URD A;  1X49 A;  3OEM A;  4QBA A;  1M5C A;  2ONK E;  2Q8U A;  1IEJ A;  1R1N A;  1N3W A;  4PC9 A;  3QG5 C;  1A7L A;  2AIX A;  4N4U A;  3MVW A;  4LZ5 A;  3RTF B;  1RQ0 A;  3FVG A;  3TYH A;  2LRS A;  3J7A G;  2YTQ A;  4EUO A;  3PMV A;  1KA1 A;  1IXI A;  1MPD A;  4Q30 B;  3M8U A;  1HNZ E;  3R7X A;  4LUB A;  4UAB A;  1G2F C;  2RKM A;  1TN9 A;  4P7D A;  4UA8 A;  2F36 A;  2LCE A;  1PEB A;  3OOA A;  5IT9 C;  2P3N A;  3K6U A;  1YYO A;  2I4C A;  4NMY A;  3QYT A;  5A6B A;  4N81 A;  2FA7 A;  2L2K B;  1NV5 A;  4PF6 A;  3OMB A;  1X6F A;  3PD9 A;  2I4B A;  4F54 A;  3LML A;  3EKI A;  2EPC A;  1GTK A;  2Y5L A;  1FTO A;  2EOS A;  2MC6 A;  4BDN A;  4F22 A;  4NG7 A;  5B70 A;  5IM2 A;  3TCF A;  5AC5 A;  3RGY A;  5AA4 A;  3Q29 A;  4J8Z A;  3V89 B;  4EQ9 A;  1NV6 A;  3RMP A;  2XXP A;  3PU5 A;  3U93 A;  4LZ8 A;  4N6K A;  3IOW A;  4JSO A;  4Q5T A;  3ADI A;  1O0W A;  1T39 A;  3IOR A;  3FZV A;  1AL3 A;  4M4G A;  2YSO A;  2DOJ A;  2UU9 E;  5AA2 A;  4ZZA A;  1UIU A;  1N34 E;  1B32 A;  1LB8 A;  1JP4 A;  4O7I A;  1MXU A;  2MKZ A;  1BIY A;  4MNI A;  3ZSF A;  1X5W A;  4XEQ A;  2BBG A;  2B3F A;  2Q9T A;  2QS2 A;  3MZ9 A;  3ZS6 A;  1S50 A;  3ODB A;  2V3Q A;  2Z8E A;  2M8C A;  2EMF A;  2Y7I A;  2M4I A;  1HSE A;  4POX A;  3DP6 A;  3PD8 A;  3MHS C;  3P7I A;  2E5L E;  3D4G A;  1MY0 A;  1H44 A;  5BR8 E;  5H8Q A;  4ZYE A;  2DRP A;  1DTZ A;  2Y7W A;  5EQ8 A;  5IZ1 A;  3T0J A;  4GZN C;  1TF6 A;  4XTC Q;  2YTI A;  1EH8 A;  2OWS A;  2DIX A;  3OSR A;  1LAH E;  2OBG A;  3UIF A;  4R2E A;  2V85 A;  3FUZ A;  2ZNS A;  2EPP A;  2BB8 A;  3V83 A;  3FXQ A;  4X9J A;  2EMK A;  3T1B A;  5EHS A;  3H6W A;  1YFH A;  4RNS A;  4KWY A;  3ADJ A;  1Y1Z A;  1MM7 A;  3O6G A;  4QSC A;  4B3M E;  2YTN A;  4BDO A;  2NUE A;  4PP0 A;  4MF3 A;  1HR0 E;  3JYR A;  3AUZ A;  4OFJ A;  4QFO A;  2KQZ A;  2R1F A;  2XXK A;  3KJ7 A;  4NF5 B;  1ZJL A;  2VP1 A;  4OVQ A;  5KCJ B;  5AE4 A;  3T9V A;  1BKA A;  5JTY A;  2FIE A;  4YU0 A;  4KR5 A;  5DVF A;  3HFU A;  3C6K A;  5H8F A;  1KA0 A;  3N94 A;  3K1P A;  3ADL A;  4C0R A;  1MY2 A;  2QMX A;  3TEP A;  5ET8 A;  2EN8 A;  1XVX A;  1XC1 A;  3L6H A;  3OEN A;  3KWR A;  1FBG A;  1R9L A;  4DV7 E;  4DV0 E;  2F3D A;  3N26 A;  3PPN A;  1MPB A;  2ZXT A;  1GVC A;  2N3H A;  2O51 A;  4F3S A;  2YTJ A;  5CMM A;  1Z7N E;  5I56 A;  1Z7M E;  4PDH A;  5H8N B;  4MNC A;  2RC7 A;  1IBL E;  3J81 C;  4IJD A;  4G8N A;  4U4S A;  1P1N A;  4OVT A;  3THN A;  2FTX B;  1EZO A;  1NV1 A;  5IKB A;  4DV1 E;  2DB2 A;  1RDY A;  1MQI A;  1A1F A;  1MXW A;  5IV8 B;  4F1Y A;  4YB7 A;  1VSO A;  2FIX A;  3MVY A;  4WSP A;  1B58 A;  1URG A;  2JJK A;  4PGN A;  2HPG A;  3IWD A;  4HE2 A;  2JOX A;  1I69 A;  1KWH A;  1JEU A;  4OEU A;  2L8T A;  3QUF A;  3VVE A;  4NX1 A;  3QMF A;  4NTL A;  2WEF A;  5LTC A;  4P1L A;  4EF2 A;  1IMA A;  3THO B;  4OVS A;  4ZEC A;  1ZIU A;  2NXO A;  4DCX A;  5I84 A;  3M3F A;  3F6H A;  4P8B A;  4I8O A;  2F7C A;  4R6H A;  5T3J A;  2EMW A;  2XD3 A;  2JYA A;  4FBP A;  3FVO A;  2VRD A;  5CRY A;  3KSJ A;  4HEI A;  2VD2 A;  1J5E E;  4Z0I A;  1D9Y A;  2HXW A;  5TP9 A;  2H9B A;  3TMG A;  2ENH A;  4OVJ A;  3ADG A;  4DXB A;  3LLH A;  4YAH X;  1FQB A;  3SKP A;  2NVU B;  2JOB A;  2P1S A;  4BDR A;  1N36 E;  2EOO A;  3LUZ A;  4MEV A;  2HEU A;  2HZL A;  2HFB A;  4LN5 A;  5KDT B;  1UTH A;  2WCC 3;  5L9O A;  4WX9 A;  4F9B B;  1YYZ A;  2WZO A;  4GL0 A;  3JU0 A;  4POW A;  5KL6 A;  2JPA A;  2FBP A;  3W15 C;  1MQD A;  4NF0 A;  3IB1 A;  1JW1 A;  1FTL A;  2EN1 A;  1ZTY A;  1M5F A;  4G77 A;  3MWB A;  1URS A;  1USY E;  2EOR A;  2ZZX A;  1UIV A;  4JI8 E;  4G8M A;  2D5W A;  3KN8 A;  4K3F A;  5ITO A;  2DE3 A;  2OLB A;  5DEX A;  3VYY A;  1YZ9 A;  5I3S A;  3CR9 A;  5IZ3 A;  5EQA A;  3HQ1 A;  2F6P A;  4R2C A;  2VT5 A;  3TQW A;  3S9L C;  4AB5 A;  4P11 A;  2VE7 C;  3C6M A;  1PJS A;  4DR3 E;  3TFL A;  3T1Y E;  2O68 A;  3EPJ A;  4RJZ A;  2EMY A;  4YKJ A;  4OMB A;  1IQS A;  1D3K A;  4GXA A;  1WHQ A;  4OET A;  3S2V A;  1RMD A;  2WBD A;  3U94 A;  2EOJ A;  2Y7R A;  3FXB A;  1VDW A;  4EXL A;  5AE2 A;  4FK5 C;  2HAU A;  2XXY A;  4OWD A;  2YSP A;  4JWO A;  2UUB E;  1DI2 A;  4MLQ A;  1B3G A;  2JP9 A;  4NED A;  5TPA B;  3U92 A;  4YKP A;  2V25 A;  2V3U A;  2VQE E;  1NL5 A;  2LE2 A;  4MH5 A;  2XWK A;  3AXF A;  3FVK A;  3S9E A;  2L3C A;  1CE2 A;  4NQ8 A;  4YIC A;  3UP9 A;  4KD5 A;  2Q8J A;  2R8T A;  2ZNT A;  3GBB A;  4H46 A;  4ZEB A;  3S4U A;  2B65 A;  1KYQ A;  1FQA A;  1FKA E;  1STU A;  5TSE A;  2M9A A;  4OER A;  4ZE8 A;  3RLF E;  2B3B A;  3BFT A;  3SDF A;  2I13 A;  5EYF A;  3PUZ E;  5IAI A;  4IO7 A;  2F8B A;  4NF8 A;  2CTD A;  2EN2 A;  4RHB B;  4BHC A;  1I6B A;  3CHG A;  1D4N A;  4GEQ B;  1UBD C;  1EU8 A;  1OQH A;  4FAT A;  4BCA A;  3HTX A;  4I62 A;  4IO3 A;  2ANJ A;  3GBA A;  4MJO A;  2RS6 A;  4ELR A;  1B52 A;  5ET7 A;  1IME A;  2FNC A;  3S9N C;  5A69 A;  3CFL A;  3MVZ A;  3MZB A;  5AC4 A;  3G3G A;  1Y3N A;  4JWX A;  3IK6 B;  5A5X A;  2EM4 A;  1A1L A;  3OSQ A;  3JTZ A;  4HCW A;  4I9D A;  3BBG A;  5ADZ A;  1A40 A;  4IO5 A;  1B3H A;  2D21 A;  1FPE A;  4ISU A;  5FHM A;  3VLU A;  3K1N A;  1XMO E;  3R26 A;  3VHT B;  1DPP A;  2I58 A;  2GH9 A;  3EPH A;  2V93 A;  4KFQ A;  5A6K A;  2H25 A;  2MDR A;  2YTG A;  1WRJ A;  3GXA A;  2HHM A;  4EDP A;  4PBH A;  5M2V A;  1IXH A;  1IMF A;  3KC0 A;  2EMB A;  2LUP B;  1NI9 A;  1YYK A;  2H99 A;  4XKP A;  1QUL A;  4Z7E A;  1SYH A;  3EN3 A;  1FCK A;  2FGG A;  3K1M A;  2V3T A;  4G61 A;  2F3B A;  3TKD A;  4GKK E;  5LLQ A;  3QAX A;  2DQV A;  5I59 A;  4GWY A;  1RDX A;  2F6G A;  3K0V A;  3C4T A;  2L33 A;  5CMC A;  2CMO A;  1UN6 B;  2NAB A;  2LO3 A;  1EH3 A;  3OEL A;  4JXI A;  1SDX A;  2F8D A;  2XXT A;  4H67 A;  2HZK A;  4EQ7 A;  2ENA A;  1FPF A;  3K4U A;  2K4V A;  4IGT A;  1A8F A;  2UYE A;  2X7P A;  2ZMB A;  4LZ7 A;  3KBR A;  2EQ1 A;  4AS5 A;  4JDF A;  3R6U A;  3MZ1 A;  4AQ4 A;  2EP3 A;  1QKB A;  5I2N B;  3IOV A;  1WJP A;  4IS1 C;  5BUU A;  3QXM A;  3LSW A;  2RTX A;  1FQF A;  4PTK A;  5T6J A;  1OQG A;  1A1I A;  3KJT A;  1LBY A;  3OD7 A;  1Y3Q A;  4OTE A;  2JY9 A;  5F1Q A;  1KZ8 A;  1MH3 A;  3K6Q A;  4JV5 E;  1B1X A;  4NF6 B;  1OLA A;  3KEI A;  4LP2 B;  1IXC A;  1A1J A;  1PC3 A;  1MGT A;  1NNT A;  4JYA E;  1MQG A;  3IOU A;  4F1V A;  3UK3 C;  1SD3 A;  1P1W A;  2QFL A;  3DF6 A;  3TTK A;  3PPO A;  1P1U A;  1VR5 A;  3RN8 A;  4NE4 A;  4P78 A;  2P3V A;  1YXI A;  4DZ1 A;  3M99 B;  3E4R A;  3H7M A;  1MPC A;  2DDK A;  2VGQ A;  2Y84 A;  2JXP A;  2B7V A;  2V86 A;  2F7B A;  3U8Q A;  4GF8 A;  1IUD A;  3MJN A;  3I3V A;  3DLN A;  3RQT A;  4OA4 A;  1LFH A;  4U1Z A;  1YSA C;  4OX9 E;  1QUK A;  2L5V A;  3FVN A;  2QVU A;  4I1D A;  1FPL A;  3RT8 A;  2CSH A;  4RK9 A;  2I9I A;  3VK6 A;  2QJE A;  2M7Q A;  5A5L A;  5DVJ A;  1ZKB A;  5CFF E;  3U72 A;  2LUQ A;  1L4S A;  2XX9 A;  1POY 1;  3FJM A;  2RPC A;  1Z1B A;  3M3K A;  4MCO A;  4PFU A;  3B6W A;  3MHH C;  1JVY A;  1SW5 A;  4FED A;  4GLI A;  1BK4 A;  2BJJ X;  1SBP A;  4X48 A;  4YB5 A;  1P1O A;  1PB7 A;  1M5B A;  1ANF A;  4QF9 A;  2YPN A;  4I3E A;  3PPQ A;  5EHM A;  4QSE A;  1AOV A;  3TQL A;  4P56 A;  4TUI A;  4KPT A;  4GVO A;  4OEN A;  2R71 A;  1N04 A;  3EQ1 A;  1VE4 A;  1YCJ A;  3BBR A;  1A1G A;  1EZ9 A;  1NUX A;  4X1D A;  1K9Y A;  3K01 A;  2I0B A;  2NUV A;  3GLB A;  4IO2 A;  4TLM B;  4IO4 A;  4U22 A;  3RTW B;  4DV3 E;  4KI0 E;  3FIG A;  3FV2 A;  5DNY A;  4JI7 E;  4ZYG A;  1ZAA C;  2GPI A;  2Y7K A;  4Q35 B;  2MKN A;  5ICT A;  1PBP A;  2NA2 A;  4PAI A;  5JK4 A;  1FQD A;  3IFC A;  4DXU A;  1SVX B;  4GWX A;  2FYI A;  4R72 A;  1CNQ A;  4ND9 A;  1EH6 A;  1A99 A;  4XKR A;  3QIM A;  5KL4 A;  3LR1 A;  4O4K A;  3MW0 A;  1US4 A;  4N4R B;  4PE5 B;  2QS3 A;  4YKI A;  1B5H A;  4XKN A;  1FPK A;  4IB2 A;  4HS7 A;  3SET A;  5I58 B;  1TT1 A;  3HO7 A;  4BDQ A;  4NXN E;  4I3Y A;  2DXR A;  1X47 A;  3PGF A;  3N6U A;  1DMB A;  2RC9 A;  2D9H A;  2EOX A;  2LTR A;  1JEV A;  4P9K A;  4GXS B;  3KGC A;  3SEV A;  1FJ9 A;  1H3D A;  3ROJ A;  4ECF A;  4WXC A;  4JWY A;  2KR0 A;  1QNT A;  1N3X A;  1QGX A;  1AMF A;  1MXX A;  3FXR A;  5CBR A;  1SQY A;  2FV4 B;  2V87 A;  3G3K A;  4OHN A;  4WXJ A;  1N7W A;  1ZMG A;  1N32 E;  2QSX A;  4R2F A;  2O1L A;  4G2Z A;  1ZBT A;  2F7A A;  3LSX A;  1T4L B;  5LL6 R;  2REG A;  1T4N A;  1NNF A;  4R2B A;  1FPI A;  4WPY A;  5EQ7 A;  3FAS A;  1UTB A;  2A5S A;  2LVH A;  2HCA A;  3CVG A;  2YTF A;  2UUC E;  4PBQ A;  2EN7 A;  2G93 A;  2ALU A;  4R2R A;  2WBS A;  2XXW A;  5IXM B;  2ONR A;  2V4C A;  5AAS A;  4OXV A;  1LLS A;  2EPK X;  1QJM A;  4KQP A;  5AA1 A;  4ESX A;  3C33 A;  1B3E A;  3EPK A;  2HC5 A;  2BJI A;  4DR1 E;  1MDQ A;  4DDD A;  1OVB A;  1IXG A;  2EOM A;  2EPL X;  1NUZ A;  4LF5 E;  1Q9D A;  1IMB A;  2W7Y A;  2X26 A;  3FXU A;  4HE0 A;  5TPA A;  2LTS A;  2XXH A;  4DV5 E;  3MC2 A;  2UVI A;  1DSN A;  3USD A;  2DWI A;  1T0K A;  2YTP A;  4ZEI A;  4KYS A;  4TQU Q;  4DR6 E;  1B40 A;  2G29 A;  4FEC A;  2JR1 A;  5H8H A;  3ILT B;  2XWV A;  5L9M A;  2ELZ A;  1FQE A;  4GQO A;  2YWQ A;  2UVH A;  1RKM A;  2PBW A;  1TFD A;  2PVU A;  2ZZW A;  3EHS A;  3KZG A;  4LQ5 A;  3CG3 A;  2H36 X;  5TU0 A;  3HHG A;  3MYU A;  3A3U A;  4KHZ E;  4DR2 E;  4F6M A;  1XI6 A;  3A29 A;  4NXM E;  2QVV A;  4DE8 A;  4O7M A;  2R76 A;  3ECR A;  2IEE A;  2I3W A;  2R6G E;  2FVZ A;  1LBC A;  2CZI A;  4LFB E;  3LBS A;  3HPI A;  2EQ3 A;  1XNQ E;  2ABH A;  2K7I A;  4NF4 A;  4JI4 E;  2EM2 A;  1B05 A;  2XX8 A;  3OML A;  1NV7 A;  2EL4 A;  1A8E A;  3V5A A;  1B3L A;  5I2K B;  2RS7 A;  3VDF A;  1ZBQ A;  2UXB E;  1LST A;  2KHX A;  2ONS A;  2PX1 A;  2MKD A;  2L3J A;  2DWA A;  2DSY A;  1OVT A;  3KFM A;  2O1M A;  3CSG A;  4XKQ A;  1H45 A;  2JWO A;  4IY6 A;  1M5E A;  2EL5 A;  1UHZ A;  1NV3 A;  5FBP A;  2CT1 A;  1ZU1 A;  1EH7 A;  2EM8 A;  3PMW A;  5DVI A;  4FIM A;  3UN6 A;  3EPE A;  4EF1 A;  4P0G A;  4N6P A;  5AA4 B;  1QW0 A;  2DGC A;  4LFA E;  4DLD A;  1IMC A;  2PRT A;  1NUY A;  3UGW A;  3CFZ A;  3DM0 A;  2UVG A;  4F1U A;  4RA1 A;  1GR2 A;  4ZEF A;  3ZKK A;  3TAJ A;  5AA3 A;  2XXR A;  4ZEK A;  2EMI A;  4HE1 A;  2I3V A;  4JVC A;  2HXR A;  4LQ2 A;  4NGU A;  4QHQ A;  2Y7P A;  2E1S A;  4PFW A;  4BDM A;  5AA2 B;  5LDZ A;  1ZU0 A;  3RPL A;  1A55 A;  2GLI A;  2EJ4 A;  1FBD A;  2RSI A;  2P2A A;  4K0K E;  1QUI A;  2FHY A;  3RY3 A;  4MAG A;  3OEK A;  1ATG A;  4ZED A;  1DOT A;  2EN6 A;  1QUJ A;  4GFR A;  4R73 A;  3A3C A;  1GZ6 A;  4LF9 E;  1F9B A;  4X1B A;  3G3J A;  4QFL A;  2HGH A;  1B5I A;  4RY1 A;  4R2S A;  2YU8 A;  4N15 A;  3E9X A;  1IMU A;  1FTA A;  1G0H A;  5H8Q B;  4JVD A;  3PTY A;  3BGH A;  3O97 A;  3HST A;  4NN3 A;  3CFX A;  3MAM A;  3HPS A;  1TFA A;  4F2Q A;  3TCG A;  5I7I A;  1AIV A;  2DVZ A;  5I2N A;  1EYI A;  5K2Y A;  5FTH A;  4FJP A;  1FPD A;  5ITP A;  1QKA A;  1B4H A;  2V88 A;  2DWJ A;  2EPZ A;  2EOF A;  5EYH A;  4R8O A;  1MXY A;  1Y4C A;  5EYG A;  1FJG E;  2VHA A;  1XHY A;  3B6T A;  1I6Q A;  4YKK A;  1I94 E;  2ELY A;  1AWB A;  4BDL A;  4R9F A;  3EPL A;  2YLN A;  1G2D C;  3ZKL A;  3LC8 A;  3W9W A;  2KLF A;  1B51 A;  3MP6 A;  2OZZ A;  1NMU A;  2EM3 A;  2WBT A;  3WAE A;  3K02 A;  2I49 A;  4U4X A;  1BBO A;  1O63 A;  3K6X A;  1DGC A;  1WVJ A;  3UA8 A;  2YTD A;  2VOZ A;  1IIW A;  1NH7 A;  1VFE A;  4MHF A;  4JSD A;  1B46 A;  3TDJ A;  5J1D A;  3ISP A;  1KJK A;  4QRZ A;  3TPA A;  5H8F B;  4F29 A;  2XWO A;  4KYD A;  4R2P A;  4B3T E;  4PFR A;  2H98 A;  5ET5 A;  2L6M A;  2RIN A;  1XOC A;  3G3F A;  3H4Z A;  2EOY A;  2XXQ A;  1H76 A;  4G68 A;  1JQF A;  2CPN A;  3Q28 A;  3VFJ A;  2GQ1 A;  3PUY E;  2WKY A;  1LLM C;  2EE8 A;  2IHR 1;  4P1E A;  3IB2 A;  5CI5 A;  5I56 B;  4X66 E;  1NKX A;  2EPO A;  4G8H A;  2Z22 A;  2I0C A;  4GX4 A;  5K2X A;  2NWJ A;  4OFO A;  2MDG A;  1LCF A;  1O64 A;  2EPR A;  2OK2 A;  3L6G A;  4R6K A;  2RSM A;  4LVQ A;  4N6D A;  1D9Q A;  4BMJ A;  1HSJ A;  4R74 A;  4XXU A;  3CSB A;  2WX9 A;  4B3S E;  3TTL A;  4MMP A;  2DSF A;  5CMB A;  2EMX A;  3T9U A;  3RNN A;  2F35 A;  4PFT A;  5JEI A;  4U23 A;  1X48 A;  4JI2 E;  2XD2 A;  3OO7 A;  3VLV A;  4PQJ A;  3EF7 A;  2X7Q A;  3T93 B;  1OIB A;  5H8S A;  4LTY A;  3ZOQ B;  1Y3P A;  2Z8F A;  1Y20 A;  3PPR A;  3KN7 A;  3DJW A;  4C1T A;  1PBQ A;  1A1K A;  2DE2 A;  1JK2 A;  1O7T A;  1LGB C;  2PFY A;  1BLF A;  2EMH A;  4JBZ A;  5DT6 A;  4KZS A;  2YTO A;  2GHA A;  5TP9 B;  1EZP A;  4M0V A;  2Z23 A;  2DE4 A;  4QFK A;  4GKJ E;  2F78 A;  1IQO A;  1VFD A;  3C32 A;  3VLW A;  4X64 E;  4JI0 E;  1ZLQ A;  1MM6 A;  3IWB A;  4GIZ A;  2RC8 A;  3H3G A;  3MST A;  1NV2 A;  1Y1M A;  2G7H A;  2EL6 A;  2PYY A;  3LSF B;  2DMY A;  1UTH B;  4PFB A;  3T66 A;  4F31 B;  2PT2 A;  2ENC A;  1RC7 A;  1MXZ A;  1B7U A;  4F3G A;  4DV4 E;  4UAC A;  2F5X A;  1XVY A;  2DP8 A;  4NAP A;  2L2N A;  2QS4 A;  3B6Q A;  3BFU A;  3PUW E;  1DQ3 A;  4DV2 E;  2EOH A;  1JK1 A;  5AA2 D;  4U21 A;  1UIL A;  1FTM A;  4DUZ E;  3RUM A;  2EOZ A;  2OX3 A;  4PGP A;  4BC7 A;  5F7V A;  4GOT A;  2EM9 A;  4H6D A;  1FBF A;  2ZM6 E;  1BTJ A;  4JI5 E;  3H03 A;  5DEX B;  2O6A A;  5IZ3 B;  4FE8 A;  4WYQ B;  4MLV A;  1FBH A;  2GFE A;  3H06 B;  4H5F A;  4GWO A;  4L8N A;  4XF5 A;  3K6W A;  4Q28 A;  4OVR A;  3T9H B;  3K6V A;  3PMX A;  2GHF A;  2RQL A;  2B9D A;  3IJX B;  1B0L A;  2H4I A;  3BF2 A;  3SZP A;  2UUA E;  3O28 A;  3SEX A;  2CZL A;  3EHT A;  3UK4 A;  4B3R E;  5A2Q C;  5IZZ A;  1A54 A;  1B6H A;  4X04 A;  2EQ0 A;  4FEB A;  4H65 A;  1LFG A;  1B3F A;  4RYA A;  1X6H A;  4LAT A;  5HPQ A;  3FJG A;  3ONM A;  2PT1 A;  1LAF E;  3VXB A;  1B9J A;  1QVS A;  2UXA A;  1PDA A;  2XXI A;  3PPP A;  3AV0 A;  4P0I A;  2QRY A;  4DR4 E;  5CC2 A;  4Q0C A;  1FBC A;  1ZBM A;  2ADR A;  4F9A B;  1Q35 A;  2EN3 A;  4NF5 A;  2DS9 A;  5FTI A;  5KCJ A;  4KYE A;  3IL1 B;  4OES A;  2Q89 A;  4PCD A;  4PDD A;  3J80 C;  1WDN A;  1F2I G;  2LJU A;  3SES A;  3RYD A;  2QPQ A;  1P1Q A;  3M3L A;  4F18 A;  3N5L A;  4NF8 B;  3VE1 B;  2L2M A;  1FBE A;  3U1O A;  1XT8 A;  4ELP A;  1LBV A;  3L00 A;  1N7X A;  5J16 A;  4KCC A;  1RDZ A;  4GWW A;  4N91 A;  5I57 B;  1YZ0 A;  3MSW A;  4DIG A;  1MDP 1;  1AH5 A;  2ZYM A;  1JW5 A;  5H8N A;  2DLK A;  1IBK E;  4WEP A;  1LBW A;  4PE3 A;  3F6G A;  4DXC A;  3O29 A;  2EM5 A;  3JAM C;  5A5X B;  1BB8 A;  4DKK A;  1OLC A;  2Q2A A;  1B7H A;  4PAF A;  4IY5 A;  1SR9 A;  3P1X A;  1LBZ A;  4LFC E;  4X62 E;  2DXY A;  2F4V E;  5I2K A;  3LUY A;  1TXF A;  1Y4T A;  2ODR C;  3WAF A;  4ESW A;  4MX6 A;  4OZ9 A;  4F39 A;  4RH8 A;  2EOQ A;  4YZZ A;  3BKI B;  3LV0 A;  4AS4 A;  1WXR A;  1SPI A;  2MC5 A;  2ZYN A;  1EYK A;  3HN0 A;  3CI8 A;  2R9J A;  2VD3 A;  4GWU A;  4N07 A;  3IFA A;  1XS5 A;  3Q25 A;  2NOO A;  4MBP A;  2EPM X;  3CIJ A;  4MNP A;  3KOT A;  4AB6 A;  5I59 B;  3TQM A;  2QVR A;  3S9M C;  2JVA A;  4PF8 A;  2DMI A;  1S7Y A;  2RCA A;  4MIJ A;  3O6I A;  4X8R A;  1WHN A;  3E3K A;  3TEL A;  1EKZ A;  4YHH E;  1J1N A;  2YRM A;  2UYF A;  3VYX A;  5KDT A;  3VVF A;  3BIH A;  5F3W A;  1XNR E;  4X65 E;  2B3T B;  3IB0 A;  1FJ6 A;  4O3B A;  3SER A;  4EXK A;  4IO6 A;  3RPW A;  2EMC A;  1RYO A;  4ZZE A;  3Q27 A;  4ZYH A;  1LFI A;  2RF1 A;  3FV1 A;  4OYV A;  4R6Y A;  3O66 A;  1IZ1 A;  1FW0 A;  4IGR A;  5FHO A;  2F34 A;  2ZYK A;  3OO9 A;  2A25 A;  3VV5 A;  3U65 A;  5ET6 A;  2EZ6 A;  1LAX A;  3D4C A;  3KZY A;  5KL5 A;  1YTV A;  3PUX E;  3BID A;  4R9G A;  1MY1 A;  1USY H;  3O6H A;  1BBG A;  4DI4 B;  1PKP A;  2CZH A;  3OXN A;  5AE3 A;  3LSL A;  3SEW A;  2LJH A;  4OOG C;  3A09 A;  4YB6 A;  2YZT A;  1IQ7 A;  4GWS A;  2A5T B;  1Q1K A;  2VPN A;  3EHU A;  1SFE A;  2NUG A;  1SYI A;  2WBB A;  1FPB A;  1FPJ A;  2EML A;  3H6T A;  4KHP E;  3IJO B;  4M2Z A;  1YUI A;  5CBS A;  1RYX A;  4M1V A;  3TTM A;  1US5 A;  3C34 A;  5CM6 A;  3O9P A;  4C1U A;  4OVP A;  2Z8D A;  2E72 A;  3JZJ A;  4O3C A;  2N3G A;  2LAO A;  3C35 A;  4OFL A;  1ELJ A;  2V89 A;  4Q8R A;  2E1M A;  2EN4 A;  2LBS B;  2EPA A;  1FSA A;  4F3P A;  1MS7 A;  3KN3 A;  3DP4 A;  3HCQ A;  3E13 X;  4ZYD A;  1FTJ A;  1OMP A;  4F9C B;  1G0I A;  4ELO A;  4N17 A;  4THI A;  5EQ9 A;  4PFI A;  4TLL B;  2PFZ A;  3IO6 A;  2EM7 A;  4F6N A;  2H5Y A;  3T96 B;  1HNX E;  1FPG A;  4KXP A;  4BLA A;  2YJP A;  4WSG A;  2YRK A;  3I6V A;  1PJT A;  5ISU A;  3QSL A;  1JNF A;  2PCR A;  1T38 A;  3C31 A;  1GQE A;  2ZZV A;  2EM0 A;  2CZK A;  3G7W A;  2VQF E;  5B7D A;  4WXD A;  4O8M A;  2Q2C A;  2EOI A;  1MH4 A;  1P47 A;  1YPN A;  3OO8 A;  4NZV A;  1LB9 A;  1HNW E;  4R75 A;  1NCS A;  4HXV A;  4H0W A;  3T22 A;  2EPX A;  2PMS A;  3H6V A;  4QSD A;  2EMZ A;  4WFT A;  3TOD A;  4JI1 E;  1S9T A;  4JI6 E;  2EPU A;  2YRH A;  5FLX C;  2EWL A;  3G3I A;  1B0H A;  1MQH A;  1IMD A;  1NFT A;  5HBC A;  3HHF A;  1T4O A;  3W9V A;  4TOZ A;  1HSL A;  4I8C A;  1LAG E;  2LMZ A;  2EOE A;  2XX7 A;  2XA5 A;  1POT A;  2QL3 A;  1LEV A;  5DW8 A;  1B2H A;  1DK4 A;  2THI A;  4IR8 A;  5I5P A;  1IBM E;  4U2R A;  3BIG A;  5A6J A;  1MEY C;  3KG2 A;  4L17 A;  2KOU A;  1JVX A;  2EMA A;  3RT6 B;  4LON B;  3ILU B;  4M30 A;  1B4Z A;  3D1R A;  5CMK A;  4H5G A;  4DCY A;  1H43 A;  5KL7 A;  4JI3 E;  2WYP A;  2O7U A;  2Q88 A;  3K2D A;  4NHB A;  1NV0 A;  5HM4 B;  4R03 A;  5F24 A;  2LV2 A;  3FBP A;  1BP5 A;  3JV9 A;  1QU6 A;  1Y9U A;  3IAZ A;  1LCT A;  1TWY A;  5IGA A;  2ODR D;  4BS9 A;  4GL8 A;  3MP1 A;  3N6T A;  2AL5 A;  4R2Q A;  2CEX A;  2Y5K A;  4N13 A;  2IA4 A;  4GX3 A;  1B1H A;  2I48 A;  1JW4 A;  3C36 A;  4G4P A;  4GX6 A;  4XFE A;  5FHN A;  1PJQ A;  4ZS9 A;  2XWI A;  4GRK A;  4KCD A;  4N8G A;  1FQC A;  3H09 A;  4OAN A;  4YMA A;  4QXD A;  2CEY A;  2O69 A;  3IO4 A;  4FOR A;  1LBX A;  2B4M A;  4HCY A;  3KSX A;  1UTB B;  4BBY A;  4LF8 E;  4X8W A;  3MQ9 A;  1YYW A;  4NF6 A;  4P3L A;  1DTG A;  2OCU A;  5L8D A;  4NWD A;  1GGG A;  1SW1 A;  3E79 A;  4GWZ A;  5BWJ A;  5LMU E;  4OQO A;  3HPZ A;  3CG1 A;  3FD3 A;  3T9X B;  4DR5 E;  2XXU A;  4RXL A;  1JET A;  1NV4 A;  1N0T A;  3PV0 E;  5AE1 A;  4F2J C;  1PB8 A;  2DWH A;  4H8J A;  1MQJ A;  4NWC A;  5JTY B;  4MFI A;  3THI A;  5L9S A;  2AYS A;  4E0X A;  2OWZ A;  1DPE A;  2QS1 A;  4H45 A;  3GYY A;  4LA9 A;  1WOD A;  1INP A;  4RPO A;  4ELQ A;  1B69 A;  2DLQ A;  2ESN A;  3MBP A;  1PB9 A;  5DYH A;  4LU9 A;  3MP8 A;  4LF6 E;  1B5J A;  1X3C A;  4AQY E;  4DI3 D;  1SI0 A;  1FRP A;  3QK6 A;  1SI1 A;  3IOT A;  1NUW A;  5H8H B;  4E0W A;  2O84 X;  4DR7 E;  3NOH A;  4JB7 A;  2P0S A;  3F11 A;  3TTN A;  2UXC E;  2VF1 A;  3QUJ A;  5LMN E;  4HW8 A;  1N84 A;  4O5G A;  3KC1 A;  2XXX A;  1MY4 A;  2EPN A;  3FAT A;  1L5T A;  4N8Y A;  2V8Q B;  3Q26 A;  5I57 A;  2WBU A;  4GD5 A;  4PFY A;  4LF4 E;  2EMG A;  3C9H A;  3B7D A;  3FIR A;  4NF4 B;  5ELV A;  1P99 A;  1AAY A;  2ZYO A;  4OEV A;  4GBW A;  4H8I A;  3VXC A;  4O43 A;  4I40 A;  1R9Q A;  1IIT A;  3G3H A;  4XIG Q;  1A1H A;  4O3A A;  3K00 A;  4ZE9 A;  4GBV A;  1EYJ A;  1R6Z A;  3O2A A;  3MVX A;  3B8B A;  5A6B D;  4LF7 E;  3OO6 A;  3B50 A;  3FJ7 A;  4F3B A;  1CB6 A;  2YT4 A;  2XXV A;  4O94 A;  4ZDM A;  3H6U A;  3CRB A;  3HV1 A;  3OTO E;  1N76 A;  3VVD A;  5ESY A;  3HXL A;  2VPO A;  4DUY E;  3IWC A;  1YUJ A;  4RK2 A;  1NNK A;  1DBZ A;  2ZNU A;  4PET A;  2DYX A;  5IWA E;  5I58 A;  1II5 A;  3RPL B;  5LOM A;  4O24 A;  1M5D A;  2E0S A; 
#chains in the Genus database with same CATH homology
 2QMW A;  4H1X A;  1FTK A;  5DTB A;  2RCB A;  4RPN A;  3TUS A;  3IR1 A;  4X9T A;  2GHB A;  4HTG A;  2OJT A;  3KOS A;  3I5O A;  2V84 A;  3DEL B;  2DVC A;  1GV8 A;  3FGS A;  3TTR A;  2HQ0 A;  1MY3 A;  2REJ A;  2D3I A;  3MUQ A;  3MPK A;  1B7Z A;  3TCH A;  1I6A A;  4QFN A;  4YMB A;  1LBB A;  5KZT A;  4FAJ A;  5ICQ A;  3SEY A;  2AL4 A;  4EQB A;  1NNP A;  3UOR A;  2A5T A;  1MG1 A;  3V8X B;  2F97 A;  3IX1 A;  4G68 C;  1MRP A;  1UQW A;  4U1O A;  4WKM A;  1YAE A;  1D9V A;  4WED A;  3TZA A;  4F19 A;  1SW2 A;  2XHD A;  2GRV A;  2I6E A;  3DP8 A;  4ONY A;  2UVJ A;  4G68 B;  4QFP A;  3C4M A;  4F2O A;  3PUV E;  3MPL A;  1NH8 A;  1SW4 A;  2OWT A;  2O7I A;  1MXV A;  3GZG A;  3SEU A;  2HAV A;  1URD A;  3OEM A;  1M5C A;  2ONK E;  1IEJ A;  1R1N A;  1N3W A;  1A7L A;  2AIX A;  3MVW A;  4LZ5 A;  3RTF B;  3FVG A;  3TYH A;  4EUO A;  3PMV A;  1IXI A;  1MPD A;  4Q30 B;  3M8U A;  3R7X A;  4LUB A;  2RKM A;  4UA8 A;  2F36 A;  1PEB A;  3OOA A;  3K6U A;  2I4C A;  4NMY A;  3QYT A;  2FA7 A;  3OMB A;  3PD9 A;  2I4B A;  1GTK A;  4F22 A;  1FTO A;  4BDN A;  5B70 A;  3TCF A;  3RGY A;  5AA4 A;  3Q29 A;  3V89 B;  4EQ9 A;  2XXP A;  3PU5 A;  3U93 A;  4LZ8 A;  3IOW A;  4JSO A;  4Q5T A;  3IOR A;  3FZV A;  1AL3 A;  4M4G A;  2DOJ A;  5AA2 A;  4ZZA A;  1UIU A;  1B32 A;  1LB8 A;  1MXU A;  1BIY A;  3ZSF A;  2B3F A;  2Q9T A;  2QS2 A;  3MZ9 A;  3ZS6 A;  1S50 A;  3ODB A;  2V3Q A;  2Z8E A;  2M8C A;  2Y7I A;  1HSE A;  4POX A;  3DP6 A;  3PD8 A;  3P7I A;  3D4G A;  1MY0 A;  1H44 A;  5H8Q A;  1DTZ A;  2Y7W A;  4XTC Q;  2OWS A;  3OSR A;  1LAH E;  2OBG A;  3UIF A;  3FUZ A;  2ZNS A;  3V83 A;  3FXQ A;  5EHS A;  3H6W A;  4RNS A;  1Y1Z A;  1MM7 A;  3O6G A;  4QSC A;  4BDO A;  4PP0 A;  4MF3 A;  3JYR A;  4OFJ A;  4QFO A;  3KJ7 A;  4NF5 B;  1ZJL A;  2VP1 A;  5KCJ B;  5AE4 A;  3T9V A;  1BKA A;  5JTY A;  4YU0 A;  4KR5 A;  5DVF A;  5H8F A;  3N94 A;  3K1P A;  4C0R A;  1MY2 A;  2QMX A;  3TEP A;  1XVX A;  1XC1 A;  3L6H A;  3OEN A;  1R9L A;  3N26 A;  3PPN A;  1MPB A;  2ZXT A;  1GVC A;  2O51 A;  4F3S A;  5CMM A;  1Z7N E;  5I56 A;  1Z7M E;  5H8N B;  2RC7 A;  4U4S A;  4G8N A;  1P1N A;  1EZO A;  5IKB A;  1MQI A;  1MXW A;  4F1Y A;  4YB7 A;  1VSO A;  3MVY A;  1B58 A;  1URG A;  1I69 A;  1KWH A;  1JEU A;  4OEU A;  3QUF A;  3VVE A;  4NTL A;  4EF2 A;  4ZEC A;  1ZIU A;  2NXO A;  4DCX A;  5I84 A;  3M3F A;  2F7C A;  4R6H A;  2XD3 A;  3FVO A;  5CRY A;  3KSJ A;  2VD2 A;  4Z0I A;  1D9Y A;  2HXW A;  5TP9 A;  2H9B A;  3TMG A;  4OVJ A;  4DXB A;  4YAH X;  1FQB A;  3SKP A;  2NVU B;  2P1S A;  4BDR A;  2HEU A;  2HZL A;  2HFB A;  5KDT B;  1UTH A;  5L9O A;  4GL0 A;  4POW A;  3W15 C;  1MQD A;  3IB1 A;  1JW1 A;  1FTL A;  1ZTY A;  1M5F A;  4G77 A;  3MWB A;  1URS A;  1USY E;  1UIV A;  4G8M A;  2D5W A;  3KN8 A;  4K3F A;  5ITO A;  2DE3 A;  2OLB A;  5DEX A;  3CR9 A;  2F6P A;  3TQW A;  3S9L C;  4AB5 A;  4P11 A;  3TFL A;  2O68 A;  4RJZ A;  4YKJ A;  4OMB A;  1D3K A;  4GXA A;  4OET A;  3S2V A;  3U94 A;  2Y7R A;  4EXL A;  2HAU A;  2XXY A;  4OWD A;  4JWO A;  4MLQ A;  1B3G A;  4NED A;  5TPA B;  3U92 A;  4YKP A;  2V25 A;  2V3U A;  1NL5 A;  4MH5 A;  3AXF A;  3FVK A;  3S9E A;  1CE2 A;  4YIC A;  3UP9 A;  4KD5 A;  2Q8J A;  2ZNT A;  3GBB A;  4ZEB A;  3S4U A;  2B65 A;  1FQA A;  4OER A;  4ZE8 A;  3RLF E;  2B3B A;  3BFT A;  3SDF A;  5EYF A;  3PUZ E;  5IAI A;  4IO7 A;  4NF8 A;  1I6B A;  1D4N A;  1EU8 A;  1OQH A;  4FAT A;  4I62 A;  4IO3 A;  2ANJ A;  3GBA A;  4ELR A;  1B52 A;  2FNC A;  3S9N C;  3CFL A;  3MVZ A;  3MZB A;  3G3G A;  1Y3N A;  4JWX A;  3IK6 B;  5A5X A;  3OSQ A;  4I9D A;  4HCW A;  1A40 A;  4IO5 A;  1B3H A;  2D21 A;  4ISU A;  5FHM A;  3VLU A;  3K1N A;  3R26 A;  1DPP A;  2I58 A;  2GH9 A;  2V93 A;  4KFQ A;  2H25 A;  3GXA A;  4EDP A;  5M2V A;  1IXH A;  2H99 A;  4Z7E A;  4XKP A;  1QUL A;  1SYH A;  3EN3 A;  1FCK A;  3K1M A;  2V3T A;  3TKD A;  3QAX A;  2DQV A;  5I59 A;  2F6G A;  3K0V A;  5CMC A;  2CMO A;  1EH3 A;  3OEL A;  4JXI A;  1SDX A;  2F8D A;  2XXT A;  4H67 A;  2HZK A;  4EQ7 A;  3K4U A;  4IGT A;  1A8F A;  2UYE A;  2X7P A;  2ZMB A;  4LZ7 A;  3KBR A;  4JDF A;  3R6U A;  3MZ1 A;  4AQ4 A;  1QKB A;  5I2N B;  3IOV A;  5BUU A;  3QXM A;  3LSW A;  1FQF A;  1OQG A;  3KJT A;  3OD7 A;  1Y3Q A;  4OTE A;  5F1Q A;  1MH3 A;  1B1X A;  4NF6 B;  1OLA A;  3KEI A;  4LP2 B;  1IXC A;  1PC3 A;  1NNT A;  1MQG A;  3IOU A;  4F1V A;  1SD3 A;  1P1W A;  3TTK A;  3PPO A;  1P1U A;  1VR5 A;  3RN8 A;  4NE4 A;  4DZ1 A;  3E4R A;  3H7M A;  1MPC A;  2VGQ A;  2Y84 A;  2F7B A;  3U8Q A;  4GF8 A;  1IUD A;  3MJN A;  3I3V A;  3DLN A;  3RQT A;  1LFH A;  4U1Z A;  1QUK A;  3FVN A;  4I1D A;  3RT8 A;  4RK9 A;  2QJE A;  5DVJ A;  1ZKB A;  3U72 A;  2XX9 A;  1POY 1;  3FJM A;  4PFU A;  3M3K A;  3B6W A;  1JVY A;  1SW5 A;  4FED A;  4GLI A;  2BJJ X;  1SBP A;  4X48 A;  4YB5 A;  1P1O A;  1PB7 A;  1M5B A;  1ANF A;  4QF9 A;  2YPN A;  3PPQ A;  5EHM A;  4QSE A;  1AOV A;  3TQL A;  4KPT A;  4GVO A;  4OEN A;  2R71 A;  1N04 A;  3EQ1 A;  1VE4 A;  1YCJ A;  3BBR A;  1EZ9 A;  4X1D A;  3K01 A;  2I0B A;  2NUV A;  3GLB A;  4IO2 A;  4TLM B;  4IO4 A;  4U22 A;  3RTW B;  4KI0 E;  3FV2 A;  2Y7K A;  5ICT A;  1PBP A;  5JK4 A;  1FQD A;  4DXU A;  1SVX B;  2FYI A;  4R72 A;  4ND9 A;  1A99 A;  4XKR A;  3QIM A;  3LR1 A;  3MW0 A;  1US4 A;  4PE5 B;  2QS3 A;  4YKI A;  1B5H A;  4XKN A;  4IB2 A;  4HS7 A;  3SET A;  5I58 B;  1TT1 A;  3HO7 A;  4BDQ A;  2DXR A;  3PGF A;  3N6U A;  1DMB A;  2RC9 A;  1JEV A;  4GXS B;  3KGC A;  3SEV A;  1H3D A;  4ECF A;  4JWY A;  1N3X A;  1AMF A;  1MXX A;  3FXR A;  5CBR A;  1SQY A;  3G3K A;  4OHN A;  4WXJ A;  1N7W A;  1ZMG A;  2QSX A;  4R2F A;  2O1L A;  4G2Z A;  2F7A A;  3LSX A;  2REG A;  1NNF A;  4R2B A;  3FAS A;  1UTB A;  2A5S A;  2HCA A;  3CVG A;  2G93 A;  2ALU A;  2XXW A;  2ONR A;  4OXV A;  1LLS A;  1QJM A;  4KQP A;  5AA1 A;  4ESX A;  3C33 A;  1B3E A;  1MDQ A;  4DDD A;  1OVB A;  1IXG A;  2W7Y A;  2X26 A;  3FXU A;  5TPA A;  2XXH A;  3MC2 A;  2UVI A;  1DSN A;  3USD A;  2DWI A;  1T0K A;  4ZEI A;  4KYS A;  4TQU Q;  1B40 A;  2G29 A;  4FEC A;  5H8H A;  3ILT B;  5L9M A;  1FQE A;  4GQO A;  2UVH A;  1RKM A;  2PBW A;  1TFD A;  2PVU A;  3EHS A;  3KZG A;  4LQ5 A;  3CG3 A;  5TU0 A;  3HHG A;  3A3U A;  4KHZ E;  4DE8 A;  3ECR A;  2IEE A;  2I3W A;  2R6G E;  1LBC A;  3LBS A;  3HPI A;  2ABH A;  4NF4 A;  1B05 A;  2XX8 A;  1A8E A;  3V5A A;  1B3L A;  5I2K B;  3VDF A;  1LST A;  2ONS A;  2PX1 A;  2DWA A;  1OVT A;  3KFM A;  2O1M A;  3CSG A;  4XKQ A;  1H45 A;  4IY6 A;  1M5E A;  3PMW A;  5DVI A;  4FIM A;  3UN6 A;  3EPE A;  4EF1 A;  4P0G A;  4N6P A;  5AA4 B;  1QW0 A;  4DLD A;  3UGW A;  3CFZ A;  3DM0 A;  2UVG A;  4F1U A;  4RA1 A;  1GR2 A;  4ZEF A;  3ZKK A;  3TAJ A;  5AA3 A;  2XXR A;  4ZEK A;  2I3V A;  4LQ2 A;  4QHQ A;  2Y7P A;  2E1S A;  4PFW A;  4BDM A;  5AA2 B;  1ZU0 A;  1A55 A;  2P2A A;  1QUI A;  3RY3 A;  3OEK A;  1ATG A;  4ZED A;  1DOT A;  1QUJ A;  4GFR A;  4R73 A;  3A3C A;  1F9B A;  4X1B A;  3G3J A;  4QFL A;  1B5I A;  4RY1 A;  3E9X A;  5H8Q B;  3O97 A;  3HST A;  3CFX A;  3MAM A;  1TFA A;  4F2Q A;  3TCG A;  1AIV A;  2DVZ A;  5I2N A;  5K2Y A;  5FTH A;  4FJP A;  5ITP A;  1QKA A;  1B4H A;  2DWJ A;  1MXY A;  1Y4C A;  2VHA A;  1XHY A;  3B6T A;  1I6Q A;  4YKK A;  4BDL A;  4R9F A;  2YLN A;  3ZKL A;  3LC8 A;  3W9W A;  2KLF A;  1B51 A;  3MP6 A;  2OZZ A;  1NMU A;  3WAE A;  3K02 A;  2I49 A;  4U4X A;  1O63 A;  3K6X A;  1WVJ A;  3UA8 A;  2VOZ A;  1IIW A;  1NH7 A;  1VFE A;  4JSD A;  1B46 A;  3TDJ A;  5J1D A;  4QRZ A;  3TPA A;  5H8F B;  4F29 A;  4KYD A;  2H98 A;  2RIN A;  1XOC A;  3G3F A;  3H4Z A;  2XXQ A;  1H76 A;  4G68 A;  1JQF A;  3Q28 A;  3VFJ A;  3PUY E;  2WKY A;  3IB2 A;  5CI5 A;  5I56 B;  1NKX A;  4G8H A;  2Z22 A;  2I0C A;  5K2X A;  2NWJ A;  4OFO A;  1LCF A;  1O64 A;  2OK2 A;  3L6G A;  4R6K A;  4LVQ A;  1HSJ A;  4R74 A;  4XXU A;  3CSB A;  3TTL A;  2DSF A;  5CMB A;  3T9U A;  3RNN A;  2F35 A;  4PFT A;  5JEI A;  4U23 A;  2XD2 A;  3OO7 A;  3VLV A;  4PQJ A;  3EF7 A;  2X7Q A;  3T93 B;  1OIB A;  5H8S A;  1Y3P A;  2Z8F A;  1Y20 A;  3PPR A;  3KN7 A;  4C1T A;  1PBQ A;  2DE2 A;  1O7T A;  1LGB C;  5DT6 A;  1BLF A;  4JBZ A;  5TP9 B;  2GHA A;  1EZP A;  2Z23 A;  2DE4 A;  4QFK A;  2F78 A;  1VFD A;  3C32 A;  3VLW A;  1ZLQ A;  1MM6 A;  4GIZ A;  2RC8 A;  3H3G A;  1Y1M A;  2PYY A;  3LSF B;  1UTH B;  3T66 A;  4F31 B;  2PT2 A;  1MXZ A;  1B7U A;  4F3G A;  4UAC A;  2F5X A;  1XVY A;  2DP8 A;  2QS4 A;  3B6Q A;  3BFU A;  3PUW E;  5AA2 D;  4U21 A;  1FTM A;  3RUM A;  5F7V A;  4GOT A;  4H6D A;  1BTJ A;  3H03 A;  5DEX B;  2O6A A;  4FE8 A;  4MLV A;  2GFE A;  3H06 B;  4H5F A;  4GWO A;  3K6W A;  3T9H B;  3K6V A;  3PMX A;  3IJX B;  1B0L A;  2H4I A;  3O28 A;  3SEX A;  2CZL A;  3EHT A;  3UK4 A;  1A54 A;  1B6H A;  4FEB A;  4H65 A;  1LFG A;  1B3F A;  4RYA A;  4LAT A;  5HPQ A;  3FJG A;  3ONM A;  2PT1 A;  1LAF E;  3VXB A;  1B9J A;  1QVS A;  2UXA A;  1PDA A;  2XXI A;  3PPP A;  4P0I A;  2QRY A;  5CC2 A;  4Q0C A;  1ZBM A;  1Q35 A;  4NF5 A;  2DS9 A;  5FTI A;  5KCJ A;  4KYE A;  3IL1 B;  4OES A;  2Q89 A;  1WDN A;  3SES A;  2QPQ A;  1P1Q A;  3M3L A;  4F18 A;  3N5L A;  4NF8 B;  3VE1 B;  3U1O A;  1XT8 A;  4ELP A;  1N7X A;  4KCC A;  5I57 B;  4DIG A;  1MDP 1;  1AH5 A;  2ZYM A;  1JW5 A;  5H8N A;  4WEP A;  4DXC A;  3O29 A;  5A5X B;  1OLC A;  2Q2A A;  1B7H A;  4IY5 A;  2DXY A;  5I2K A;  3LUY A;  1TXF A;  1Y4T A;  3WAF A;  4ESW A;  4OZ9 A;  4F39 A;  4YZZ A;  3BKI B;  2ZYN A;  3HN0 A;  3CI8 A;  2R9J A;  2VD3 A;  4N07 A;  1XS5 A;  3Q25 A;  2NOO A;  4MBP A;  3CIJ A;  3KOT A;  4AB6 A;  5I59 B;  3S9M C;  1S7Y A;  2RCA A;  3O6I A;  3E3K A;  3TEL A;  1J1N A;  2UYF A;  5KDT A;  3VVF A;  3IB0 A;  4O3B A;  3SER A;  4EXK A;  4IO6 A;  3RPW A;  1RYO A;  4ZZE A;  3Q27 A;  1LFI A;  2RF1 A;  3FV1 A;  4OYV A;  4R6Y A;  3O66 A;  1IZ1 A;  1FW0 A;  4IGR A;  5FHO A;  2F34 A;  2ZYK A;  3OO9 A;  3VV5 A;  1LAX A;  3D4C A;  1YTV A;  3PUX E;  4R9G A;  1MY1 A;  1USY H;  3O6H A;  3OXN A;  3LSL A;  3SEW A;  3A09 A;  4YB6 A;  1IQ7 A;  2A5T B;  1Q1K A;  3EHU A;  1SYI A;  3H6T A;  3IJO B;  5CBS A;  1RYX A;  4M1V A;  3TTM A;  1US5 A;  3C34 A;  5CM6 A;  3O9P A;  4C1U A;  2Z8D A;  3JZJ A;  4O3C A;  2LAO A;  3C35 A;  4OFL A;  1ELJ A;  4Q8R A;  4F3P A;  1MS7 A;  3KN3 A;  3DP4 A;  3HCQ A;  3E13 X;  1FTJ A;  1OMP A;  4ELO A;  4THI A;  4TLL B;  3IO6 A;  2H5Y A;  3T96 B;  4BLA A;  2YJP A;  3I6V A;  5ISU A;  3QSL A;  1JNF A;  3C31 A;  3G7W A;  5B7D A;  2Q2C A;  1MH4 A;  1YPN A;  3OO8 A;  1LB9 A;  4R75 A;  4H0W A;  3T22 A;  4QSD A;  2PMS A;  3H6V A;  3TOD A;  1S9T A;  3G3I A;  1B0H A;  1MQH A;  1NFT A;  5HBC A;  3HHF A;  3W9V A;  4TOZ A;  1HSL A;  4I8C A;  1LAG E;  2XX7 A;  1POT A;  2QL3 A;  1B2H A;  2THI A;  4U2R A;  3KG2 A;  4L17 A;  1JVX A;  3RT6 B;  4LON B;  3ILU B;  1B4Z A;  5CMK A;  4H5G A;  4DCY A;  1H43 A;  2O7U A;  2Q88 A;  3K2D A;  5HM4 B;  1BP5 A;  3JV9 A;  1Y9U A;  3IAZ A;  1LCT A;  1TWY A;  4GL8 A;  3MP1 A;  3N6T A;  2AL5 A;  4N13 A;  2IA4 A;  1B1H A;  2I48 A;  1JW4 A;  3C36 A;  4G4P A;  5FHN A;  4ZS9 A;  4GRK A;  4KCD A;  1FQC A;  4YMA A;  2O69 A;  3IO4 A;  4FOR A;  4HCY A;  3KSX A;  1UTB B;  3MQ9 A;  4NF6 A;  1DTG A;  2OCU A;  5L8D A;  4NWD A;  1GGG A;  1SW1 A;  5BWJ A;  4OQO A;  3CG1 A;  3FD3 A;  3T9X B;  2XXU A;  4RXL A;  1JET A;  1N0T A;  3PV0 E;  1PB8 A;  2DWH A;  4H8J A;  1MQJ A;  4NWC A;  5JTY B;  4MFI A;  3THI A;  5L9S A;  2AYS A;  4E0X A;  1DPE A;  2QS1 A;  4LA9 A;  1WOD A;  4RPO A;  4ELQ A;  2ESN A;  3MBP A;  1PB9 A;  5DYH A;  3MP8 A;  1B5J A;  1SI0 A;  3QK6 A;  1SI1 A;  3IOT A;  5H8H B;  4E0W A;  2O84 X;  4JB7 A;  2P0S A;  3F11 A;  3TTN A;  3QUJ A;  4HW8 A;  1N84 A;  2XXX A;  1MY4 A;  3FAT A;  1L5T A;  3Q26 A;  5I57 A;  4GD5 A;  4PFY A;  3C9H A;  3B7D A;  3FIR A;  4NF4 B;  5ELV A;  1P99 A;  2ZYO A;  4OEV A;  4H8I A;  3VXC A;  1R9Q A;  1IIT A;  3G3H A;  4XIG Q;  4O3A A;  3K00 A;  4ZE9 A;  1R6Z A;  3O2A A;  3MVX A;  3OO6 A;  3FJ7 A;  4F3B A;  1CB6 A;  2XXV A;  4ZDM A;  3H6U A;  3CRB A;  3HV1 A;  1N76 A;  3VVD A;  4RK2 A;  1NNK A;  2ZNU A;  4PET A;  2DYX A;  5I58 A;  1II5 A;  5LOM A;  1M5D A;  2E0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...