3EQ1A

The crystal structure of human porphobilinogen deaminase at 2.8a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
338
structure length
312
Chain Sequence
RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPQHEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
publication title Structure of human porphobilinogen deaminase at 2.8 A: the molecular basis of acute intermittent porphyria
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 312
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3eq1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A02
3F11A 2OWTA 2QSXA 3TQLA 4F2QA 1Y3NA 2I3WA 5EHSA 3EN3A 3N6TA 3T9UA 5I2NB 1NKXA 1JEUA 1IIWA 1GTKA 4R6HA 4G8NA 2DXRA 2F8DA 2B3BA 2REJA 4LONB 4JSOA 1NNFA 1AL3A 3LSWA 1EZOA 1B0HA 2PBWA 2Y7KA 3VVFA 4IO5A 3CVGA 3H7MA 4LZ5A 4ECFA 5I58A 4M1VA 1UIVA 3DM0A 3TFLA 3S9EA 1IUDA 3U93A 2QJEA 3WAEA 5H8FA 3FJ7A 2Z8EA 1MM6A 4NWCA 1DPEA 1Y1MA 2YLNA 3FATA 4U1ZA 4H8JA 5TPAA 1DTZA 2I0BA 1PB7A 2RC7A 4RY1A 4G77A 5FTHA 3FXQA 4QFNA 3BBRA 3GLBA 1Y9UA 4X1BA 4IO3A 1POY1 4KCDA 3HPIA 3UORA 2DOJA 4YKIA 3TCFA 4FATA 4ELPA 2QL3A 1N7XA 4RPOA 1P1QA 5A5XB 5IAIA 3K1MA 2VHAA 1MH4A 2V3QA 3SESA 4Q0CA 3TODA 4RXLA 5CMBA 1II5A 3IOUA 3K0VA 4ELRA 2NWJA 3TTMA 1LFIA 2V93A 1P99A 4P0GA 3FD3A 4F19A 3TCGA 1LFGA 3MUQA 2GRVA 2QS4A 4DZ1A 1LGBC 3C36A 3T22A 3IAZA 1D4NA 4RNSA 3TTKA 4XKQA 5BWJA 2ALUA 2XXQA 3OMBA 1B3FA 2Y7IA 2OLBA 1N04A 1QULA 4GLIA 1ATGA 1N3WA 3VVEA 5J1DA 4JBZA 5ITOA 3JYRA 5I2KB 1LFHA 4DXBA 2DVCA 4RK2A 4G68B 4THIA 1B5HA 3T9XB 4ZEBA 3A3CA 3K00A 2GFEA 4C0RA 4Q8RA 3MP8A 2OZZA 1M5BA 3E13X 3B6TA 3LR1A 4F39A 4OFOA 4QSDA 3MP6A 4YAHX 1SQYA 1LAGE 3DELB 4QFKA 5TU0A 1D3KA 2I4CA 4ZE8A 2D5WA 4F3PA 4XIGQ 3B7DA 2ESNA 4PQJA 1XHYA 1FTLA 5FHOA 2XXTA 1B5IA 3HO7A 1P1UA 3MWBA 4KYDA 4HCWA 4JXIA 1UTBA 1B4HA 4MFIA 4F18A 1HSEA 1AOVA 2DSFA 1URSA 1B32A 4DCYA 3G3IA 1ZIUA 1M5FA 4GWOA 2QMXA 4ZEDA 3H6UA 3T66A 4F31B 3ILTB 2M8CA 2DWAA 3EHUA 2PVUA 1JVYA 1NMUA 4DE8A 4MLQA 3I3VA 2XXRA 1ZTYA 4OMBA 4LZ8A 1MRPA 3M3LA 4LZ7A 3PUVE 1YPNA 5KZTA 1Z7ME 3LSXA 3FZVA 5L8DA 1QW0A 2ZYNA 1IXGA 4LQ2A 3M8UA 1B58A 1LBCA 2IEEA 3L6HA 3E3KA 1A54A 1A8EA 4NF8A 2NVUB 2Q9TA 4DDDA 1QVSA 3Q28A 2HZKA 3K01A 4KPTA 2VOZA 2Q88A 5F1QA 1FQBA 1TFDA 1OQGA 3LC8A 3USDA 2H9BA 3FASA 1OMPA 1MY1A 1MXUA 1MXYA 2QS2A 3KFMA 3KN3A 4N13A 3B6QA 1OLAA 1FQCA 1P1WA 5FHMA 1A99A 1XVYA 1MQDA 1IZ1A 5AA2B 2Q89A 2I6EA 4LQ5A 5L9MA 1Y20A 3SEWA 3T96B 2DQVA 1P1NA 4KD5A 1B0LA 2O7IA 5H8SA 3LUYA 3V5AA 5I2NA 5AA3A 1L5TA 2F7AA 4R72A 5IKBA 1EU8A 2V3TA 4EQBA 1IXCA 3MP1A 4X48A 4IO7A 1NNTA 3FXUA 1PB8A 4IGTA 1M5EA 3TZAA 4EF1A 2B65A 3S9MC 4NF4B 3VE1B 2I48A 1FTOA 2GHAA 3VLVA 2W7YA 4BDOA 4QSEA 3ZS6A 1N84A 2DVZA 4BDMA 3M3FA 2XXXA 4EUOA 2FA7A 2HEUA 1B1HA 2REGA 3EQ1A 1S50A 4G8HA 4QFPA 1SW5A 4NF5B 4F3BA 4GXAA 2FYIA 3H3GA 4R73A 4R9FA 2Q8JA 3FUZA 3VDFA 2QS1A 4DXUA 3DP6A 4K3FA 2VD2A 1XT8A 4YMBA 1DMBA 2RINA 3MBPA 2HAUA 3RLFE 1B51A 4R9GA 1ZKBA 2E0SA 2ZNSA 3UA8A 4ELOA 4JWOA 4YKJA 3RNNA 4F1VA 4QFLA 3PPQA 2RC9A 2Q2CA 3LSLA 4TOZA 4R6KA 3OOAA 2O69A 1LAHE 4FEDA 5DEXB 2RF1A 4FECA 3FJMA 5A5XA 3KJ7A 1GV8A 2ONKE 1DTGA 4GL0A 3N94A 1PB9A 2R6GE 5M2VA 1SYHA 1MY2A 1AH5A 4PFWA 1GVCA 4JSDA 4GRKA 3K6VA 4F22A 5CI5A 1LSTA 4MBPA 2IA4A 1MQGA 4EXLA 4X1DA 4I1DA 2NOOA 3EHTA 3ONMA 2BJJX 4AB5A 2F34A 3C9HA 4NTLA 2QMWA 3MZ9A 4BDRA 1A8FA 2A5TB 2R9JA 2ANJA 3IB1A 3TQWA 3RUMA 1FQAA 1JW1A 1NH8A 1FTKA 4WXJA 3U1OA 3CSBA 4YB7A 2XXYA 4P11A 5I2KA 2D3IA 4YMAA 1KWHA 1N76A 1JETA 1H43A 4G68A 3V89B 2Y7WA 2ABHA 2DP8A 3HSTA 1BLFA 1TXFA 1N3XA 3C32A 4ZEFA 4MF3A 4FORA 4LUBA 4X9TA 4ZZAA 4F29A 4AQ4A 3Q27A 4R74A 4DIGA 4LA9A 1QKBA 1JEVA 4KI0E 1J1NA 4ONYA 2XD3A 3Q29A 5H8HB 3G3KA 1SYIA 2X7QA 3R7XA 3CFZA 4QSCA 3DP4A 4KQPA 5HBCA 1JVXA 4GVOA 2Y84A 5F7VA 3JV9A 1TWYA 3H4ZA 2AYSA 1H45A 1OQHA 3QIMA 3E4RA 2I49A 1OLCA 4OVJA 3OO6A 4G2ZA 3MVWA 1HSLA 2HXWA 1NFTA 3TDJA 5K2XA 3IO4A 4KCCA 2HCAA 4ZEKA 3KSJA 2E1SA 4OEUA 4JWXA 3HHGA 5H8NB 3O97A 2YPNA 3EPEA 1HSJA 3PGFA 2OBGA 1WVJA 2QRYA 4PP0A 1URGA 1BIYA 3IOTA 1IEJA 4U4XA 5CMCA 4QHQA 4ZEIA 2O51A 2ZYMA 1IQ7A 4NF6B 3VVDA 1B7UA 2OWSA 5JTYB 5CBRA 3K4UA 3EF7A 1US4A 4E0WA 3R26A 3O29A 1MDQA 3C34A 1O64A 3TCHA 4FIMA 1WDNA 3TMGA 5AA2A 3W9WA 1B9JA 2DS9A 3A3UA 2NXOA 3PPRA 1VE4A 1IITA 3U8QA 4L17A 2THIA 1D9VA 4GXSB 1UIUA 3KN7A 4LATA 3S4UA 1I69A 5CMMA 2H25A 2UYFA 5DYHA 2Q2AA 4ZECA 5JEIA 4H5FA 3K6XA 3K6WA 1BTJA 2O1MA 4DLDA 3G7WA 1O63A 2O84X 4NF4A 3KN8A 4YB5A 1UTHB 3C35A 3H6VA 1A55A 3MAMA 1VFEA 4NEDA 3OELA 5DTBA 3IK6B 3CR9A 3K1NA 1B6HA 1A7LA 1YTVA 1ANFA 3PMWA 2Z23A 2H5YA 4HS7A 4WEDA 3T9VA 3TKDA 4H8IA 4NF5A 1B3GA 4F2OA 1JW4A 4AB6A 4FE8A 3PPNA 1DOTA 3K02A 1LCTA 4UACA 3IB2A 3QUJA 5B70A 4OXVA 5KCJB 1B46A 1XC1A 3M3KA 5EHMA 2QPQA 3UP9A 2PT1A 4OFJA 1MPBA 2F6PA 4E0XA 5FTIA 3QK6A 4YZZA 2PX1A 3MC2A 1SW2A 3KEIA 3KOTA 4XKNA 1QUJA 3MQ9A 3FGSA 4H5GA 3VXCA 3OENA 4BDLA 5I57B 1R9LA 4I62A 3N6UA 1B05A 2P1SA 4U1OA 2V25A 3VLUA 4FAJA 1DPPA 4O3AA 3RPWA 3PD8A 3VLWA 3CI8A 3GBAA 5DEXA 3OSQA 4R2BA 3EHSA 1PEBA 1PBQA 4N6PA 4OERA 2ZNTA 5TP9A 2F36A 3H03A 2WKYA 4R2FA 1FQFA 3ECRA 1I6AA 1B3HA 1AIVA 1NL5A 3THIA 2PMSA 2XXWA 4OZ9A 4KFQA 5KDTB 1MPCA 4O3CA 3D4CA 3WAFA 3S9LC 3H06B 1SI1A 1N7WA 3QUFA 1OVBA 3HCQA 3IR1A 2H4IA 4TLLB 2A5TA 1XVXA 4OTEA 2XX8A 3FVKA 3OO8A 3TTLA 3PUXE 1D9YA 2QS3A 3FVOA 3TAJA 1EH3A 2D21A 1US5A 2PT2A 3ZKKA 1MY0A 3G3HA 2KLFA 1F9BA 3S9NC 4PFYA 1QJMA 2I58A 3CIJA 4GF8A 3OXNA 4LVQA 1B2HA 2Y7RA 4OWDA 3C4MA 1PDAA 3DP8A 1MQHA 2DWHA 5H8HA 4F3SA 1CB6A 2DWIA 1QUKA 1Y4TA 3L6GA 2O7UA 5I59B 3D4GA 3RTFB 2HZLA 3U94A 3MZ1A 3G3FA 4XKRA 3W9VA 1Z7NE 4R75A 2HAVA 2F5XA 2AL5A 3MJNA 2RCAA 3H6TA 3TUSA 3LSFB 1MXVA 2ZMBA 3I5OA 4ZZEA 2UYEA 1FQEA 3UGWA 5CBSA 1JQFA 4G68C 2ONSA 5FHNA 4O3BA 4JB7A 1RYXA 3SEUA 5AA1A 4IGRA 3T93B 2UVGA 5H8NA 4F1UA 2XXHA 4G8MA 5TP9B 4KYSA 4KR5A 3G3JA 3RT6B 1ZMGA 1S7YA 1B3LA 4JDFA 4PETA 5I56B 5AA4B 2F6GA 1MY3A 3OEKA 1FTMA 1PC3A 4WKMA 4HCYA 1BP5A 3C33A 4GD5A 1T0KA 4NF6A 3IJOB 3I6VA 3MZBA 5JTYA 1R1NA 1JW5A 2P2AA 3CSGA 3K6UA 3QXMA 3QSLA 3TTNA 4NE4A 3IOVA 1B4ZA 1LB9A 1YAEA 1MDP1 4GIZA 3BFTA 3V83A 3OSRA 5H8QB 1NH7A 4WEPA 4IO4A 4XTCQ 4U2RA 3V8XB 4Q5TA 4KHZE 1Y1ZA 4EQ9A 1I6QA 2DXYA 2ZYKA 5AA2D 4H67A 4I9DA 1VR5A 4JWYA 1USYE 1CE2A 1VSOA 1SI0A 3O66A 1USYH 4DCXA 3FVNA 3Q26A 1UTHA 3KG2A 2Y7PA 4ZE9A 3UIFA 4Z0IA 3Q25A 1PBPA 1EZ9A 4IY5A 4RPNA 4R6YA 1S9TA 1SD3A 4C1TA 2RKMA 3SETA 3SKPA 2DWJA 4I8CA 3IB0A 1LBBA 4U23A 5KCJA 1B1XA 5B7DA 4ZS9A 4YICA 4BDNA 5DVIA 2ZYOA 4PE5B 4N07A 3MVZA 1FQDA 2ZXTA 5L9SA 4OFLA 1LAXA 4G4PA 4GQOA 1ZLQA 2RC8A 3C31A 4IO2A 1M5DA 5I57A 3IJXB 5L9OA 3O6GA 1B3EA 1MH3A 1SW4A 4C1UA 3TYHA 3SEXA 3O28A 4ESWA 3FXRA 3PUWE 2LAOA 2GH9A 4EF2A 2G93A 1SBPA 3PD9A 1FTJA 2R71A 3CFLA 1UQWA 1FCKA 4FEBA 1TFAA 3PU5A 2UVHA 5DVJA 5CM6A 2GHBA 3VXBA 4M4GA 2OCUA 3PUZE 2I0CA 4ND9A 3PPPA 1R6ZA 5KDTA 2F97A 3SDFA 4QRZA 1MXZA 5CMKA 5DVFA 3TTRA 2V3UA 5ITPA 1FW0A 2DE2A 5ICTA 4YKKA 4U21A 1EZPA 1URDA 4OESA 3FIRA 2AL4A 1A40A 5ISUA 5AE4A 2Z22A 3IX1A 2HFBA 2O1LA 3RGYA 3W15C 3O6HA 3R6UA 2V84A 3UN6A 4KYEA 2H99A 1MG1A 3KJTA 3OO7A 5I58B 1NNPA 4RJZA 2XXVA 4H65A 1B7ZA 1MQIA 3GZGA 1YCJA 4YB6A 1OIBA 3KOSA 5H8FB 1AMFA 3MVYA 4RYAA 3PV0E 3SEYA 1QKAA 2UVIA 4TLMB 2G29A 4IY6A 5ICQA 3KSXA 2CMOA 4OENA 5TPAB 4H6DA 1SW1A 5I59A 3U92A 4QFOA 3AXFA 4RK9A 4BLAA 3PMXA 2XXUA 3PUYE 3CG1A 3GXAA 1O7TA 1IXIA 2F78A 3E9XA 4BDQA 3IO6A 1LLSA 3HV1A 2XX7A 3FVGA 3IOWA 3TELA 5CC2A 1LCFA 3HHFA 4MH5A 3TPAA 2UXAA 1MXWA 5K2YA 4EXKA 2Z8FA 2X7PA 4GL8A 2Z8DA 3KZGA 4UA8A 2B3FA 4POWA 1H76A 3DLNA 3BFUA 2AIXA 1SDXA 3N5LA 2I4BA 2XXIA 4YKPA 1Q35A 2FNCA 5HM4B 4ESXA 5LOMA 1JNFA 2VGQA 4F3GA 4DXCA 3BKIB 5JK4A 1RKMA 2YJPA 3A09A 3IORA 2ONRA 3VFJA 4RA1A 5ELVA 2DYXA 2VP1A 5I56A 3JZJA 4XXUA 5AA4A 2F35A 1Y3QA 1Y3PA 4GFRA 2NUVA 4ZDMA 1I6BA 4OETA 2XXPA 2X26A 3ILUB 4NWDA 3UK4A 1M5CA 1B52A 2HQ0A 3O6IA 3RY3A 5BUUA 2XHDA 1QUIA 4PFUA 3O9PA 1P1OA 5CRYA 1VFDA 4ISUA 3H6WA 3RN8A 1R9QA 5I84A 4U4SA 4PFTA 3PMVA 5H8QA 3OD7A 1Q1KA 4EDPA 1POTA 3K2DA 1ZJLA 2H98A 1H44A 3MPKA 1N0TA 3OO9A 3KGCA 1ELJA 4IB2A 3G3GA 3MVXA 3CFXA 3GBBA 1Y4CA 3FV1A 5DT6A 3VV5A 1OVTA 3P7IA 4U22A 3QAXA 4OEVA 3TEPA 1MM7A 4Q30B 2OJTA 3B6WA 1MQJA 2RCBA 1RYOA 1SVXB 1B7HA 2A5SA 4IO6A 3S2VA 3CRBA 3MPLA 4MLVA 5HPQA 1UTBB 4P0IA 1MPDA 3ZSFA 1DSNA 1ZBMA 2VD3A 4NMYA 1LAFE 3SEVA 3MW0A 2F7BA 1B40A 3T9HB 2O68A 3SERA 2CZLA 3LBSA 4LP2B 2O6AA 1MY4A 2DE3A 3OEMA 4EQ7A 1NNKA 1MXXA 2F7CA 4OQOA 4GOTA 4HW8A 1GR2A 2OK2A 4QF9A 4F1YA 3ODBA 4YU0A 3QYTA 1LB8A 3O2AA 1WODA 1ZU0A 2I3VA 3PPOA 2XD2A 4OHNA 3KBRA 5EYFA 2ZNUA 4FJPA 4POXA 4ELQA 4NF8B 3RTWB 4Z7EA 3RT8A 3CG3A 3FV2A 2P0SA 1GGGA 2PYYA 3ZKLA 4OYVA 1MS7A 1XS5A 4TQUQ 3IL1B 3K1PA 1H3DA 1IXHA 3HN0A 1TT1A 1B5JA 4H0WA 2UVJA 1BKAA 3U72A 4XKPA 4H1XA 1XOCA 4HTGA 3N26A 2XX9A 3RQTA 2DE4A 3FJGA
chains in the Genus database with same CATH superfamily
4O7IA 3F11A 2OWTA 4JI2E 2QSXA 2WBSA 3TQLA 4F2QA 1Y3NA 2I3WA 5EHSA 2B7TA 3EN3A 3N6TA 2RTXA 3T9UA 5I2NB 1NKXA 1AWBA 1JEUA 1IIWA 1RDYA 1GTKA 4R6HA 4G8NA 5A6BA 2GHFA 1SR9A 2DXRA 1A1JA 2YTOA 2F8DA 2LCEA 4AS4A 2B3BA 2ZZWA 2REJA 2HC5A 4LONB 4JSOA 1NNFA 1AL3A 3LSWA 1EZOA 4N81A 1FPIA 1N32E 1Q9DA 4R03A 1B0HA 2PBWA 2Y7KA 3VVFA 4IO5A 3CVGA 3H7MA 4LZ5A 4ECFA 5I58A 5I3SA 2KONA 4M1VA 4TUGA 1RDXA 1UIVA 3DM0A 3TFLA 3S9EA 1IUDA 4B3RE 3U93A 1PKPA 4IR8A 2QJEA 3WAEA 5H8FA 4DV7E 5BR8E 3IWBA 3FJ7A 1Z1BA 2LUPB 4H46A 2EQ3A 2JWOA 1LBWA 2Z8EA 1MM6A 1NCSA 4NWCA 5TSEA 1DPEA 1Y1MA 2YLNA 2EMCA 3FATA 4U1ZA 4H8JA 5TPAA 1DTZA 2GQ1A 2UUBE 2I0BA 2EM3A 1PB7A 3T1HE 5ET5A 2NUFA 1IQOA 2RC7A 4PFIA 4RY1A 4G77A 5A2QC 2UXDE 3C6KA 1EH8A 2A25A 2B7VA 4R2EA 3QG5C 2VPOA 5FTHA 3FXQA 4QFNA 3KBZA 1PJSA 2EPOA 3BBRA 4O7MA 3GLBA 4YHHE 2R76A 1Y9UA 2LVHA 4X1BA 2EN4A 4IO3A 1POY1 4KCDA 3HPIA 3UORA 3FIGA 1KYQA 2ODRD 2DOJA 4NZVA 4LF8E 4YKIA 1RDZA 3TCFA 4FATA 4X8RA 4ELPA 2QL3A 1N7XA 2LBSB 4RPOA 1P1QA 3KC1A 2V8QB 3HQ1A 4L5NC 5A5XB 4PDHA 1N3GA 5IAIA 3K1MA 2VHAA 1MH4A 2V3QA 3SESA 4Q0CA 2CSHA 5FLXC 2HGHA 2WBTA 3TODA 4RXLA 5CMBA 4TUIA 1EYJA 2RSIA 1II5A 1NV1A 3IOUA 4P8BA 3K0VA 4ELRA 2NWJA 3TTMA 1LFIA 2V93A 1P99A 4P0GA 3FD3A 4F19A 3FBPA 3TCGA 1LFGA 3MUQA 2GRVA 2QS4A 4DR6E 3IWCA 2EOMA 4DZ1A 4DI3D 4MNIA 1LGBC 3C36A 1BB8A 3T22A 3IAZA 1D4NA 1GZ6A 1YYOA 4RNSA 3TTKA 4XKQA 5BWJA 2EMXA 2ALUA 2XXQA 1FKAE 3OMBA 1B3FA 3ROJA 2EN7A 4DV4E 2Y7IA 1D9QA 2FVZA 2ODRC 3LUZA 1NUXA 2OLBA 2FIEA 1N04A 1QULA 1K9YA 1ATGA 1N3WA 4GLIA 3VVEA 5J1DA 4JBZA 5ITOA 3JYRA 5I2KB 1LFHA 1X5WA 2L5VA 4DXBA 4NGUA 2F8BA 2DVCA 1RQ0A 4RK2A 5EYGA 4G68B 4THIA 1B5HA 3T9XB 4ZEBA 1RC7A 1IMCA 3A3CA 1CNQA 3K00A 2EQ0A 2GFEA 4C0RA 4Q8RA 1LBYA 4NXME 3MP8A 4LF5E 5I5PA 2OZZA 2GPIA 1FPEA 2E72A 1M5BA 2EMHA 3E13X 3B6TA 3LR1A 4NAPA 4F39A 4OFOA 1HNXE 4QSDA 4AS5A 3MP6A 4YAHX 1SQYA 1LAGE 3DELB 4IJDA 4QFKA 5TU0A 1D3KA 2I4CA 2EM5A 4ZE8A 1FPLA 2D5WA 4F3PA 4XIGQ 3B7DA 2ESNA 4PQJA 1XHYA 1FTLA 2EN1A 4NHRA 4MNCA 3U65A 5A6AA 2XXTA 4OVSA 2EWLA 5ET7A 5FHOA 1B5IA 3HO7A 1P1UA 3MWBA 4KYDA 2HHHE 3LMLA 4F54A 4HCWA 1STUA 4JXIA 1UTBA 1B4HA 4MFIA 4F18A 1HSEA 4WSGA 2XXKA 1AOVA 2DSFA 1URSA 1B32A 4I40A 2FIXA 4DCYA 3G3IA 1ZIUA 1M5FA 4GWOA 4X9JA 2OX3A 2QMXA 4UABA 3KZZA 4ZEDA 3H6UA 3T66A 4F31B 4JI8E 2EPRA 2WBDA 5AE2A 3ILTB 2M8CA 2DWAA 3EHUA 2PVUA 1LBXA 1T4OA 1JVYA 1NMUA 4O94A 4DE8A 4MLQA 3I3VA 2XXRA 3J81C 1ZTYA 4OMBA 3TQMA 4LZ8A 4OVTA 1MRPA 3M3LA 4LZ7A 3PUVE 1YPNA 5KZTA 1Z7ME 3LSXA 3FZVA 5L8DA 4B3ME 2YT4A 1QW0A 2JY9A 4RH8A 1MGTA 1IXGA 2ZYNA 5LLQA 3ADGA 1XI6A 4LQ2A 4DV5E 3M8UA 1B58A 1LBCA 2IEEA 4R2PA 3L6HA 5CFFE 4DR4E 4WYQB 1FPJA 2BJIA 3E3KA 1A54A 2YTFA 1A8EA 4NF8A 3F6HA 2NVUB 2EM2A 2Q9TA 4IS1C 4GX6A 4DDDA 1QVSA 2B9DA 3Q28A 4LFAE 3LLHA 2HZKA 4GX3A 3K01A 1T4NA 4KPTA 4P1LA 2VOZA 2Q88A 5F1QA 2P3VA 1FQBA 1TFDA 1OQGA 3LC8A 4GWUA 4MNPA 2EPXA 2H9BA 3FASA 3USDA 2EM4A 1OMPA 1MY1A 1MXUA 1MXYA 2QS2A 4NG7A 3KFMA 2XWVA 3KN3A 4N13A 4ZYEA 3B6QA 1OLAA 1FQCA 4DUYE 1P1WA 3ZOQB 4JI4E 5FHMA 4WX9A 1FJGE 1A99A 1XVYA 3ISPA 1MQDA 1IZ1A 5AA2B 4BS9A 2Q89A 2I6EA 4LQ5A 1NEIA 5L9MA 2LO3A 1Y20A 3SEWA 1WHNA 1EYKA 3T1BA 3T96B 2DQVA 2RSMA 3VYXA 2YRKA 2KR0A 2ENAA 1P1NA 5FBPA 4GWZA 4KD5A 2L33A 1B0LA 2O7IA 5H8SA 4LF9E 3LUYA 3V5AA 5I2NA 4WXCA 5AA3A 1JK2A 1L5TA 1G2FC 2F7AA 2FGGA 2QVVA 2V85A 4R72A 2FTXB 5IKBA 4Q35B 1SFEA 1EU8A 1IMFA 2V3TA 2FBPA 4EQBA 1IXCA 1FBFA 3MP1A 4X48A 4IO7A 1NNTA 4F9CB 3FXUA 1PB8A 4GBVA 4IGTA 4PFRA 1M5EA 2B4MA 2R8TA 3TZAA 2YU8A 4EF1A 2B65A 3S9MC 4NF4B 3AV0A 4KXPA 3VE1B 2I48A 1FTOA 2LRSA 2GHAA 3VLVA 2W7YA 2EPUA 1ZU1A 4BDOA 5EQAA 2M7QA 3BIGA 4QSEA 3ZS6A 4P1EA 1N84A 2DVZA 4BDMA 3M3FA 4HE0A 2XXXA 3PTYA 4EUOA 2EOXA 2HEUA 2FA7A 1B1HA 2REGA 3EQ1A 3HXLA 1S50A 4G8HA 2L3JA 3QMFA 4QFPA 1SW5A 4MEVA 4NF5B 5LDZA 4F3BA 4GXAA 1WHQA 2FYIA 4XFEA 3H3GA 1FBPA 4R73A 4R9FA 2Q8JA 4PGPA 3FUZA 3VDFA 2QS1A 4DXUA 2ENCA 3MHSC 4WFTA 1N33E 3DP6A 4K3FA 2VD2A 1PJTA 1L4SA 1XT8A 4GBWA 5DW8A 4YMBA 1DMBA 2RINA 2EN2A 2EM0A 3IFCA 3MBPA 2HAUA 3RLFE 1B51A 1IQSA 2F3DA 1YYWA 4R9GA 1ZKBA 2EE8A 2E0SA 2ZNSA 4GX4A 4NHBA 3UA8A 4R2AA 4ELOA 1TF6A 5A5LA 4JWOA 5KL4A 4YKJA 3RNNA 4F1VA 1X3CA 4QFLA 2EOFA 1FPGA 3MYUA 2EM8A 3PPQA 1T38A 2RC9A 2Q2CA 3LSLA 4TOZA 4R6KA 2EPNA 2VT5A 3OOAA 2O69A 1LAHE 4FEDA 5A6JA 4LFBE 4MCOA 5DEXB 2RF1A 4FECA 4PF6A 3FJMA 4N8YA 2FHYA 5A5XA 2I13A 5ET8A 1A1KA 4WXDA 3KJ7A 1GV8A 2ONKE 1DTGA 4GL0A 3N94A 1NV4A 2EPMX 4I3YA 1PB9A 2R6GE 4I8OA 1NV0A 5M2VA 1SYHA 1MY2A 1AH5A 4PFWA 1GVCA 1FBDA 3ADJA 4L8NA 4F6NA 4JSDA 4GRKA 3K6VA 4F22A 5CI5A 1LSTA 4MBPA 2IA4A 1MQGA 4EXLA 4JYAE 4X1DA 1YYZA 2EOSA 2NOOA 4I1DA 2LV2A 3EHTA 3ONMA 2BJJX 4AB5A 2PFYA 2F34A 3FXBA 3C9HA 2WCC3 4NTLA 2QMWA 1KZ8A 1DI2A 3MZ9A 2RS6A 4BDRA 1A8FA 2A5TB 2R9JA 4ZYHA 2ANJA 2RS7A 3IB1A 3TQWA 3RUMA 1FQAA 1JW1A 2MDRA 1NH8A 1FRPA 1FTKA 4WXJA 3U1OA 3CSBA 1LEVA 5KL2A 4YB7A 4P7DA 2XXYA 2EN6A 2EPCA 4P11A 5I2KA 2D3IA 4YMAA 1KWHA 2L8TA 1N76A 1JETA 1H43A 4G68A 2EPAA 3V89B 2Y7WA 2ABHA 2YSOA 2DP8A 3HSTA 1BLFA 1TXFA 1N3XA 3C32A 4O24A 4OX9E 4ZEFA 4MF3A 4FORA 1NV2A 5F24A 1QGXA 4LUBA 4X9TA 4ZZAA 4F29A 4AQ4A 2YU5A 2EN8A 3Q27A 4R74A 4DIGA 4R2DA 4LA9A 1QKBA 2N8XA 1JEVA 4KI0E 1J1NA 4ONYA 1WJPA 2XD3A 3Q29A 5H8HB 3G3KA 1SYIA 2X7QA 4MHFA 2L2KB 2E5LE 3R7XA 3CFZA 4QSCA 2EZ6A 3DP4A 4KQPA 2YRMA 5HBCA 1JVXA 2EMFA 1IMBA 1O0WA 4GVOA 1HNWE 2Y84A 5F7VA 4JI5E 3JV9A 1TWYA 3H4ZA 4PAKA 2AYSA 4X8WA 4N91A 1LBZA 1H45A 1OQHA 1FTAA 3QIMA 2EL4A 3E4RA 2I49A 2EMKA 2GLIA 4GKJE 1OLCA 2F3BA 2WZOA 4OVJA 3OO6A 4G2ZA 1FSAA 4FBPA 3MVWA 4DMIA 4PGNA 3RPLB 1HSLA 2HXWA 3J7AG 1NFTA 1YZ9A 3TDJA 5ADZA 4DV6E 5K2XA 2E1MA 3IO4A 4KCCA 2HCAA 1G0HA 4ZEKA 3KSJA 2E1SA 4OEUA 2EL6A 4JWXA 3HHGA 5H8NB 3O97A 2LMZA 2YPNA 3EPEA 2WYKA 1HSJA 5IV8B 3PGFA 2OBGA 1WVJA 4X64E 2QRYA 4PP0A 1URGA 4KWYA 1BIYA 3IOTA 2YSPA 3HTXA 1IEJA 4U4XA 5CMCA 3HPZA 4QHQA 2L3CA 2JPAA 2CT1A 1J5EE 4KHPE 4DR1E 4ZEIA 2O51A 1LBVA 2ZYMA 1IQ7A 1AAYA 4NF6B 1SPIA 3VVDA 4JI7E 4O5GA 1B7UA 2OWSA 1DK4A 3EKIA 5JTYB 5CBRA 3K4UA 3EF7A 1FBGA 3LV0A 1US4A 4E0WA 3R26A 3O29A 4JV5E 1MDQA 3C34A 1O64A 2Q8MA 3TCHA 3IWDA 4FK5C 4FIMA 4DR2E 1WDNA 2F4VE 3TMGA 5AA2A 3W9WA 1B9JA 2DS9A 4Q28A 3A3UA 2HXRA 2NXOA 5KL7A 3PPRA 1VE4A 1IITA 3U8QA 4L17A 1YZ0A 2KOUA 2THIA 1TF3A 1D9VA 4GXSB 4N4UA 2DLQA 1UIUA 2I9IA 3KN7A 5AE1A 4LATA 5KL6A 4F6MA 3S4UA 1I69A 3EPHA 5CMMA 2H25A 2UYFA 2Y5KA 5DYHA 2Q2AA 4ZECA 5JEIA 4H5FA 3K6XA 4BBYA 2CEYA 3K6WA 1BTJA 2O1MA 4DLDA 3MSTA 2EMBA 3G7WA 1O63A 2O84X 4NF4A 3KN8A 4YB5A 1UTHB 3C35A 3H6VA 1A55A 3MAMA 1VFEA 4NEDA 3OELA 5DTBA 2DRPA 3IK6B 2YTEA 3CR9A 3ADIA 2XA5A 3K1NA 1B6HA 2UUAE 1EYIA 1A7LA 1YTVA 1XMOE 1ANFA 3PMWA 2Z23A 2H5YA 4HS7A 4WEDA 3T9VA 3TKDA 4H8IA 4NF5A 4YY3E 1B3GA 4F2OA 2EMZA 1NI9A 1JW4A 2IHR1 1QU6A 1NUWA 4AB6A 4FE8A 3PPNA 1MEYC 1DOTA 3K02A 1LCTA 4UACA 3IB2A 4OVPA 3QUJA 2EQ1A 4OXVA 5B70A 5KCJB 1B46A 1FPFA 1XC1A 1EH7A 3M3KA 3E78A 5EHMA 5IZ1A 1UHZA 5EYHA 2QPQA 3UP9A 2PT1A 4OFJA 1MPBA 2EM9A 2F6PA 4E0XA 5FTIA 3QK6A 4YZZA 2PX1A 3MC2A 5T6JA 1SW2A 3KEIA 3DJWA 4MX6A 3AUZA 3KOTA 4XKNA 5A69A 4OA4A 1QUJA 3MQ9A 2NABA 2V88A 3FGSA 2LUQA 4H5GA 3VXCA 3OENA 4BDLA 3VK6A 4JI1E 5I57B 1R9LA 4I62A 3N6UA 1B05A 4KZSA 2P1SA 4U1OA 2V25A 3VLUA 2PRTA 4FAJA 4HE2A 2LTSA 2EM7A 1DPPA 1XMQE 5I7IA 4O3AA 3RPWA 1A1LA 3PD8A 3VLWA 3CI8A 2JYAA 3GBAA 4PAFA 1X49A 3RMPA 5DEXA 3OSQA 4R2BA 3EHSA 1PEBA 2LTRA 2YTGA 1PBQA 4N6PA 2EPLX 4DR7E 4OERA 2ZNTA 5TP9A 2EOJA 2MKNA 3MHHC 2EJ4A 2F36A 3H03A 2WKYA 4R2FA 2L2NA 1FQFA 2MKDA 3ECRA 1I6AA 1B3HA 1AIVA 1NL5A 2EOOA 3THIA 2PMSA 2XXWA 4OZ9A 4KFQA 4DV1E 5KDTB 3BIDA 1MPCA 4PF8A 4O3CA 2V86A 3D4CA 2EMWA 2RPCA 3WAFA 1INPA 2RQLA 3H06B 1SI1A 1N7WA 3S9LC 1A1GA 1X47A 1N34E 3QUFA 4GKKE 2CEXA 1OVBA 3HCQA 4ZYGA 3IR1A 2H4IA 4TLLB 2A5TA 1XVXA 2WBUA 4OTEA 2XX8A 3FVKA 2XWIA 4PE3A 2YZTA 3OO8A 3TTLA 4DV0E 3PUXE 4ZYDA 2QFLA 1D9YA 2QS3A 4R8OA 3FVOA 3TAJA 1EH3A 2JVAA 2D21A 4OANA 1US5A 2PT2A 3ZKKA 1MY0A 5A6BD 3G3HA 2KLFA 4N15A 1F9BA 3S9NC 4PFYA 1YSAC 1QJMA 2I58A 3CIJA 4JI3E 4GF8A 3OXNA 4LVQA 2NUEA 4BHBA 3C4BA 2EP3A 1B2HA 2CZIA 2Y7RA 4OWDA 3C4MA 1PDAA 3DP8A 1G0IA 2MDGA 1MQHA 4MAGA 2DWHA 5H8HA 1NV3A 4X65E 2YWQA 4F3SA 1CB6A 2P3NA 2DWIA 1QUKA 1Y4TA 2EOIA 3L6GA 2O7UA 1X6HA 2VQFE 1BK4A 5I59B 1G2DC 3D4GA 3RTFB 1UN6B 2HZLA 3J80C 3U94A 4K0KE 3MZ1A 1NUYA 3G3FA 4XKRA 3W9VA 5AC5A 1Z7NE 4PTKA 4JI0E 3GYYA 2HPGA 2WEFA 4R75A 3VYYA 2HAVA 2F5XA 2EOQA 2AL5A 3MJNA 2YTNA 2RCAA 3H6TA 2LT7A 4QXDA 2EOEA 3TUSA 2ADRA 3LSFB 1MXVA 2ZMBA 3I5OA 4HE1A 3RPLA 4ZZEA 1NV5A 2UYEA 1FQEA 3UGWA 2H36X 5CBSA 1YYKA 1JQFA 4G68C 2ONSA 3OTOE 2L2MA 5FHNA 2L92A 4O3BA 4JB7A 4BC7A 1RYXA 4PC9A 1IBKE 3SEUA 4J8ZA 4MIJA 1IMUA 5AA1A 2M9AA 4IGRA 1FBHA 4NX1A 3T93B 1WXRA 5J16A 1K9ZA 2UVGA 5A6KA 5H8NA 4F1UA 2XXHA 4G8MA 5TP9B 2WBBA 4KYSA 4KR5A 3HFUA 4F2JC 2MC6A 2ELYA 3G3JA 3RT6B 2V83A 4P47A 1ZMGA 4PBHA 1S7YA 1B3LA 4JDFA 4PETA 5I56B 4M0VA 5AA4B 2F6GA 1MY3A 4R2RA 3OEKA 1FTMA 1PC3A 4WKMA 4HCYA 2EL5A 1BP5A 3C33A 4GD5A 1T0KA 4NF6A 3IJOB 1FBEA 4DUZE 3I6VA 3MZBA 5JTYA 1R1NA 1JW5A 2P2AA 3CSGA 3K6UA 3QXMA 5EQ9A 3QSLA 3TTNA 4NE4A 4BMJA 3IOVA 1YUJA 1B4ZA 4BCAA 1LB9A 3IFAA 2YTQA 1NV6A 1YAEA 1MDP1 4GIZA 3BFTA 3V83A 3OSRA 5H8QB 2LE2A 1NH7A 4WEPA 4IO4A 4XTCQ 4U2RA 3V8XB 4Q5TA 4KHZE 1Y1ZA 4EQ9A 4JVDA 2V4CA 4HXVA 4XEQA 1N36E 2EMYA 4N6KA 4GWXA 1I6QA 3EPJA 2DXYA 3H09A 2V87A 2NUGA 2ZYKA 4X04A 5AA2D 5IZ3B 4H67A 1KA1A 5EQ8A 4I9DA 5LTCA 1VR5A 4JWYA 4N17A 4G61A 4OVRA 1GQEA 1USYE 1CE2A 1VSOA 3EPKA 1SI0A 3O66A 2VRDA 1USYH 4DCXA 3FVNA 3Q26A 1UTHA 2WYPA 4PBQA 3VHTB 1X6EA 4NN3A 3KG2A 2Y7PA 1FPBA 4ZE9A 3UIFA 4N8GA 4DR3E 4Z0IA 3Q25A 1UBDC 1PBPA 2MC5A 4NXNE 1X48A 2JOXA 1EZ9A 4IY5A 1KA0A 4R6YA 4RPNA 3JTZA 2HHMA 1S9TA 1SD3A 4C1TA 1FPDA 2RKMA 3SETA 3SKPA 2LJUA 2DWJA 4I8CA 3IB0A 1LBBA 2FV4B 3C4TA 2UXBE 4U23A 1B1XA 5B7DA 5KCJA 2QVUA 3T0JA 4ZS9A 1ZBQA 1XNRE 4YICA 2KHXA 4BDNA 5DVIA 5KL3A 2ZYOA 4PE5B 4GWWA 4N07A 2Y5LA 3MVZA 1FQDA 3CHGA 3BGHA 4R2CA 2ZXTA 4LN5A 1IMAA 5L9SA 4OFLA 1LAXA 4G4PA 4GQOA 1ZLQA 1QNTA 2RC8A 3DF6A 3C31A 4IO2A 1M5DA 5I57A 3IJXB 4OOGC 4M9VC 1YXIA 5L9OA 3O6GA 5AC4A 4BC9A 5IM2A 2L6MA 1B3EA 1MH3A 2WX9A 1SW4A 4C1UA 5DNYA 3C6MA 3SEXA 3TYHA 3O28A 4ESWA 4AQYE 3FXRA 1BBGA 1LLMC 1WRJA 3PUWE 2LAOA 2GH9A 4EF2A 5EQ7A 2G93A 4PFBA 1SBPA 4MJOA 5IXMB 2DMIA 2G7HA 1FTJA 3PD9A 4GWYA 2R71A 3CFLA 1UQWA 1FCKA 4FEBA 1TFAA 3PU5A 2UVHA 5DVJA 5CM6A 2EMGA 2GHBA 3VXBA 4M4GA 4P56A 4LF6E 5IWAE 2OCUA 3RYDA 1JK1A 4DKKA 4LF4E 2DIXA 3PUZE 2I0CA 4ND9A 3PPPA 1R6ZA 5KDTA 4N6DA 4XF5A 2F97A 3SDFA 4QRZA 5KL5A 1IMDA 3B50A 1MXZA 4LFCE 5CMKA 2OWZA 3A29A 5DVFA 3TTRA 2V3UA 5ITPA 1FW0A 2DE2A 5ICTA 4YKKA 1FJ6A 4U21A 2M4IA 1EZPA 1URDA 2JOBA 4OESA 3FIRA 2AL4A 4DV2E 1A40A 1ZR9A 2EMLA 3KZYA 5ISUA 5AE4A 2Q8UA 2JR1A 1X6FA 2EPZA 2Z22A 3IX1A 4RHBB 2HFBA 1BBOA 2O1LA 1FBCA 3RGYA 3W15C 1PJQA 3O6HA 3R6UA 4QBAA 2V84A 2BBGA 3UN6A 4KYEA 2ELZA 3F6GA 1F2IG 2H99A 4DR5E 1MG1A 3KJTA 1NV7A 3OO7A 5I58B 1NNPA 4H45A 2UXCE 2XXVA 4GWSA 4RJZA 4H65A 1B7ZA 1MQIA 3BIHA 3GZGA 1YCJA 4YB6A 5F3WA 2EMIA 1OIBA 1I94E 3KOSA 5H8FB 1AMFA 3MVYA 4RYAA 3PV0E 3SEYA 5IT9C 1QKAA 4O43A 2UVIA 5LL6R 4TLMB 2G29A 4P9KA 4IY6A 5ICQA 3KSXA 5AE3A 2CMOA 4NQ8A 4OENA 5TPAB 4H6DA 2PFZA 3JAMC 1SW1A 1YUIA 5I59A 3U92A 4QFOA 3AXFA 2UU9E 4RK9A 4BLAA 2K7IA 4R2SA 3PMXA 1KJKA 2XXUA 5LMUE 3PUYE 3CG1A 3GXAA 1O7TA 1IXIA 2F78A 2HJJA 3UK3C 3NOHA 1VDWA 3E9XA 3J7Yp 4BDQA 3IO6A 1LLSA 3HV1A 2XX7A 3M99B 3FVGA 3IOWA 3TELA 5CC2A 1LCFA 2EN3A 3HHFA 1EH6A 3L00A 2UXAA 4MH5A 3TPAA 3D1RA 1MXWA 5K2YA 2EOHA 4EXKA 2Z8FA 1UILA 2X7PA 4GL8A 2EMAA 2Z8DA 3KZGA 4UA8A 2B3FA 4POWA 4PDDA 1H76A 2ZZVA 3DLNA 4LU9A 3BFUA 2AIXA 1SDXA 3N5LA 2I4BA 2JXPA 2XXIA 1Q35A 4YKPA 3JU0A 2JP9A 2BB8A 2FNCA 2ZM6E 5HM4B 4ESXA 4I3EA 5LOMA 1JNFA 4LTYA 2VGQA 2R1FA 4F3GA 4PAIA 2VE7C 3HPSA 4DXCA 3BKIB 5JK4A 1RKMA 3OMLA 2YJPA 3A09A 3IORA 2ONRA 5T3JA 2B3TB 3KC0A 3VFJA 2CZHA 4RA1A 5ELVA 2EOYA 2CPNA 2DYXA 2VP1A 5I56A 4O4KA 1ZBTA 4B3TE 3JZJA 4XXUA 5AA4A 2F35A 1Y3QA 1DCUA 2YTJA 1Y3PA 2J7JA 4GFRA 5IZZA 5AASA 2NUVA 4ZDMA 1I6BA 4GZNC 4OETA 2XXPA 4X62E 1IBME 2X26A 2DGCA 3ILUB 4NWDA 3UK4A 1M5CA 1B52A 2HQ0A 3O6IA 3MSWA 3RY3A 5BUUA 1A1IA 2XHDA 1QUIA 4DI4B 2UUCE 3KWRA 4F9BB 4PFUA 3O9PA 1EKZA 1P1OA 3B8BA 1VFDA 5CRYA 4F9AB 4ISUA 3H6WA 3RN8A 1R9QA 4WPYA 2YTDA 2ENHA 5I84A 4JVIA 4U4SA 5ESYA 4PFTA 3PMVA 5H8QA 3OD7A 1Q1KA 4EDPA 3BBGA 1POTA 3K2DA 1HR0E 1ZJLA 2H98A 1H44A 3MPKA 1N0TA 2Q74A 1IBLE 3OO9A 3KGCA 2LJHA 1ELJA 4IB2A 3G3GA 1RMDA 2ZZXA 3K6QA 3MVXA 2EORA 5IZ3A 3CFXA 1DQ3A 1P47A 3EPLA 3GBBA 2EOZA 1Y4CA 3THNA 1A1FA 3FV1A 5DT6A 3VV5A 1OVTA 1IMEA 3P7IA 2PCRA 2K4VA 1B69A 4U22A 3ADLA 2QVRA 4X66E 3QAXA 4OEVA 3TEPA 2DSYA 1MM7A 4OVQA 2OJTA 4Q30B 3B6WA 1MQJA 2RCBA 1T39A 2YTIA 1RYOA 4R2QA 3BF2A 1DBZA 1SVXB 1B7HA 2A5SA 4IO6A 5IGAA 1NUZA 2XWKA 2EPPA 3CRBA 3S2VA 4MMPA 3SZPA 2DDKA 4JVCA 2CZKA 4DV3E 2D9HA 3MPLA 2JJKA 4MLVA 5HPQA 3THOB 1FPKA 1UTBB 4P0IA 2N3GA 1MPDA 3ZSFA 1DSNA 1ZBMA 2VD3A 2VF1A 4NMYA 4M30A 1LAFE 3SEVA 2MKZA 3MW0A 2F7BA 1B40A 2YRHA 1DGCA 2O68A 3SERA 3T9HB 2CZLA 3LBSA 4LP2B 2CTDA 4N4RB 2O6AA 2KQZA 1MY4A 4PCDA 2DE3A 3OEMA 4EQ7A 2EPKX 1NNKA 2B4LA 1MXXA 2F7CA 4OQOA 4GOTA 4HW8A 1TN9A 5ET6A 1GR2A 2OK2A 4QF9A 4F1YA 3ODBA 4YU0A 3QYTA 1LB8A 3O2AA 1WODA 1YFHA 2YTPA 1ZU0A 2I3VA 3PPOA 2XD2A 4OHNA 1HNZE 2V89A 3KBRA 1JP4A 5EYFA 2ZNUA 4FJPA 4M2ZA 4POXA 2VQEE 4ELQA 2DLKA 4P3LA 4BHCA 2M1SA 4NF8B 4P78A 3P1XA 3RTWB 3T1YE 4Z7EA 3RT8A 3CG3A 3FV2A 2P0SA 4WSPA 1GGGA 1ZAAC 2PYYA 3ZKLA 4OYVA 1MS7A 1XS5A 4TQUQ 2XWOA 3IL1B 3K1PA 1H3DA 1IXHA 3HN0A 1FJ9A 1XNQE 2N3HA 4LF7E 1TT1A 4JI6E 2DMYA 2NA2A 4B3SE 5LMNE 1B5JA 4H0WA 1T4LB 1J26A 2UVJA 4GEQB 1BKAA 2DB2A 3U72A 4XKPA 4H1XA 4O8MA 1XOCA 4HEIA 4HTGA 3N26A 2EM6A 2XX9A 3RQTA 2DE4A 1A1HA 3E79A 3FJGA 2VPNA 4NF0A
chains in the Genus database with same CATH topology
3F11A 2OWTA 2QSXA 3TQLA 4F2QA 1Y3NA 2I3WA 5EHSA 3EN3A 3N6TA 3T9UA 5I2NB 1NKXA 1JEUA 1IIWA 1GTKA 4R6HA 4G8NA 2DXRA 2F8DA 2B3BA 2REJA 4LONB 4JSOA 1NNFA 1AL3A 3LSWA 1EZOA 1B0HA 2PBWA 2Y7KA 3VVFA 4IO5A 3CVGA 3H7MA 4LZ5A 4ECFA 5I58A 4M1VA 1UIVA 3DM0A 3TFLA 3S9EA 1IUDA 3U93A 2QJEA 3WAEA 5H8FA 3FJ7A 2Z8EA 1MM6A 4NWCA 1DPEA 1Y1MA 2YLNA 3FATA 4U1ZA 4H8JA 5TPAA 1DTZA 2I0BA 1PB7A 2RC7A 4RY1A 4G77A 5FTHA 3FXQA 4QFNA 3BBRA 3GLBA 1Y9UA 4X1BA 4IO3A 1POY1 4KCDA 3HPIA 3UORA 2DOJA 4YKIA 3TCFA 4FATA 4ELPA 2QL3A 1N7XA 4RPOA 1P1QA 5A5XB 5IAIA 3K1MA 2VHAA 1MH4A 2V3QA 3SESA 4Q0CA 3TODA 4RXLA 5CMBA 1II5A 3IOUA 3K0VA 4ELRA 2NWJA 3TTMA 1LFIA 2V93A 1P99A 4P0GA 3FD3A 4F19A 3TCGA 1LFGA 3MUQA 2GRVA 2QS4A 4DZ1A 1LGBC 3C36A 3T22A 3IAZA 1D4NA 4RNSA 3TTKA 4XKQA 5BWJA 2ALUA 2XXQA 3OMBA 1B3FA 2Y7IA 2OLBA 1N04A 1QULA 4GLIA 1ATGA 1N3WA 3VVEA 5J1DA 4JBZA 5ITOA 3JYRA 5I2KB 1LFHA 4DXBA 2DVCA 4RK2A 4G68B 4THIA 1B5HA 3T9XB 4ZEBA 3A3CA 3K00A 2GFEA 4C0RA 4Q8RA 3MP8A 2OZZA 1M5BA 3E13X 3B6TA 3LR1A 4F39A 4OFOA 4QSDA 3MP6A 4YAHX 1SQYA 1LAGE 3DELB 4QFKA 5TU0A 1D3KA 2I4CA 4ZE8A 2D5WA 4F3PA 4XIGQ 3B7DA 2ESNA 4PQJA 1XHYA 1FTLA 5FHOA 2XXTA 1B5IA 3HO7A 1P1UA 3MWBA 4KYDA 4HCWA 4JXIA 1UTBA 1B4HA 4MFIA 4F18A 1HSEA 1AOVA 2DSFA 1URSA 1B32A 4DCYA 3G3IA 1ZIUA 1M5FA 4GWOA 2QMXA 4ZEDA 3H6UA 3T66A 4F31B 3ILTB 2M8CA 2DWAA 3EHUA 2PVUA 1JVYA 1NMUA 4DE8A 4MLQA 3I3VA 2XXRA 1ZTYA 4OMBA 4LZ8A 1MRPA 3M3LA 4LZ7A 3PUVE 1YPNA 5KZTA 1Z7ME 3LSXA 3FZVA 5L8DA 1QW0A 2ZYNA 1IXGA 4LQ2A 3M8UA 1B58A 1LBCA 2IEEA 3L6HA 3E3KA 1A54A 1A8EA 4NF8A 2NVUB 2Q9TA 4DDDA 1QVSA 3Q28A 2HZKA 3K01A 4KPTA 2VOZA 2Q88A 5F1QA 1FQBA 1TFDA 1OQGA 3LC8A 3USDA 2H9BA 3FASA 1OMPA 1MY1A 1MXUA 1MXYA 2QS2A 3KFMA 3KN3A 4N13A 3B6QA 1OLAA 1FQCA 1P1WA 5FHMA 1A99A 1XVYA 1MQDA 1IZ1A 5AA2B 2Q89A 2I6EA 4LQ5A 5L9MA 1Y20A 3SEWA 3T96B 2DQVA 1P1NA 4KD5A 1B0LA 2O7IA 5H8SA 3LUYA 3V5AA 5I2NA 5AA3A 1L5TA 2F7AA 4R72A 5IKBA 1EU8A 2V3TA 4EQBA 1IXCA 3MP1A 4X48A 4IO7A 1NNTA 3FXUA 1PB8A 4IGTA 1M5EA 3TZAA 4EF1A 2B65A 3S9MC 4NF4B 3VE1B 2I48A 1FTOA 2GHAA 3VLVA 2W7YA 4BDOA 4QSEA 3ZS6A 1N84A 2DVZA 4BDMA 3M3FA 2XXXA 4EUOA 2FA7A 2HEUA 1B1HA 2REGA 3EQ1A 1S50A 4G8HA 4QFPA 1SW5A 4NF5B 4F3BA 4GXAA 2FYIA 3H3GA 4R73A 4R9FA 2Q8JA 3FUZA 3VDFA 2QS1A 4DXUA 3DP6A 4K3FA 2VD2A 1XT8A 4YMBA 1DMBA 2RINA 3MBPA 2HAUA 3RLFE 1B51A 4R9GA 1ZKBA 2E0SA 2ZNSA 3UA8A 4ELOA 4JWOA 4YKJA 3RNNA 4F1VA 4QFLA 3PPQA 2RC9A 2Q2CA 3LSLA 4TOZA 4R6KA 3OOAA 2O69A 1LAHE 4FEDA 5DEXB 2RF1A 4FECA 3FJMA 5A5XA 3KJ7A 1GV8A 2ONKE 1DTGA 4GL0A 3N94A 1PB9A 2R6GE 5M2VA 1SYHA 1MY2A 1AH5A 4PFWA 1GVCA 4JSDA 4GRKA 3K6VA 4F22A 5CI5A 1LSTA 4MBPA 2IA4A 1MQGA 4EXLA 4X1DA 4I1DA 2NOOA 3EHTA 3ONMA 2BJJX 4AB5A 2F34A 3C9HA 4NTLA 2QMWA 3MZ9A 4BDRA 1A8FA 2A5TB 2R9JA 2ANJA 3IB1A 3TQWA 3RUMA 1FQAA 1JW1A 1NH8A 1FTKA 4WXJA 3U1OA 3CSBA 4YB7A 2XXYA 4P11A 5I2KA 2D3IA 4YMAA 1KWHA 1N76A 1JETA 1H43A 4G68A 3V89B 2Y7WA 2ABHA 2DP8A 3HSTA 1BLFA 1TXFA 1N3XA 3C32A 4ZEFA 4MF3A 4FORA 4LUBA 4X9TA 4ZZAA 4F29A 4AQ4A 3Q27A 4R74A 4DIGA 4LA9A 1QKBA 1JEVA 4KI0E 1J1NA 4ONYA 2XD3A 3Q29A 5H8HB 3G3KA 1SYIA 2X7QA 3R7XA 3CFZA 4QSCA 3DP4A 4KQPA 5HBCA 1JVXA 4GVOA 2Y84A 5F7VA 3JV9A 1TWYA 3H4ZA 2AYSA 1H45A 1OQHA 3QIMA 3E4RA 2I49A 1OLCA 4OVJA 3OO6A 4G2ZA 3MVWA 1HSLA 2HXWA 1NFTA 3TDJA 5K2XA 3IO4A 4KCCA 2HCAA 4ZEKA 3KSJA 2E1SA 4OEUA 4JWXA 3HHGA 5H8NB 3O97A 2YPNA 3EPEA 1HSJA 3PGFA 2OBGA 1WVJA 2QRYA 4PP0A 1URGA 1BIYA 3IOTA 1IEJA 4U4XA 5CMCA 4QHQA 4ZEIA 2O51A 2ZYMA 1IQ7A 4NF6B 3VVDA 1B7UA 2OWSA 5JTYB 5CBRA 3K4UA 3EF7A 1US4A 4E0WA 3R26A 3O29A 1MDQA 3C34A 1O64A 3TCHA 4FIMA 1WDNA 3TMGA 5AA2A 3W9WA 1B9JA 2DS9A 3A3UA 2NXOA 3PPRA 1VE4A 1IITA 3U8QA 4L17A 2THIA 1D9VA 4GXSB 1UIUA 3KN7A 4LATA 3S4UA 1I69A 5CMMA 2H25A 2UYFA 5DYHA 2Q2AA 4ZECA 5JEIA 4H5FA 3K6XA 3K6WA 1BTJA 2O1MA 4DLDA 3G7WA 1O63A 2O84X 4NF4A 3KN8A 4YB5A 1UTHB 3C35A 3H6VA 1A55A 3MAMA 1VFEA 4NEDA 3OELA 5DTBA 3IK6B 3CR9A 3K1NA 1B6HA 1A7LA 1YTVA 1ANFA 3PMWA 2Z23A 2H5YA 4HS7A 4WEDA 3T9VA 3TKDA 4H8IA 4NF5A 1B3GA 4F2OA 1JW4A 4AB6A 4FE8A 3PPNA 1DOTA 3K02A 1LCTA 4UACA 3IB2A 3QUJA 5B70A 4OXVA 5KCJB 1B46A 1XC1A 3M3KA 5EHMA 2QPQA 3UP9A 2PT1A 4OFJA 1MPBA 2F6PA 4E0XA 5FTIA 3QK6A 4YZZA 2PX1A 3MC2A 1SW2A 3KEIA 3KOTA 4XKNA 1QUJA 3MQ9A 3FGSA 4H5GA 3VXCA 3OENA 4BDLA 5I57B 1R9LA 4I62A 3N6UA 1B05A 2P1SA 4U1OA 2V25A 3VLUA 4FAJA 1DPPA 4O3AA 3RPWA 3PD8A 3VLWA 3CI8A 3GBAA 5DEXA 3OSQA 4R2BA 3EHSA 1PEBA 1PBQA 4N6PA 4OERA 2ZNTA 5TP9A 2F36A 3H03A 2WKYA 4R2FA 1FQFA 3ECRA 1I6AA 1B3HA 1AIVA 1NL5A 3THIA 2PMSA 2XXWA 4OZ9A 4KFQA 5KDTB 1MPCA 4O3CA 3D4CA 3WAFA 3S9LC 3H06B 1SI1A 1N7WA 3QUFA 1OVBA 3HCQA 3IR1A 2H4IA 4TLLB 2A5TA 1XVXA 4OTEA 2XX8A 3FVKA 3OO8A 3TTLA 3PUXE 1D9YA 2QS3A 3FVOA 3TAJA 1EH3A 2D21A 1US5A 2PT2A 3ZKKA 1MY0A 3G3HA 2KLFA 1F9BA 3S9NC 4PFYA 1QJMA 2I58A 3CIJA 4GF8A 3OXNA 4LVQA 1B2HA 2Y7RA 4OWDA 3C4MA 1PDAA 3DP8A 1MQHA 2DWHA 5H8HA 4F3SA 1CB6A 2DWIA 1QUKA 1Y4TA 3L6GA 2O7UA 5I59B 3D4GA 3RTFB 2HZLA 3U94A 3MZ1A 3G3FA 4XKRA 3W9VA 1Z7NE 4R75A 2HAVA 2F5XA 2AL5A 3MJNA 2RCAA 3H6TA 3TUSA 3LSFB 1MXVA 2ZMBA 3I5OA 4ZZEA 2UYEA 1FQEA 3UGWA 5CBSA 1JQFA 4G68C 2ONSA 5FHNA 4O3BA 4JB7A 1RYXA 3SEUA 5AA1A 4IGRA 3T93B 2UVGA 5H8NA 4F1UA 2XXHA 4G8MA 5TP9B 4KYSA 4KR5A 3G3JA 3RT6B 1ZMGA 1S7YA 1B3LA 4JDFA 4PETA 5I56B 5AA4B 2F6GA 1MY3A 3OEKA 1FTMA 1PC3A 4WKMA 4HCYA 1BP5A 3C33A 4GD5A 1T0KA 4NF6A 3IJOB 3I6VA 3MZBA 5JTYA 1R1NA 1JW5A 2P2AA 3CSGA 3K6UA 3QXMA 3QSLA 3TTNA 4NE4A 3IOVA 1B4ZA 1LB9A 1YAEA 1MDP1 4GIZA 3BFTA 3V83A 3OSRA 5H8QB 1NH7A 4WEPA 4IO4A 4XTCQ 4U2RA 3V8XB 4Q5TA 4KHZE 1Y1ZA 4EQ9A 1I6QA 2DXYA 2ZYKA 5AA2D 4H67A 4I9DA 1VR5A 4JWYA 1USYE 1CE2A 1VSOA 1SI0A 3O66A 1USYH 4DCXA 3FVNA 3Q26A 1UTHA 3KG2A 2Y7PA 4ZE9A 3UIFA 4Z0IA 3Q25A 1PBPA 1EZ9A 4IY5A 4RPNA 4R6YA 1S9TA 1SD3A 4C1TA 2RKMA 3SETA 3SKPA 2DWJA 4I8CA 3IB0A 1LBBA 4U23A 5KCJA 1B1XA 5B7DA 4ZS9A 4YICA 4BDNA 5DVIA 2ZYOA 4PE5B 4N07A 3MVZA 1FQDA 2ZXTA 5L9SA 4OFLA 1LAXA 4G4PA 4GQOA 1ZLQA 2RC8A 3C31A 4IO2A 1M5DA 5I57A 3IJXB 5L9OA 3O6GA 1B3EA 1MH3A 1SW4A 4C1UA 3TYHA 3SEXA 3O28A 4ESWA 3FXRA 3PUWE 2LAOA 2GH9A 4EF2A 2G93A 1SBPA 3PD9A 1FTJA 2R71A 3CFLA 1UQWA 1FCKA 4FEBA 1TFAA 3PU5A 2UVHA 5DVJA 5CM6A 2GHBA 3VXBA 4M4GA 2OCUA 3PUZE 2I0CA 4ND9A 3PPPA 1R6ZA 5KDTA 2F97A 3SDFA 4QRZA 1MXZA 5CMKA 5DVFA 3TTRA 2V3UA 5ITPA 1FW0A 2DE2A 5ICTA 4YKKA 4U21A 1EZPA 1URDA 4OESA 3FIRA 2AL4A 1A40A 5ISUA 5AE4A 2Z22A 3IX1A 2HFBA 2O1LA 3RGYA 3W15C 3O6HA 3R6UA 2V84A 3UN6A 4KYEA 2H99A 1MG1A 3KJTA 3OO7A 5I58B 1NNPA 4RJZA 2XXVA 4H65A 1B7ZA 1MQIA 3GZGA 1YCJA 4YB6A 1OIBA 3KOSA 5H8FB 1AMFA 3MVYA 4RYAA 3PV0E 3SEYA 1QKAA 2UVIA 4TLMB 2G29A 4IY6A 5ICQA 3KSXA 2CMOA 4OENA 5TPAB 4H6DA 1SW1A 5I59A 3U92A 4QFOA 3AXFA 4RK9A 4BLAA 3PMXA 2XXUA 3PUYE 3CG1A 3GXAA 1O7TA 1IXIA 2F78A 3E9XA 4BDQA 3IO6A 1LLSA 3HV1A 2XX7A 3FVGA 3IOWA 3TELA 5CC2A 1LCFA 3HHFA 4MH5A 3TPAA 2UXAA 1MXWA 5K2YA 4EXKA 2Z8FA 2X7PA 4GL8A 2Z8DA 3KZGA 4UA8A 2B3FA 4POWA 1H76A 3DLNA 3BFUA 2AIXA 1SDXA 3N5LA 2I4BA 2XXIA 4YKPA 1Q35A 2FNCA 5HM4B 4ESXA 5LOMA 1JNFA 2VGQA 4F3GA 4DXCA 3BKIB 5JK4A 1RKMA 2YJPA 3A09A 3IORA 2ONRA 3VFJA 4RA1A 5ELVA 2DYXA 2VP1A 5I56A 3JZJA 4XXUA 5AA4A 2F35A 1Y3QA 1Y3PA 4GFRA 2NUVA 4ZDMA 1I6BA 4OETA 2XXPA 2X26A 3ILUB 4NWDA 3UK4A 1M5CA 1B52A 2HQ0A 3O6IA 3RY3A 5BUUA 2XHDA 1QUIA 4PFUA 3O9PA 1P1OA 5CRYA 1VFDA 4ISUA 3H6WA 3RN8A 1R9QA 5I84A 4U4SA 4PFTA 3PMVA 5H8QA 3OD7A 1Q1KA 4EDPA 1POTA 3K2DA 1ZJLA 2H98A 1H44A 3MPKA 1N0TA 3OO9A 3KGCA 1ELJA 4IB2A 3G3GA 3MVXA 3CFXA 3GBBA 1Y4CA 3FV1A 5DT6A 3VV5A 1OVTA 3P7IA 4U22A 3QAXA 4OEVA 3TEPA 1MM7A 4Q30B 2OJTA 3B6WA 1MQJA 2RCBA 1RYOA 1SVXB 1B7HA 2A5SA 4IO6A 3S2VA 3CRBA 3MPLA 4MLVA 5HPQA 1UTBB 4P0IA 1MPDA 3ZSFA 1DSNA 1ZBMA 2VD3A 4NMYA 1LAFE 3SEVA 3MW0A 2F7BA 1B40A 3T9HB 2O68A 3SERA 2CZLA 3LBSA 4LP2B 2O6AA 1MY4A 2DE3A 3OEMA 4EQ7A 1NNKA 1MXXA 2F7CA 4OQOA 4GOTA 4HW8A 1GR2A 2OK2A 4QF9A 4F1YA 3ODBA 4YU0A 3QYTA 1LB8A 3O2AA 1WODA 1ZU0A 2I3VA 3PPOA 2XD2A 4OHNA 3KBRA 5EYFA 2ZNUA 4FJPA 4POXA 4ELQA 4NF8B 3RTWB 4Z7EA 3RT8A 3CG3A 3FV2A 2P0SA 1GGGA 2PYYA 3ZKLA 4OYVA 1MS7A 1XS5A 4TQUQ 3IL1B 3K1PA 1H3DA 1IXHA 3HN0A 1TT1A 1B5JA 4H0WA 2UVJA 1BKAA 3U72A 4XKPA 4H1XA 1XOCA 4HTGA 3N26A 2XX9A 3RQTA 2DE4A 3FJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F11 A;  2OWT A;  2QSX A;  3TQL A;  4F2Q A;  1Y3N A;  2I3W A;  5EHS A;  3EN3 A;  3N6T A;  3T9U A;  5I2N B;  1NKX A;  1JEU A;  1IIW A;  1GTK A;  4R6H A;  4G8N A;  2DXR A;  2F8D A;  2B3B A;  2REJ A;  4LON B;  4JSO A;  1NNF A;  1AL3 A;  3LSW A;  1EZO A;  1B0H A;  2PBW A;  2Y7K A;  3VVF A;  4IO5 A;  3CVG A;  3H7M A;  4LZ5 A;  4ECF A;  5I58 A;  4M1V A;  1UIV A;  3DM0 A;  3TFL A;  3S9E A;  1IUD A;  3U93 A;  2QJE A;  3WAE A;  5H8F A;  3FJ7 A;  2Z8E A;  1MM6 A;  4NWC A;  1DPE A;  1Y1M A;  2YLN A;  3FAT A;  4U1Z A;  4H8J A;  5TPA A;  1DTZ A;  2I0B A;  1PB7 A;  2RC7 A;  4RY1 A;  4G77 A;  5FTH A;  3FXQ A;  4QFN A;  3BBR A;  3GLB A;  1Y9U A;  4X1B A;  4IO3 A;  1POY 1;  4KCD A;  3HPI A;  3UOR A;  2DOJ A;  4YKI A;  3TCF A;  4FAT A;  4ELP A;  2QL3 A;  1N7X A;  4RPO A;  1P1Q A;  5A5X B;  5IAI A;  3K1M A;  2VHA A;  1MH4 A;  2V3Q A;  3SES A;  4Q0C A;  3TOD A;  4RXL A;  5CMB A;  1II5 A;  3IOU A;  3K0V A;  4ELR A;  2NWJ A;  3TTM A;  1LFI A;  2V93 A;  1P99 A;  4P0G A;  3FD3 A;  4F19 A;  3TCG A;  1LFG A;  3MUQ A;  2GRV A;  2QS4 A;  4DZ1 A;  1LGB C;  3C36 A;  3T22 A;  3IAZ A;  1D4N A;  4RNS A;  3TTK A;  4XKQ A;  5BWJ A;  2ALU A;  2XXQ A;  3OMB A;  1B3F A;  2Y7I A;  2OLB A;  1N04 A;  1QUL A;  4GLI A;  1ATG A;  1N3W A;  3VVE A;  5J1D A;  4JBZ A;  5ITO A;  3JYR A;  5I2K B;  1LFH A;  4DXB A;  2DVC A;  4RK2 A;  4G68 B;  4THI A;  1B5H A;  3T9X B;  4ZEB A;  3A3C A;  3K00 A;  2GFE A;  4C0R A;  4Q8R A;  3MP8 A;  2OZZ A;  1M5B A;  3E13 X;  3B6T A;  3LR1 A;  4F39 A;  4OFO A;  4QSD A;  3MP6 A;  4YAH X;  1SQY A;  1LAG E;  3DEL B;  4QFK A;  5TU0 A;  1D3K A;  2I4C A;  4ZE8 A;  2D5W A;  4F3P A;  4XIG Q;  3B7D A;  2ESN A;  4PQJ A;  1XHY A;  1FTL A;  5FHO A;  2XXT A;  1B5I A;  3HO7 A;  1P1U A;  3MWB A;  4KYD A;  4HCW A;  4JXI A;  1UTB A;  1B4H A;  4MFI A;  4F18 A;  1HSE A;  1AOV A;  2DSF A;  1URS A;  1B32 A;  4DCY A;  3G3I A;  1ZIU A;  1M5F A;  4GWO A;  2QMX A;  4ZED A;  3H6U A;  3T66 A;  4F31 B;  3ILT B;  2M8C A;  2DWA A;  3EHU A;  2PVU A;  1JVY A;  1NMU A;  4DE8 A;  4MLQ A;  3I3V A;  2XXR A;  1ZTY A;  4OMB A;  4LZ8 A;  1MRP A;  3M3L A;  4LZ7 A;  3PUV E;  1YPN A;  5KZT A;  1Z7M E;  3LSX A;  3FZV A;  5L8D A;  1QW0 A;  2ZYN A;  1IXG A;  4LQ2 A;  3M8U A;  1B58 A;  1LBC A;  2IEE A;  3L6H A;  3E3K A;  1A54 A;  1A8E A;  4NF8 A;  2NVU B;  2Q9T A;  4DDD A;  1QVS A;  3Q28 A;  2HZK A;  3K01 A;  4KPT A;  2VOZ A;  2Q88 A;  5F1Q A;  1FQB A;  1TFD A;  1OQG A;  3LC8 A;  3USD A;  2H9B A;  3FAS A;  1OMP A;  1MY1 A;  1MXU A;  1MXY A;  2QS2 A;  3KFM A;  3KN3 A;  4N13 A;  3B6Q A;  1OLA A;  1FQC A;  1P1W A;  5FHM A;  1A99 A;  1XVY A;  1MQD A;  1IZ1 A;  5AA2 B;  2Q89 A;  2I6E A;  4LQ5 A;  5L9M A;  1Y20 A;  3SEW A;  3T96 B;  2DQV A;  1P1N A;  4KD5 A;  1B0L A;  2O7I A;  5H8S A;  3LUY A;  3V5A A;  5I2N A;  5AA3 A;  1L5T A;  2F7A A;  4R72 A;  5IKB A;  1EU8 A;  2V3T A;  4EQB A;  1IXC A;  3MP1 A;  4X48 A;  4IO7 A;  1NNT A;  3FXU A;  1PB8 A;  4IGT A;  1M5E A;  3TZA A;  4EF1 A;  2B65 A;  3S9M C;  4NF4 B;  3VE1 B;  2I48 A;  1FTO A;  2GHA A;  3VLV A;  2W7Y A;  4BDO A;  4QSE A;  3ZS6 A;  1N84 A;  2DVZ A;  4BDM A;  3M3F A;  2XXX A;  4EUO A;  2FA7 A;  2HEU A;  1B1H A;  2REG A;  3EQ1 A;  1S50 A;  4G8H A;  4QFP A;  1SW5 A;  4NF5 B;  4F3B A;  4GXA A;  2FYI A;  3H3G A;  4R73 A;  4R9F A;  2Q8J A;  3FUZ A;  3VDF A;  2QS1 A;  4DXU A;  3DP6 A;  4K3F A;  2VD2 A;  1XT8 A;  4YMB A;  1DMB A;  2RIN A;  3MBP A;  2HAU A;  3RLF E;  1B51 A;  4R9G A;  1ZKB A;  2E0S A;  2ZNS A;  3UA8 A;  4ELO A;  4JWO A;  4YKJ A;  3RNN A;  4F1V A;  4QFL A;  3PPQ A;  2RC9 A;  2Q2C A;  3LSL A;  4TOZ A;  4R6K A;  3OOA A;  2O69 A;  1LAH E;  4FED A;  5DEX B;  2RF1 A;  4FEC A;  3FJM A;  5A5X A;  3KJ7 A;  1GV8 A;  2ONK E;  1DTG A;  4GL0 A;  3N94 A;  1PB9 A;  2R6G E;  5M2V A;  1SYH A;  1MY2 A;  1AH5 A;  4PFW A;  1GVC A;  4JSD A;  4GRK A;  3K6V A;  4F22 A;  5CI5 A;  1LST A;  4MBP A;  2IA4 A;  1MQG A;  4EXL A;  4X1D A;  4I1D A;  2NOO A;  3EHT A;  3ONM A;  2BJJ X;  4AB5 A;  2F34 A;  3C9H A;  4NTL A;  2QMW A;  3MZ9 A;  4BDR A;  1A8F A;  2A5T B;  2R9J A;  2ANJ A;  3IB1 A;  3TQW A;  3RUM A;  1FQA A;  1JW1 A;  1NH8 A;  1FTK A;  4WXJ A;  3U1O A;  3CSB A;  4YB7 A;  2XXY A;  4P11 A;  5I2K A;  2D3I A;  4YMA A;  1KWH A;  1N76 A;  1JET A;  1H43 A;  4G68 A;  3V89 B;  2Y7W A;  2ABH A;  2DP8 A;  3HST A;  1BLF A;  1TXF A;  1N3X A;  3C32 A;  4ZEF A;  4MF3 A;  4FOR A;  4LUB A;  4X9T A;  4ZZA A;  4F29 A;  4AQ4 A;  3Q27 A;  4R74 A;  4DIG A;  4LA9 A;  1QKB A;  1JEV A;  4KI0 E;  1J1N A;  4ONY A;  2XD3 A;  3Q29 A;  5H8H B;  3G3K A;  1SYI A;  2X7Q A;  3R7X A;  3CFZ A;  4QSC A;  3DP4 A;  4KQP A;  5HBC A;  1JVX A;  4GVO A;  2Y84 A;  5F7V A;  3JV9 A;  1TWY A;  3H4Z A;  2AYS A;  1H45 A;  1OQH A;  3QIM A;  3E4R A;  2I49 A;  1OLC A;  4OVJ A;  3OO6 A;  4G2Z A;  3MVW A;  1HSL A;  2HXW A;  1NFT A;  3TDJ A;  5K2X A;  3IO4 A;  4KCC A;  2HCA A;  4ZEK A;  3KSJ A;  2E1S A;  4OEU A;  4JWX A;  3HHG A;  5H8N B;  3O97 A;  2YPN A;  3EPE A;  1HSJ A;  3PGF A;  2OBG A;  1WVJ A;  2QRY A;  4PP0 A;  1URG A;  1BIY A;  3IOT A;  1IEJ A;  4U4X A;  5CMC A;  4QHQ A;  4ZEI A;  2O51 A;  2ZYM A;  1IQ7 A;  4NF6 B;  3VVD A;  1B7U A;  2OWS A;  5JTY B;  5CBR A;  3K4U A;  3EF7 A;  1US4 A;  4E0W A;  3R26 A;  3O29 A;  1MDQ A;  3C34 A;  1O64 A;  3TCH A;  4FIM A;  1WDN A;  3TMG A;  5AA2 A;  3W9W A;  1B9J A;  2DS9 A;  3A3U A;  2NXO A;  3PPR A;  1VE4 A;  1IIT A;  3U8Q A;  4L17 A;  2THI A;  1D9V A;  4GXS B;  1UIU A;  3KN7 A;  4LAT A;  3S4U A;  1I69 A;  5CMM A;  2H25 A;  2UYF A;  5DYH A;  2Q2A A;  4ZEC A;  5JEI A;  4H5F A;  3K6X A;  3K6W A;  1BTJ A;  2O1M A;  4DLD A;  3G7W A;  1O63 A;  2O84 X;  4NF4 A;  3KN8 A;  4YB5 A;  1UTH B;  3C35 A;  3H6V A;  1A55 A;  3MAM A;  1VFE A;  4NED A;  3OEL A;  5DTB A;  3IK6 B;  3CR9 A;  3K1N A;  1B6H A;  1A7L A;  1YTV A;  1ANF A;  3PMW A;  2Z23 A;  2H5Y A;  4HS7 A;  4WED A;  3T9V A;  3TKD A;  4H8I A;  4NF5 A;  1B3G A;  4F2O A;  1JW4 A;  4AB6 A;  4FE8 A;  3PPN A;  1DOT A;  3K02 A;  1LCT A;  4UAC A;  3IB2 A;  3QUJ A;  5B70 A;  4OXV A;  5KCJ B;  1B46 A;  1XC1 A;  3M3K A;  5EHM A;  2QPQ A;  3UP9 A;  2PT1 A;  4OFJ A;  1MPB A;  2F6P A;  4E0X A;  5FTI A;  3QK6 A;  4YZZ A;  2PX1 A;  3MC2 A;  1SW2 A;  3KEI A;  3KOT A;  4XKN A;  1QUJ A;  3MQ9 A;  3FGS A;  4H5G A;  3VXC A;  3OEN A;  4BDL A;  5I57 B;  1R9L A;  4I62 A;  3N6U A;  1B05 A;  2P1S A;  4U1O A;  2V25 A;  3VLU A;  4FAJ A;  1DPP A;  4O3A A;  3RPW A;  3PD8 A;  3VLW A;  3CI8 A;  3GBA A;  5DEX A;  3OSQ A;  4R2B A;  3EHS A;  1PEB A;  1PBQ A;  4N6P A;  4OER A;  2ZNT A;  5TP9 A;  2F36 A;  3H03 A;  2WKY A;  4R2F A;  1FQF A;  3ECR A;  1I6A A;  1B3H A;  1AIV A;  1NL5 A;  3THI A;  2PMS A;  2XXW A;  4OZ9 A;  4KFQ A;  5KDT B;  1MPC A;  4O3C A;  3D4C A;  3WAF A;  3S9L C;  3H06 B;  1SI1 A;  1N7W A;  3QUF A;  1OVB A;  3HCQ A;  3IR1 A;  2H4I A;  4TLL B;  2A5T A;  1XVX A;  4OTE A;  2XX8 A;  3FVK A;  3OO8 A;  3TTL A;  3PUX E;  1D9Y A;  2QS3 A;  3FVO A;  3TAJ A;  1EH3 A;  2D21 A;  1US5 A;  2PT2 A;  3ZKK A;  1MY0 A;  3G3H A;  2KLF A;  1F9B A;  3S9N C;  4PFY A;  1QJM A;  2I58 A;  3CIJ A;  4GF8 A;  3OXN A;  4LVQ A;  1B2H A;  2Y7R A;  4OWD A;  3C4M A;  1PDA A;  3DP8 A;  1MQH A;  2DWH A;  5H8H A;  4F3S A;  1CB6 A;  2DWI A;  1QUK A;  1Y4T A;  3L6G A;  2O7U A;  5I59 B;  3D4G A;  3RTF B;  2HZL A;  3U94 A;  3MZ1 A;  3G3F A;  4XKR A;  3W9V A;  1Z7N E;  4R75 A;  2HAV A;  2F5X A;  2AL5 A;  3MJN A;  2RCA A;  3H6T A;  3TUS A;  3LSF B;  1MXV A;  2ZMB A;  3I5O A;  4ZZE A;  2UYE A;  1FQE A;  3UGW A;  5CBS A;  1JQF A;  4G68 C;  2ONS A;  5FHN A;  4O3B A;  4JB7 A;  1RYX A;  3SEU A;  5AA1 A;  4IGR A;  3T93 B;  2UVG A;  5H8N A;  4F1U A;  2XXH A;  4G8M A;  5TP9 B;  4KYS A;  4KR5 A;  3G3J A;  3RT6 B;  1ZMG A;  1S7Y A;  1B3L A;  4JDF A;  4PET A;  5I56 B;  5AA4 B;  2F6G A;  1MY3 A;  3OEK A;  1FTM A;  1PC3 A;  4WKM A;  4HCY A;  1BP5 A;  3C33 A;  4GD5 A;  1T0K A;  4NF6 A;  3IJO B;  3I6V A;  3MZB A;  5JTY A;  1R1N A;  1JW5 A;  2P2A A;  3CSG A;  3K6U A;  3QXM A;  3QSL A;  3TTN A;  4NE4 A;  3IOV A;  1B4Z A;  1LB9 A;  1YAE A;  1MDP 1;  4GIZ A;  3BFT A;  3V83 A;  3OSR A;  5H8Q B;  1NH7 A;  4WEP A;  4IO4 A;  4XTC Q;  4U2R A;  3V8X B;  4Q5T A;  4KHZ E;  1Y1Z A;  4EQ9 A;  1I6Q A;  2DXY A;  2ZYK A;  5AA2 D;  4H67 A;  4I9D A;  1VR5 A;  4JWY A;  1USY E;  1CE2 A;  1VSO A;  1SI0 A;  3O66 A;  1USY H;  4DCX A;  3FVN A;  3Q26 A;  1UTH A;  3KG2 A;  2Y7P A;  4ZE9 A;  3UIF A;  4Z0I A;  3Q25 A;  1PBP A;  1EZ9 A;  4IY5 A;  4RPN A;  4R6Y A;  1S9T A;  1SD3 A;  4C1T A;  2RKM A;  3SET A;  3SKP A;  2DWJ A;  4I8C A;  3IB0 A;  1LBB A;  4U23 A;  5KCJ A;  1B1X A;  5B7D A;  4ZS9 A;  4YIC A;  4BDN A;  5DVI A;  2ZYO A;  4PE5 B;  4N07 A;  3MVZ A;  1FQD A;  2ZXT A;  5L9S A;  4OFL A;  1LAX A;  4G4P A;  4GQO A;  1ZLQ A;  2RC8 A;  3C31 A;  4IO2 A;  1M5D A;  5I57 A;  3IJX B;  5L9O A;  3O6G A;  1B3E A;  1MH3 A;  1SW4 A;  4C1U A;  3TYH A;  3SEX A;  3O28 A;  4ESW A;  3FXR A;  3PUW E;  2LAO A;  2GH9 A;  4EF2 A;  2G93 A;  1SBP A;  3PD9 A;  1FTJ A;  2R71 A;  3CFL A;  1UQW A;  1FCK A;  4FEB A;  1TFA A;  3PU5 A;  2UVH A;  5DVJ A;  5CM6 A;  2GHB A;  3VXB A;  4M4G A;  2OCU A;  3PUZ E;  2I0C A;  4ND9 A;  3PPP A;  1R6Z A;  5KDT A;  2F97 A;  3SDF A;  4QRZ A;  1MXZ A;  5CMK A;  5DVF A;  3TTR A;  2V3U A;  5ITP A;  1FW0 A;  2DE2 A;  5ICT A;  4YKK A;  4U21 A;  1EZP A;  1URD A;  4OES A;  3FIR A;  2AL4 A;  1A40 A;  5ISU A;  5AE4 A;  2Z22 A;  3IX1 A;  2HFB A;  2O1L A;  3RGY A;  3W15 C;  3O6H A;  3R6U A;  2V84 A;  3UN6 A;  4KYE A;  2H99 A;  1MG1 A;  3KJT A;  3OO7 A;  5I58 B;  1NNP A;  4RJZ A;  2XXV A;  4H65 A;  1B7Z A;  1MQI A;  3GZG A;  1YCJ A;  4YB6 A;  1OIB A;  3KOS A;  5H8F B;  1AMF A;  3MVY A;  4RYA A;  3PV0 E;  3SEY A;  1QKA A;  2UVI A;  4TLM B;  2G29 A;  4IY6 A;  5ICQ A;  3KSX A;  2CMO A;  4OEN A;  5TPA B;  4H6D A;  1SW1 A;  5I59 A;  3U92 A;  4QFO A;  3AXF A;  4RK9 A;  4BLA A;  3PMX A;  2XXU A;  3PUY E;  3CG1 A;  3GXA A;  1O7T A;  1IXI A;  2F78 A;  3E9X A;  4BDQ A;  3IO6 A;  1LLS A;  3HV1 A;  2XX7 A;  3FVG A;  3IOW A;  3TEL A;  5CC2 A;  1LCF A;  3HHF A;  4MH5 A;  3TPA A;  2UXA A;  1MXW A;  5K2Y A;  4EXK A;  2Z8F A;  2X7P A;  4GL8 A;  2Z8D A;  3KZG A;  4UA8 A;  2B3F A;  4POW A;  1H76 A;  3DLN A;  3BFU A;  2AIX A;  1SDX A;  3N5L A;  2I4B A;  2XXI A;  4YKP A;  1Q35 A;  2FNC A;  5HM4 B;  4ESX A;  5LOM A;  1JNF A;  2VGQ A;  4F3G A;  4DXC A;  3BKI B;  5JK4 A;  1RKM A;  2YJP A;  3A09 A;  3IOR A;  2ONR A;  3VFJ A;  4RA1 A;  5ELV A;  2DYX A;  2VP1 A;  5I56 A;  3JZJ A;  4XXU A;  5AA4 A;  2F35 A;  1Y3Q A;  1Y3P A;  4GFR A;  2NUV A;  4ZDM A;  1I6B A;  4OET A;  2XXP A;  2X26 A;  3ILU B;  4NWD A;  3UK4 A;  1M5C A;  1B52 A;  2HQ0 A;  3O6I A;  3RY3 A;  5BUU A;  2XHD A;  1QUI A;  4PFU A;  3O9P A;  1P1O A;  5CRY A;  1VFD A;  4ISU A;  3H6W A;  3RN8 A;  1R9Q A;  5I84 A;  4U4S A;  4PFT A;  3PMV A;  5H8Q A;  3OD7 A;  1Q1K A;  4EDP A;  1POT A;  3K2D A;  1ZJL A;  2H98 A;  1H44 A;  3MPK A;  1N0T A;  3OO9 A;  3KGC A;  1ELJ A;  4IB2 A;  3G3G A;  3MVX A;  3CFX A;  3GBB A;  1Y4C A;  3FV1 A;  5DT6 A;  3VV5 A;  1OVT A;  3P7I A;  4U22 A;  3QAX A;  4OEV A;  3TEP A;  1MM7 A;  4Q30 B;  2OJT A;  3B6W A;  1MQJ A;  2RCB A;  1RYO A;  1SVX B;  1B7H A;  2A5S A;  4IO6 A;  3S2V A;  3CRB A;  3MPL A;  4MLV A;  5HPQ A;  1UTB B;  4P0I A;  1MPD A;  3ZSF A;  1DSN A;  1ZBM A;  2VD3 A;  4NMY A;  1LAF E;  3SEV A;  3MW0 A;  2F7B A;  1B40 A;  3T9H B;  2O68 A;  3SER A;  2CZL A;  3LBS A;  4LP2 B;  2O6A A;  1MY4 A;  2DE3 A;  3OEM A;  4EQ7 A;  1NNK A;  1MXX A;  2F7C A;  4OQO A;  4GOT A;  4HW8 A;  1GR2 A;  2OK2 A;  4QF9 A;  4F1Y A;  3ODB A;  4YU0 A;  3QYT A;  1LB8 A;  3O2A A;  1WOD A;  1ZU0 A;  2I3V A;  3PPO A;  2XD2 A;  4OHN A;  3KBR A;  5EYF A;  2ZNU A;  4FJP A;  4POX A;  4ELQ A;  4NF8 B;  3RTW B;  4Z7E A;  3RT8 A;  3CG3 A;  3FV2 A;  2P0S A;  1GGG A;  2PYY A;  3ZKL A;  4OYV A;  1MS7 A;  1XS5 A;  4TQU Q;  3IL1 B;  3K1P A;  1H3D A;  1IXH A;  3HN0 A;  1TT1 A;  1B5J A;  4H0W A;  2UVJ A;  1BKA A;  3U72 A;  4XKP A;  4H1X A;  1XOC A;  4HTG A;  3N26 A;  2XX9 A;  3RQT A;  2DE4 A;  3FJG A; 
#chains in the Genus database with same CATH topology
 4O7I A;  3F11 A;  2OWT A;  4JI2 E;  2QSX A;  2WBS A;  3TQL A;  4F2Q A;  1Y3N A;  2I3W A;  5EHS A;  2B7T A;  3EN3 A;  3N6T A;  2RTX A;  3T9U A;  5I2N B;  1NKX A;  1AWB A;  1JEU A;  1IIW A;  1RDY A;  1GTK A;  4R6H A;  4G8N A;  5A6B A;  2GHF A;  1SR9 A;  2DXR A;  1A1J A;  2YTO A;  2F8D A;  2LCE A;  4AS4 A;  2B3B A;  2ZZW A;  2REJ A;  2HC5 A;  4LON B;  4JSO A;  1NNF A;  1AL3 A;  3LSW A;  1EZO A;  4N81 A;  1FPI A;  1N32 E;  1Q9D A;  4R03 A;  1B0H A;  2PBW A;  2Y7K A;  3VVF A;  4IO5 A;  3CVG A;  3H7M A;  4LZ5 A;  4ECF A;  5I58 A;  5I3S A;  2KON A;  4M1V A;  4TUG A;  1RDX A;  1UIV A;  3DM0 A;  3TFL A;  3S9E A;  1IUD A;  4B3R E;  3U93 A;  1PKP A;  4IR8 A;  2QJE A;  3WAE A;  5H8F A;  4DV7 E;  5BR8 E;  3IWB A;  3FJ7 A;  1Z1B A;  2LUP B;  4H46 A;  2EQ3 A;  2JWO A;  1LBW A;  2Z8E A;  1MM6 A;  1NCS A;  4NWC A;  5TSE A;  1DPE A;  1Y1M A;  2YLN A;  2EMC A;  3FAT A;  4U1Z A;  4H8J A;  5TPA A;  1DTZ A;  2GQ1 A;  2UUB E;  2I0B A;  2EM3 A;  1PB7 A;  3T1H E;  5ET5 A;  2NUF A;  1IQO A;  2RC7 A;  4PFI A;  4RY1 A;  4G77 A;  5A2Q C;  2UXD E;  3C6K A;  1EH8 A;  2A25 A;  2B7V A;  4R2E A;  3QG5 C;  2VPO A;  5FTH A;  3FXQ A;  4QFN A;  3KBZ A;  1PJS A;  2EPO A;  3BBR A;  4O7M A;  3GLB A;  4YHH E;  2R76 A;  1Y9U A;  2LVH A;  4X1B A;  2EN4 A;  4IO3 A;  1POY 1;  4KCD A;  3HPI A;  3UOR A;  3FIG A;  1KYQ A;  2ODR D;  2DOJ A;  4NZV A;  4LF8 E;  4YKI A;  1RDZ A;  3TCF A;  4FAT A;  4X8R A;  4ELP A;  2QL3 A;  1N7X A;  2LBS B;  4RPO A;  1P1Q A;  3KC1 A;  2V8Q B;  3HQ1 A;  4L5N C;  5A5X B;  4PDH A;  1N3G A;  5IAI A;  3K1M A;  2VHA A;  1MH4 A;  2V3Q A;  3SES A;  4Q0C A;  2CSH A;  5FLX C;  2HGH A;  2WBT A;  3TOD A;  4RXL A;  5CMB A;  4TUI A;  1EYJ A;  2RSI A;  1II5 A;  1NV1 A;  3IOU A;  4P8B A;  3K0V A;  4ELR A;  2NWJ A;  3TTM A;  1LFI A;  2V93 A;  1P99 A;  4P0G A;  3FD3 A;  4F19 A;  3FBP A;  3TCG A;  1LFG A;  3MUQ A;  2GRV A;  2QS4 A;  4DR6 E;  3IWC A;  2EOM A;  4DZ1 A;  4DI3 D;  4MNI A;  1LGB C;  3C36 A;  1BB8 A;  3T22 A;  3IAZ A;  1D4N A;  1GZ6 A;  1YYO A;  4RNS A;  3TTK A;  4XKQ A;  5BWJ A;  2EMX A;  2ALU A;  2XXQ A;  1FKA E;  3OMB A;  1B3F A;  3ROJ A;  2EN7 A;  4DV4 E;  2Y7I A;  1D9Q A;  2FVZ A;  2ODR C;  3LUZ A;  1NUX A;  2OLB A;  2FIE A;  1N04 A;  1QUL A;  1K9Y A;  1ATG A;  1N3W A;  4GLI A;  3VVE A;  5J1D A;  4JBZ A;  5ITO A;  3JYR A;  5I2K B;  1LFH A;  1X5W A;  2L5V A;  4DXB A;  4NGU A;  2F8B A;  2DVC A;  1RQ0 A;  4RK2 A;  5EYG A;  4G68 B;  4THI A;  1B5H A;  3T9X B;  4ZEB A;  1RC7 A;  1IMC A;  3A3C A;  1CNQ A;  3K00 A;  2EQ0 A;  2GFE A;  4C0R A;  4Q8R A;  1LBY A;  4NXM E;  3MP8 A;  4LF5 E;  5I5P A;  2OZZ A;  2GPI A;  1FPE A;  2E72 A;  1M5B A;  2EMH A;  3E13 X;  3B6T A;  3LR1 A;  4NAP A;  4F39 A;  4OFO A;  1HNX E;  4QSD A;  4AS5 A;  3MP6 A;  4YAH X;  1SQY A;  1LAG E;  3DEL B;  4IJD A;  4QFK A;  5TU0 A;  1D3K A;  2I4C A;  2EM5 A;  4ZE8 A;  1FPL A;  2D5W A;  4F3P A;  4XIG Q;  3B7D A;  2ESN A;  4PQJ A;  1XHY A;  1FTL A;  2EN1 A;  4NHR A;  4MNC A;  3U65 A;  5A6A A;  2XXT A;  4OVS A;  2EWL A;  5ET7 A;  5FHO A;  1B5I A;  3HO7 A;  1P1U A;  3MWB A;  4KYD A;  2HHH E;  3LML A;  4F54 A;  4HCW A;  1STU A;  4JXI A;  1UTB A;  1B4H A;  4MFI A;  4F18 A;  1HSE A;  4WSG A;  2XXK A;  1AOV A;  2DSF A;  1URS A;  1B32 A;  4I40 A;  2FIX A;  4DCY A;  3G3I A;  1ZIU A;  1M5F A;  4GWO A;  4X9J A;  2OX3 A;  2QMX A;  4UAB A;  3KZZ A;  4ZED A;  3H6U A;  3T66 A;  4F31 B;  4JI8 E;  2EPR A;  2WBD A;  5AE2 A;  3ILT B;  2M8C A;  2DWA A;  3EHU A;  2PVU A;  1LBX A;  1T4O A;  1JVY A;  1NMU A;  4O94 A;  4DE8 A;  4MLQ A;  3I3V A;  2XXR A;  3J81 C;  1ZTY A;  4OMB A;  3TQM A;  4LZ8 A;  4OVT A;  1MRP A;  3M3L A;  4LZ7 A;  3PUV E;  1YPN A;  5KZT A;  1Z7M E;  3LSX A;  3FZV A;  5L8D A;  4B3M E;  2YT4 A;  1QW0 A;  2JY9 A;  4RH8 A;  1MGT A;  1IXG A;  2ZYN A;  5LLQ A;  3ADG A;  1XI6 A;  4LQ2 A;  4DV5 E;  3M8U A;  1B58 A;  1LBC A;  2IEE A;  4R2P A;  3L6H A;  5CFF E;  4DR4 E;  4WYQ B;  1FPJ A;  2BJI A;  3E3K A;  1A54 A;  2YTF A;  1A8E A;  4NF8 A;  3F6H A;  2NVU B;  2EM2 A;  2Q9T A;  4IS1 C;  4GX6 A;  4DDD A;  1QVS A;  2B9D A;  3Q28 A;  4LFA E;  3LLH A;  2HZK A;  4GX3 A;  3K01 A;  1T4N A;  4KPT A;  4P1L A;  2VOZ A;  2Q88 A;  5F1Q A;  2P3V A;  1FQB A;  1TFD A;  1OQG A;  3LC8 A;  4GWU A;  4MNP A;  2EPX A;  2H9B A;  3FAS A;  3USD A;  2EM4 A;  1OMP A;  1MY1 A;  1MXU A;  1MXY A;  2QS2 A;  4NG7 A;  3KFM A;  2XWV A;  3KN3 A;  4N13 A;  4ZYE A;  3B6Q A;  1OLA A;  1FQC A;  4DUY E;  1P1W A;  3ZOQ B;  4JI4 E;  5FHM A;  4WX9 A;  1FJG E;  1A99 A;  1XVY A;  3ISP A;  1MQD A;  1IZ1 A;  5AA2 B;  4BS9 A;  2Q89 A;  2I6E A;  4LQ5 A;  1NEI A;  5L9M A;  2LO3 A;  1Y20 A;  3SEW A;  1WHN A;  1EYK A;  3T1B A;  3T96 B;  2DQV A;  2RSM A;  3VYX A;  2YRK A;  2KR0 A;  2ENA A;  1P1N A;  5FBP A;  4GWZ A;  4KD5 A;  2L33 A;  1B0L A;  2O7I A;  5H8S A;  4LF9 E;  3LUY A;  3V5A A;  5I2N A;  4WXC A;  5AA3 A;  1JK2 A;  1L5T A;  1G2F C;  2F7A A;  2FGG A;  2QVV A;  2V85 A;  4R72 A;  2FTX B;  5IKB A;  4Q35 B;  1SFE A;  1EU8 A;  1IMF A;  2V3T A;  2FBP A;  4EQB A;  1IXC A;  1FBF A;  3MP1 A;  4X48 A;  4IO7 A;  1NNT A;  4F9C B;  3FXU A;  1PB8 A;  4GBV A;  4IGT A;  4PFR A;  1M5E A;  2B4M A;  2R8T A;  3TZA A;  2YU8 A;  4EF1 A;  2B65 A;  3S9M C;  4NF4 B;  3AV0 A;  4KXP A;  3VE1 B;  2I48 A;  1FTO A;  2LRS A;  2GHA A;  3VLV A;  2W7Y A;  2EPU A;  1ZU1 A;  4BDO A;  5EQA A;  2M7Q A;  3BIG A;  4QSE A;  3ZS6 A;  4P1E A;  1N84 A;  2DVZ A;  4BDM A;  3M3F A;  4HE0 A;  2XXX A;  3PTY A;  4EUO A;  2EOX A;  2HEU A;  2FA7 A;  1B1H A;  2REG A;  3EQ1 A;  3HXL A;  1S50 A;  4G8H A;  2L3J A;  3QMF A;  4QFP A;  1SW5 A;  4MEV A;  4NF5 B;  5LDZ A;  4F3B A;  4GXA A;  1WHQ A;  2FYI A;  4XFE A;  3H3G A;  1FBP A;  4R73 A;  4R9F A;  2Q8J A;  4PGP A;  3FUZ A;  3VDF A;  2QS1 A;  4DXU A;  2ENC A;  3MHS C;  4WFT A;  1N33 E;  3DP6 A;  4K3F A;  2VD2 A;  1PJT A;  1L4S A;  1XT8 A;  4GBW A;  5DW8 A;  4YMB A;  1DMB A;  2RIN A;  2EN2 A;  2EM0 A;  3IFC A;  3MBP A;  2HAU A;  3RLF E;  1B51 A;  1IQS A;  2F3D A;  1YYW A;  4R9G A;  1ZKB A;  2EE8 A;  2E0S A;  2ZNS A;  4GX4 A;  4NHB A;  3UA8 A;  4R2A A;  4ELO A;  1TF6 A;  5A5L A;  4JWO A;  5KL4 A;  4YKJ A;  3RNN A;  4F1V A;  1X3C A;  4QFL A;  2EOF A;  1FPG A;  3MYU A;  2EM8 A;  3PPQ A;  1T38 A;  2RC9 A;  2Q2C A;  3LSL A;  4TOZ A;  4R6K A;  2EPN A;  2VT5 A;  3OOA A;  2O69 A;  1LAH E;  4FED A;  5A6J A;  4LFB E;  4MCO A;  5DEX B;  2RF1 A;  4FEC A;  4PF6 A;  3FJM A;  4N8Y A;  2FHY A;  5A5X A;  2I13 A;  5ET8 A;  1A1K A;  4WXD A;  3KJ7 A;  1GV8 A;  2ONK E;  1DTG A;  4GL0 A;  3N94 A;  1NV4 A;  2EPM X;  4I3Y A;  1PB9 A;  2R6G E;  4I8O A;  1NV0 A;  5M2V A;  1SYH A;  1MY2 A;  1AH5 A;  4PFW A;  1GVC A;  1FBD A;  3ADJ A;  4L8N A;  4F6N A;  4JSD A;  4GRK A;  3K6V A;  4F22 A;  5CI5 A;  1LST A;  4MBP A;  2IA4 A;  1MQG A;  4EXL A;  4JYA E;  4X1D A;  1YYZ A;  2EOS A;  2NOO A;  4I1D A;  2LV2 A;  3EHT A;  3ONM A;  2BJJ X;  4AB5 A;  2PFY A;  2F34 A;  3FXB A;  3C9H A;  2WCC 3;  4NTL A;  2QMW A;  1KZ8 A;  1DI2 A;  3MZ9 A;  2RS6 A;  4BDR A;  1A8F A;  2A5T B;  2R9J A;  4ZYH A;  2ANJ A;  2RS7 A;  3IB1 A;  3TQW A;  3RUM A;  1FQA A;  1JW1 A;  2MDR A;  1NH8 A;  1FRP A;  1FTK A;  4WXJ A;  3U1O A;  3CSB A;  1LEV A;  5KL2 A;  4YB7 A;  4P7D A;  2XXY A;  2EN6 A;  2EPC A;  4P11 A;  5I2K A;  2D3I A;  4YMA A;  1KWH A;  2L8T A;  1N76 A;  1JET A;  1H43 A;  4G68 A;  2EPA A;  3V89 B;  2Y7W A;  2ABH A;  2YSO A;  2DP8 A;  3HST A;  1BLF A;  1TXF A;  1N3X A;  3C32 A;  4O24 A;  4OX9 E;  4ZEF A;  4MF3 A;  4FOR A;  1NV2 A;  5F24 A;  1QGX A;  4LUB A;  4X9T A;  4ZZA A;  4F29 A;  4AQ4 A;  2YU5 A;  2EN8 A;  3Q27 A;  4R74 A;  4DIG A;  4R2D A;  4LA9 A;  1QKB A;  2N8X A;  1JEV A;  4KI0 E;  1J1N A;  4ONY A;  1WJP A;  2XD3 A;  3Q29 A;  5H8H B;  3G3K A;  1SYI A;  2X7Q A;  4MHF A;  2L2K B;  2E5L E;  3R7X A;  3CFZ A;  4QSC A;  2EZ6 A;  3DP4 A;  4KQP A;  2YRM A;  5HBC A;  1JVX A;  2EMF A;  1IMB A;  1O0W A;  4GVO A;  1HNW E;  2Y84 A;  5F7V A;  4JI5 E;  3JV9 A;  1TWY A;  3H4Z A;  4PAK A;  2AYS A;  4X8W A;  4N91 A;  1LBZ A;  1H45 A;  1OQH A;  1FTA A;  3QIM A;  2EL4 A;  3E4R A;  2I49 A;  2EMK A;  2GLI A;  4GKJ E;  1OLC A;  2F3B A;  2WZO A;  4OVJ A;  3OO6 A;  4G2Z A;  1FSA A;  4FBP A;  3MVW A;  4DMI A;  4PGN A;  3RPL B;  1HSL A;  2HXW A;  3J7A G;  1NFT A;  1YZ9 A;  3TDJ A;  5ADZ A;  4DV6 E;  5K2X A;  2E1M A;  3IO4 A;  4KCC A;  2HCA A;  1G0H A;  4ZEK A;  3KSJ A;  2E1S A;  4OEU A;  2EL6 A;  4JWX A;  3HHG A;  5H8N B;  3O97 A;  2LMZ A;  2YPN A;  3EPE A;  2WYK A;  1HSJ A;  5IV8 B;  3PGF A;  2OBG A;  1WVJ A;  4X64 E;  2QRY A;  4PP0 A;  1URG A;  4KWY A;  1BIY A;  3IOT A;  2YSP A;  3HTX A;  1IEJ A;  4U4X A;  5CMC A;  3HPZ A;  4QHQ A;  2L3C A;  2JPA A;  2CT1 A;  1J5E E;  4KHP E;  4DR1 E;  4ZEI A;  2O51 A;  1LBV A;  2ZYM A;  1IQ7 A;  1AAY A;  4NF6 B;  1SPI A;  3VVD A;  4JI7 E;  4O5G A;  1B7U A;  2OWS A;  1DK4 A;  3EKI A;  5JTY B;  5CBR A;  3K4U A;  3EF7 A;  1FBG A;  3LV0 A;  1US4 A;  4E0W A;  3R26 A;  3O29 A;  4JV5 E;  1MDQ A;  3C34 A;  1O64 A;  2Q8M A;  3TCH A;  3IWD A;  4FK5 C;  4FIM A;  4DR2 E;  1WDN A;  2F4V E;  3TMG A;  5AA2 A;  3W9W A;  1B9J A;  2DS9 A;  4Q28 A;  3A3U A;  2HXR A;  2NXO A;  5KL7 A;  3PPR A;  1VE4 A;  1IIT A;  3U8Q A;  4L17 A;  1YZ0 A;  2KOU A;  2THI A;  1TF3 A;  1D9V A;  4GXS B;  4N4U A;  2DLQ A;  1UIU A;  2I9I A;  3KN7 A;  5AE1 A;  4LAT A;  5KL6 A;  4F6M A;  3S4U A;  1I69 A;  3EPH A;  5CMM A;  2H25 A;  2UYF A;  2Y5K A;  5DYH A;  2Q2A A;  4ZEC A;  5JEI A;  4H5F A;  3K6X A;  4BBY A;  2CEY A;  3K6W A;  1BTJ A;  2O1M A;  4DLD A;  3MST A;  2EMB A;  3G7W A;  1O63 A;  2O84 X;  4NF4 A;  3KN8 A;  4YB5 A;  1UTH B;  3C35 A;  3H6V A;  1A55 A;  3MAM A;  1VFE A;  4NED A;  3OEL A;  5DTB A;  2DRP A;  3IK6 B;  2YTE A;  3CR9 A;  3ADI A;  2XA5 A;  3K1N A;  1B6H A;  2UUA E;  1EYI A;  1A7L A;  1YTV A;  1XMO E;  1ANF A;  3PMW A;  2Z23 A;  2H5Y A;  4HS7 A;  4WED A;  3T9V A;  3TKD A;  4H8I A;  4NF5 A;  4YY3 E;  1B3G A;  4F2O A;  2EMZ A;  1NI9 A;  1JW4 A;  2IHR 1;  1QU6 A;  1NUW A;  4AB6 A;  4FE8 A;  3PPN A;  1MEY C;  1DOT A;  3K02 A;  1LCT A;  4UAC A;  3IB2 A;  4OVP A;  3QUJ A;  2EQ1 A;  4OXV A;  5B70 A;  5KCJ B;  1B46 A;  1FPF A;  1XC1 A;  1EH7 A;  3M3K A;  3E78 A;  5EHM A;  5IZ1 A;  1UHZ A;  5EYH A;  2QPQ A;  3UP9 A;  2PT1 A;  4OFJ A;  1MPB A;  2EM9 A;  2F6P A;  4E0X A;  5FTI A;  3QK6 A;  4YZZ A;  2PX1 A;  3MC2 A;  5T6J A;  1SW2 A;  3KEI A;  3DJW A;  4MX6 A;  3AUZ A;  3KOT A;  4XKN A;  5A69 A;  4OA4 A;  1QUJ A;  3MQ9 A;  2NAB A;  2V88 A;  3FGS A;  2LUQ A;  4H5G A;  3VXC A;  3OEN A;  4BDL A;  3VK6 A;  4JI1 E;  5I57 B;  1R9L A;  4I62 A;  3N6U A;  1B05 A;  4KZS A;  2P1S A;  4U1O A;  2V25 A;  3VLU A;  2PRT A;  4FAJ A;  4HE2 A;  2LTS A;  2EM7 A;  1DPP A;  1XMQ E;  5I7I A;  4O3A A;  3RPW A;  1A1L A;  3PD8 A;  3VLW A;  3CI8 A;  2JYA A;  3GBA A;  4PAF A;  1X49 A;  3RMP A;  5DEX A;  3OSQ A;  4R2B A;  3EHS A;  1PEB A;  2LTR A;  2YTG A;  1PBQ A;  4N6P A;  2EPL X;  4DR7 E;  4OER A;  2ZNT A;  5TP9 A;  2EOJ A;  2MKN A;  3MHH C;  2EJ4 A;  2F36 A;  3H03 A;  2WKY A;  4R2F A;  2L2N A;  1FQF A;  2MKD A;  3ECR A;  1I6A A;  1B3H A;  1AIV A;  1NL5 A;  2EOO A;  3THI A;  2PMS A;  2XXW A;  4OZ9 A;  4KFQ A;  4DV1 E;  5KDT B;  3BID A;  1MPC A;  4PF8 A;  4O3C A;  2V86 A;  3D4C A;  2EMW A;  2RPC A;  3WAF A;  1INP A;  2RQL A;  3H06 B;  1SI1 A;  1N7W A;  3S9L C;  1A1G A;  1X47 A;  1N34 E;  3QUF A;  4GKK E;  2CEX A;  1OVB A;  3HCQ A;  4ZYG A;  3IR1 A;  2H4I A;  4TLL B;  2A5T A;  1XVX A;  2WBU A;  4OTE A;  2XX8 A;  3FVK A;  2XWI A;  4PE3 A;  2YZT A;  3OO8 A;  3TTL A;  4DV0 E;  3PUX E;  4ZYD A;  2QFL A;  1D9Y A;  2QS3 A;  4R8O A;  3FVO A;  3TAJ A;  1EH3 A;  2JVA A;  2D21 A;  4OAN A;  1US5 A;  2PT2 A;  3ZKK A;  1MY0 A;  5A6B D;  3G3H A;  2KLF A;  4N15 A;  1F9B A;  3S9N C;  4PFY A;  1YSA C;  1QJM A;  2I58 A;  3CIJ A;  4JI3 E;  4GF8 A;  3OXN A;  4LVQ A;  2NUE A;  4BHB A;  3C4B A;  2EP3 A;  1B2H A;  2CZI A;  2Y7R A;  4OWD A;  3C4M A;  1PDA A;  3DP8 A;  1G0I A;  2MDG A;  1MQH A;  4MAG A;  2DWH A;  5H8H A;  1NV3 A;  4X65 E;  2YWQ A;  4F3S A;  1CB6 A;  2P3N A;  2DWI A;  1QUK A;  1Y4T A;  2EOI A;  3L6G A;  2O7U A;  1X6H A;  2VQF E;  1BK4 A;  5I59 B;  1G2D C;  3D4G A;  3RTF B;  1UN6 B;  2HZL A;  3J80 C;  3U94 A;  4K0K E;  3MZ1 A;  1NUY A;  3G3F A;  4XKR A;  3W9V A;  5AC5 A;  1Z7N E;  4PTK A;  4JI0 E;  3GYY A;  2HPG A;  2WEF A;  4R75 A;  3VYY A;  2HAV A;  2F5X A;  2EOQ A;  2AL5 A;  3MJN A;  2YTN A;  2RCA A;  3H6T A;  2LT7 A;  4QXD A;  2EOE A;  3TUS A;  2ADR A;  3LSF B;  1MXV A;  2ZMB A;  3I5O A;  4HE1 A;  3RPL A;  4ZZE A;  1NV5 A;  2UYE A;  1FQE A;  3UGW A;  2H36 X;  5CBS A;  1YYK A;  1JQF A;  4G68 C;  2ONS A;  3OTO E;  2L2M A;  5FHN A;  2L92 A;  4O3B A;  4JB7 A;  4BC7 A;  1RYX A;  4PC9 A;  1IBK E;  3SEU A;  4J8Z A;  4MIJ A;  1IMU A;  5AA1 A;  2M9A A;  4IGR A;  1FBH A;  4NX1 A;  3T93 B;  1WXR A;  5J16 A;  1K9Z A;  2UVG A;  5A6K A;  5H8N A;  4F1U A;  2XXH A;  4G8M A;  5TP9 B;  2WBB A;  4KYS A;  4KR5 A;  3HFU A;  4F2J C;  2MC6 A;  2ELY A;  3G3J A;  3RT6 B;  2V83 A;  4P47 A;  1ZMG A;  4PBH A;  1S7Y A;  1B3L A;  4JDF A;  4PET A;  5I56 B;  4M0V A;  5AA4 B;  2F6G A;  1MY3 A;  4R2R A;  3OEK A;  1FTM A;  1PC3 A;  4WKM A;  4HCY A;  2EL5 A;  1BP5 A;  3C33 A;  4GD5 A;  1T0K A;  4NF6 A;  3IJO B;  1FBE A;  4DUZ E;  3I6V A;  3MZB A;  5JTY A;  1R1N A;  1JW5 A;  2P2A A;  3CSG A;  3K6U A;  3QXM A;  5EQ9 A;  3QSL A;  3TTN A;  4NE4 A;  4BMJ A;  3IOV A;  1YUJ A;  1B4Z A;  4BCA A;  1LB9 A;  3IFA A;  2YTQ A;  1NV6 A;  1YAE A;  1MDP 1;  4GIZ A;  3BFT A;  3V83 A;  3OSR A;  5H8Q B;  2LE2 A;  1NH7 A;  4WEP A;  4IO4 A;  4XTC Q;  4U2R A;  3V8X B;  4Q5T A;  4KHZ E;  1Y1Z A;  4EQ9 A;  4JVD A;  2V4C A;  4HXV A;  4XEQ A;  1N36 E;  2EMY A;  4N6K A;  4GWX A;  1I6Q A;  3EPJ A;  2DXY A;  3H09 A;  2V87 A;  2NUG A;  2ZYK A;  4X04 A;  5AA2 D;  5IZ3 B;  4H67 A;  1KA1 A;  5EQ8 A;  4I9D A;  5LTC A;  1VR5 A;  4JWY A;  4N17 A;  4G61 A;  4OVR A;  1GQE A;  1USY E;  1CE2 A;  1VSO A;  3EPK A;  1SI0 A;  3O66 A;  2VRD A;  1USY H;  4DCX A;  3FVN A;  3Q26 A;  1UTH A;  2WYP A;  4PBQ A;  3VHT B;  1X6E A;  4NN3 A;  3KG2 A;  2Y7P A;  1FPB A;  4ZE9 A;  3UIF A;  4N8G A;  4DR3 E;  4Z0I A;  3Q25 A;  1UBD C;  1PBP A;  2MC5 A;  4NXN E;  1X48 A;  2JOX A;  1EZ9 A;  4IY5 A;  1KA0 A;  4R6Y A;  4RPN A;  3JTZ A;  2HHM A;  1S9T A;  1SD3 A;  4C1T A;  1FPD A;  2RKM A;  3SET A;  3SKP A;  2LJU A;  2DWJ A;  4I8C A;  3IB0 A;  1LBB A;  2FV4 B;  3C4T A;  2UXB E;  4U23 A;  1B1X A;  5B7D A;  5KCJ A;  2QVU A;  3T0J A;  4ZS9 A;  1ZBQ A;  1XNR E;  4YIC A;  2KHX A;  4BDN A;  5DVI A;  5KL3 A;  2ZYO A;  4PE5 B;  4GWW A;  4N07 A;  2Y5L A;  3MVZ A;  1FQD A;  3CHG A;  3BGH A;  4R2C A;  2ZXT A;  4LN5 A;  1IMA A;  5L9S A;  4OFL A;  1LAX A;  4G4P A;  4GQO A;  1ZLQ A;  1QNT A;  2RC8 A;  3DF6 A;  3C31 A;  4IO2 A;  1M5D A;  5I57 A;  3IJX B;  4OOG C;  4M9V C;  1YXI A;  5L9O A;  3O6G A;  5AC4 A;  4BC9 A;  5IM2 A;  2L6M A;  1B3E A;  1MH3 A;  2WX9 A;  1SW4 A;  4C1U A;  5DNY A;  3C6M A;  3SEX A;  3TYH A;  3O28 A;  4ESW A;  4AQY E;  3FXR A;  1BBG A;  1LLM C;  1WRJ A;  3PUW E;  2LAO A;  2GH9 A;  4EF2 A;  5EQ7 A;  2G93 A;  4PFB A;  1SBP A;  4MJO A;  5IXM B;  2DMI A;  2G7H A;  1FTJ A;  3PD9 A;  4GWY A;  2R71 A;  3CFL A;  1UQW A;  1FCK A;  4FEB A;  1TFA A;  3PU5 A;  2UVH A;  5DVJ A;  5CM6 A;  2EMG A;  2GHB A;  3VXB A;  4M4G A;  4P56 A;  4LF6 E;  5IWA E;  2OCU A;  3RYD A;  1JK1 A;  4DKK A;  4LF4 E;  2DIX A;  3PUZ E;  2I0C A;  4ND9 A;  3PPP A;  1R6Z A;  5KDT A;  4N6D A;  4XF5 A;  2F97 A;  3SDF A;  4QRZ A;  5KL5 A;  1IMD A;  3B50 A;  1MXZ A;  4LFC E;  5CMK A;  2OWZ A;  3A29 A;  5DVF A;  3TTR A;  2V3U A;  5ITP A;  1FW0 A;  2DE2 A;  5ICT A;  4YKK A;  1FJ6 A;  4U21 A;  2M4I A;  1EZP A;  1URD A;  2JOB A;  4OES A;  3FIR A;  2AL4 A;  4DV2 E;  1A40 A;  1ZR9 A;  2EML A;  3KZY A;  5ISU A;  5AE4 A;  2Q8U A;  2JR1 A;  1X6F A;  2EPZ A;  2Z22 A;  3IX1 A;  4RHB B;  2HFB A;  1BBO A;  2O1L A;  1FBC A;  3RGY A;  3W15 C;  1PJQ A;  3O6H A;  3R6U A;  4QBA A;  2V84 A;  2BBG A;  3UN6 A;  4KYE A;  2ELZ A;  3F6G A;  1F2I G;  2H99 A;  4DR5 E;  1MG1 A;  3KJT A;  1NV7 A;  3OO7 A;  5I58 B;  1NNP A;  4H45 A;  2UXC E;  2XXV A;  4GWS A;  4RJZ A;  4H65 A;  1B7Z A;  1MQI A;  3BIH A;  3GZG A;  1YCJ A;  4YB6 A;  5F3W A;  2EMI A;  1OIB A;  1I94 E;  3KOS A;  5H8F B;  1AMF A;  3MVY A;  4RYA A;  3PV0 E;  3SEY A;  5IT9 C;  1QKA A;  4O43 A;  2UVI A;  5LL6 R;  4TLM B;  2G29 A;  4P9K A;  4IY6 A;  5ICQ A;  3KSX A;  5AE3 A;  2CMO A;  4NQ8 A;  4OEN A;  5TPA B;  4H6D A;  2PFZ A;  3JAM C;  1SW1 A;  1YUI A;  5I59 A;  3U92 A;  4QFO A;  3AXF A;  2UU9 E;  4RK9 A;  4BLA A;  2K7I A;  4R2S A;  3PMX A;  1KJK A;  2XXU A;  5LMU E;  3PUY E;  3CG1 A;  3GXA A;  1O7T A;  1IXI A;  2F78 A;  2HJJ A;  3UK3 C;  3NOH A;  1VDW A;  3E9X A;  3J7Y p;  4BDQ A;  3IO6 A;  1LLS A;  3HV1 A;  2XX7 A;  3M99 B;  3FVG A;  3IOW A;  3TEL A;  5CC2 A;  1LCF A;  2EN3 A;  3HHF A;  1EH6 A;  3L00 A;  2UXA A;  4MH5 A;  3TPA A;  3D1R A;  1MXW A;  5K2Y A;  2EOH A;  4EXK A;  2Z8F A;  1UIL A;  2X7P A;  4GL8 A;  2EMA A;  2Z8D A;  3KZG A;  4UA8 A;  2B3F A;  4POW A;  4PDD A;  1H76 A;  2ZZV A;  3DLN A;  4LU9 A;  3BFU A;  2AIX A;  1SDX A;  3N5L A;  2I4B A;  2JXP A;  2XXI A;  1Q35 A;  4YKP A;  3JU0 A;  2JP9 A;  2BB8 A;  2FNC A;  2ZM6 E;  5HM4 B;  4ESX A;  4I3E A;  5LOM A;  1JNF A;  4LTY A;  2VGQ A;  2R1F A;  4F3G A;  4PAI A;  2VE7 C;  3HPS A;  4DXC A;  3BKI B;  5JK4 A;  1RKM A;  3OML A;  2YJP A;  3A09 A;  3IOR A;  2ONR A;  5T3J A;  2B3T B;  3KC0 A;  3VFJ A;  2CZH A;  4RA1 A;  5ELV A;  2EOY A;  2CPN A;  2DYX A;  2VP1 A;  5I56 A;  4O4K A;  1ZBT A;  4B3T E;  3JZJ A;  4XXU A;  5AA4 A;  2F35 A;  1Y3Q A;  1DCU A;  2YTJ A;  1Y3P A;  2J7J A;  4GFR A;  5IZZ A;  5AAS A;  2NUV A;  4ZDM A;  1I6B A;  4GZN C;  4OET A;  2XXP A;  4X62 E;  1IBM E;  2X26 A;  2DGC A;  3ILU B;  4NWD A;  3UK4 A;  1M5C A;  1B52 A;  2HQ0 A;  3O6I A;  3MSW A;  3RY3 A;  5BUU A;  1A1I A;  2XHD A;  1QUI A;  4DI4 B;  2UUC E;  3KWR A;  4F9B B;  4PFU A;  3O9P A;  1EKZ A;  1P1O A;  3B8B A;  1VFD A;  5CRY A;  4F9A B;  4ISU A;  3H6W A;  3RN8 A;  1R9Q A;  4WPY A;  2YTD A;  2ENH A;  5I84 A;  4JVI A;  4U4S A;  5ESY A;  4PFT A;  3PMV A;  5H8Q A;  3OD7 A;  1Q1K A;  4EDP A;  3BBG A;  1POT A;  3K2D A;  1HR0 E;  1ZJL A;  2H98 A;  1H44 A;  3MPK A;  1N0T A;  2Q74 A;  1IBL E;  3OO9 A;  3KGC A;  2LJH A;  1ELJ A;  4IB2 A;  3G3G A;  1RMD A;  2ZZX A;  3K6Q A;  3MVX A;  2EOR A;  5IZ3 A;  3CFX A;  1DQ3 A;  1P47 A;  3EPL A;  3GBB A;  2EOZ A;  1Y4C A;  3THN A;  1A1F A;  3FV1 A;  5DT6 A;  3VV5 A;  1OVT A;  1IME A;  3P7I A;  2PCR A;  2K4V A;  1B69 A;  4U22 A;  3ADL A;  2QVR A;  4X66 E;  3QAX A;  4OEV A;  3TEP A;  2DSY A;  1MM7 A;  4OVQ A;  2OJT A;  4Q30 B;  3B6W A;  1MQJ A;  2RCB A;  1T39 A;  2YTI A;  1RYO A;  4R2Q A;  3BF2 A;  1DBZ A;  1SVX B;  1B7H A;  2A5S A;  4IO6 A;  5IGA A;  1NUZ A;  2XWK A;  2EPP A;  3CRB A;  3S2V A;  4MMP A;  3SZP A;  2DDK A;  4JVC A;  2CZK A;  4DV3 E;  2D9H A;  3MPL A;  2JJK A;  4MLV A;  5HPQ A;  3THO B;  1FPK A;  1UTB B;  4P0I A;  2N3G A;  1MPD A;  3ZSF A;  1DSN A;  1ZBM A;  2VD3 A;  2VF1 A;  4NMY A;  4M30 A;  1LAF E;  3SEV A;  2MKZ A;  3MW0 A;  2F7B A;  1B40 A;  2YRH A;  1DGC A;  2O68 A;  3SER A;  3T9H B;  2CZL A;  3LBS A;  4LP2 B;  2CTD A;  4N4R B;  2O6A A;  2KQZ A;  1MY4 A;  4PCD A;  2DE3 A;  3OEM A;  4EQ7 A;  2EPK X;  1NNK A;  2B4L A;  1MXX A;  2F7C A;  4OQO A;  4GOT A;  4HW8 A;  1TN9 A;  5ET6 A;  1GR2 A;  2OK2 A;  4QF9 A;  4F1Y A;  3ODB A;  4YU0 A;  3QYT A;  1LB8 A;  3O2A A;  1WOD A;  1YFH A;  2YTP A;  1ZU0 A;  2I3V A;  3PPO A;  2XD2 A;  4OHN A;  1HNZ E;  2V89 A;  3KBR A;  1JP4 A;  5EYF A;  2ZNU A;  4FJP A;  4M2Z A;  4POX A;  2VQE E;  4ELQ A;  2DLK A;  4P3L A;  4BHC A;  2M1S A;  4NF8 B;  4P78 A;  3P1X A;  3RTW B;  3T1Y E;  4Z7E A;  3RT8 A;  3CG3 A;  3FV2 A;  2P0S A;  4WSP A;  1GGG A;  1ZAA C;  2PYY A;  3ZKL A;  4OYV A;  1MS7 A;  1XS5 A;  4TQU Q;  2XWO A;  3IL1 B;  3K1P A;  1H3D A;  1IXH A;  3HN0 A;  1FJ9 A;  1XNQ E;  2N3H A;  4LF7 E;  1TT1 A;  4JI6 E;  2DMY A;  2NA2 A;  4B3S E;  5LMN E;  1B5J A;  4H0W A;  1T4L B;  1J26 A;  2UVJ A;  4GEQ B;  1BKA A;  2DB2 A;  3U72 A;  4XKP A;  4H1X A;  4O8M A;  1XOC A;  4HEI A;  4HTG A;  3N26 A;  2EM6 A;  2XX9 A;  3RQT A;  2DE4 A;  1A1H A;  3E79 A;  3FJG A;  2VPN A;  4NF0 A; 
#chains in the Genus database with same CATH homology
 3F11 A;  2OWT A;  2QSX A;  3TQL A;  4F2Q A;  1Y3N A;  2I3W A;  5EHS A;  3EN3 A;  3N6T A;  3T9U A;  5I2N B;  1NKX A;  1JEU A;  1IIW A;  1GTK A;  4R6H A;  4G8N A;  2DXR A;  2F8D A;  2B3B A;  2REJ A;  4LON B;  4JSO A;  1NNF A;  1AL3 A;  3LSW A;  1EZO A;  1B0H A;  2PBW A;  2Y7K A;  3VVF A;  4IO5 A;  3CVG A;  3H7M A;  4LZ5 A;  4ECF A;  5I58 A;  4M1V A;  1UIV A;  3DM0 A;  3TFL A;  3S9E A;  1IUD A;  3U93 A;  2QJE A;  3WAE A;  5H8F A;  3FJ7 A;  2Z8E A;  1MM6 A;  4NWC A;  1DPE A;  1Y1M A;  2YLN A;  3FAT A;  4U1Z A;  4H8J A;  5TPA A;  1DTZ A;  2I0B A;  1PB7 A;  2RC7 A;  4RY1 A;  4G77 A;  5FTH A;  3FXQ A;  4QFN A;  3BBR A;  3GLB A;  1Y9U A;  4X1B A;  4IO3 A;  1POY 1;  4KCD A;  3HPI A;  3UOR A;  2DOJ A;  4YKI A;  3TCF A;  4FAT A;  4ELP A;  2QL3 A;  1N7X A;  4RPO A;  1P1Q A;  5A5X B;  5IAI A;  3K1M A;  2VHA A;  1MH4 A;  2V3Q A;  3SES A;  4Q0C A;  3TOD A;  4RXL A;  5CMB A;  1II5 A;  3IOU A;  3K0V A;  4ELR A;  2NWJ A;  3TTM A;  1LFI A;  2V93 A;  1P99 A;  4P0G A;  3FD3 A;  4F19 A;  3TCG A;  1LFG A;  3MUQ A;  2GRV A;  2QS4 A;  4DZ1 A;  1LGB C;  3C36 A;  3T22 A;  3IAZ A;  1D4N A;  4RNS A;  3TTK A;  4XKQ A;  5BWJ A;  2ALU A;  2XXQ A;  3OMB A;  1B3F A;  2Y7I A;  2OLB A;  1N04 A;  1QUL A;  4GLI A;  1ATG A;  1N3W A;  3VVE A;  5J1D A;  4JBZ A;  5ITO A;  3JYR A;  5I2K B;  1LFH A;  4DXB A;  2DVC A;  4RK2 A;  4G68 B;  4THI A;  1B5H A;  3T9X B;  4ZEB A;  3A3C A;  3K00 A;  2GFE A;  4C0R A;  4Q8R A;  3MP8 A;  2OZZ A;  1M5B A;  3E13 X;  3B6T A;  3LR1 A;  4F39 A;  4OFO A;  4QSD A;  3MP6 A;  4YAH X;  1SQY A;  1LAG E;  3DEL B;  4QFK A;  5TU0 A;  1D3K A;  2I4C A;  4ZE8 A;  2D5W A;  4F3P A;  4XIG Q;  3B7D A;  2ESN A;  4PQJ A;  1XHY A;  1FTL A;  5FHO A;  2XXT A;  1B5I A;  3HO7 A;  1P1U A;  3MWB A;  4KYD A;  4HCW A;  4JXI A;  1UTB A;  1B4H A;  4MFI A;  4F18 A;  1HSE A;  1AOV A;  2DSF A;  1URS A;  1B32 A;  4DCY A;  3G3I A;  1ZIU A;  1M5F A;  4GWO A;  2QMX A;  4ZED A;  3H6U A;  3T66 A;  4F31 B;  3ILT B;  2M8C A;  2DWA A;  3EHU A;  2PVU A;  1JVY A;  1NMU A;  4DE8 A;  4MLQ A;  3I3V A;  2XXR A;  1ZTY A;  4OMB A;  4LZ8 A;  1MRP A;  3M3L A;  4LZ7 A;  3PUV E;  1YPN A;  5KZT A;  1Z7M E;  3LSX A;  3FZV A;  5L8D A;  1QW0 A;  2ZYN A;  1IXG A;  4LQ2 A;  3M8U A;  1B58 A;  1LBC A;  2IEE A;  3L6H A;  3E3K A;  1A54 A;  1A8E A;  4NF8 A;  2NVU B;  2Q9T A;  4DDD A;  1QVS A;  3Q28 A;  2HZK A;  3K01 A;  4KPT A;  2VOZ A;  2Q88 A;  5F1Q A;  1FQB A;  1TFD A;  1OQG A;  3LC8 A;  3USD A;  2H9B A;  3FAS A;  1OMP A;  1MY1 A;  1MXU A;  1MXY A;  2QS2 A;  3KFM A;  3KN3 A;  4N13 A;  3B6Q A;  1OLA A;  1FQC A;  1P1W A;  5FHM A;  1A99 A;  1XVY A;  1MQD A;  1IZ1 A;  5AA2 B;  2Q89 A;  2I6E A;  4LQ5 A;  5L9M A;  1Y20 A;  3SEW A;  3T96 B;  2DQV A;  1P1N A;  4KD5 A;  1B0L A;  2O7I A;  5H8S A;  3LUY A;  3V5A A;  5I2N A;  5AA3 A;  1L5T A;  2F7A A;  4R72 A;  5IKB A;  1EU8 A;  2V3T A;  4EQB A;  1IXC A;  3MP1 A;  4X48 A;  4IO7 A;  1NNT A;  3FXU A;  1PB8 A;  4IGT A;  1M5E A;  3TZA A;  4EF1 A;  2B65 A;  3S9M C;  4NF4 B;  3VE1 B;  2I48 A;  1FTO A;  2GHA A;  3VLV A;  2W7Y A;  4BDO A;  4QSE A;  3ZS6 A;  1N84 A;  2DVZ A;  4BDM A;  3M3F A;  2XXX A;  4EUO A;  2FA7 A;  2HEU A;  1B1H A;  2REG A;  3EQ1 A;  1S50 A;  4G8H A;  4QFP A;  1SW5 A;  4NF5 B;  4F3B A;  4GXA A;  2FYI A;  3H3G A;  4R73 A;  4R9F A;  2Q8J A;  3FUZ A;  3VDF A;  2QS1 A;  4DXU A;  3DP6 A;  4K3F A;  2VD2 A;  1XT8 A;  4YMB A;  1DMB A;  2RIN A;  3MBP A;  2HAU A;  3RLF E;  1B51 A;  4R9G A;  1ZKB A;  2E0S A;  2ZNS A;  3UA8 A;  4ELO A;  4JWO A;  4YKJ A;  3RNN A;  4F1V A;  4QFL A;  3PPQ A;  2RC9 A;  2Q2C A;  3LSL A;  4TOZ A;  4R6K A;  3OOA A;  2O69 A;  1LAH E;  4FED A;  5DEX B;  2RF1 A;  4FEC A;  3FJM A;  5A5X A;  3KJ7 A;  1GV8 A;  2ONK E;  1DTG A;  4GL0 A;  3N94 A;  1PB9 A;  2R6G E;  5M2V A;  1SYH A;  1MY2 A;  1AH5 A;  4PFW A;  1GVC A;  4JSD A;  4GRK A;  3K6V A;  4F22 A;  5CI5 A;  1LST A;  4MBP A;  2IA4 A;  1MQG A;  4EXL A;  4X1D A;  4I1D A;  2NOO A;  3EHT A;  3ONM A;  2BJJ X;  4AB5 A;  2F34 A;  3C9H A;  4NTL A;  2QMW A;  3MZ9 A;  4BDR A;  1A8F A;  2A5T B;  2R9J A;  2ANJ A;  3IB1 A;  3TQW A;  3RUM A;  1FQA A;  1JW1 A;  1NH8 A;  1FTK A;  4WXJ A;  3U1O A;  3CSB A;  4YB7 A;  2XXY A;  4P11 A;  5I2K A;  2D3I A;  4YMA A;  1KWH A;  1N76 A;  1JET A;  1H43 A;  4G68 A;  3V89 B;  2Y7W A;  2ABH A;  2DP8 A;  3HST A;  1BLF A;  1TXF A;  1N3X A;  3C32 A;  4ZEF A;  4MF3 A;  4FOR A;  4LUB A;  4X9T A;  4ZZA A;  4F29 A;  4AQ4 A;  3Q27 A;  4R74 A;  4DIG A;  4LA9 A;  1QKB A;  1JEV A;  4KI0 E;  1J1N A;  4ONY A;  2XD3 A;  3Q29 A;  5H8H B;  3G3K A;  1SYI A;  2X7Q A;  3R7X A;  3CFZ A;  4QSC A;  3DP4 A;  4KQP A;  5HBC A;  1JVX A;  4GVO A;  2Y84 A;  5F7V A;  3JV9 A;  1TWY A;  3H4Z A;  2AYS A;  1H45 A;  1OQH A;  3QIM A;  3E4R A;  2I49 A;  1OLC A;  4OVJ A;  3OO6 A;  4G2Z A;  3MVW A;  1HSL A;  2HXW A;  1NFT A;  3TDJ A;  5K2X A;  3IO4 A;  4KCC A;  2HCA A;  4ZEK A;  3KSJ A;  2E1S A;  4OEU A;  4JWX A;  3HHG A;  5H8N B;  3O97 A;  2YPN A;  3EPE A;  1HSJ A;  3PGF A;  2OBG A;  1WVJ A;  2QRY A;  4PP0 A;  1URG A;  1BIY A;  3IOT A;  1IEJ A;  4U4X A;  5CMC A;  4QHQ A;  4ZEI A;  2O51 A;  2ZYM A;  1IQ7 A;  4NF6 B;  3VVD A;  1B7U A;  2OWS A;  5JTY B;  5CBR A;  3K4U A;  3EF7 A;  1US4 A;  4E0W A;  3R26 A;  3O29 A;  1MDQ A;  3C34 A;  1O64 A;  3TCH A;  4FIM A;  1WDN A;  3TMG A;  5AA2 A;  3W9W A;  1B9J A;  2DS9 A;  3A3U A;  2NXO A;  3PPR A;  1VE4 A;  1IIT A;  3U8Q A;  4L17 A;  2THI A;  1D9V A;  4GXS B;  1UIU A;  3KN7 A;  4LAT A;  3S4U A;  1I69 A;  5CMM A;  2H25 A;  2UYF A;  5DYH A;  2Q2A A;  4ZEC A;  5JEI A;  4H5F A;  3K6X A;  3K6W A;  1BTJ A;  2O1M A;  4DLD A;  3G7W A;  1O63 A;  2O84 X;  4NF4 A;  3KN8 A;  4YB5 A;  1UTH B;  3C35 A;  3H6V A;  1A55 A;  3MAM A;  1VFE A;  4NED A;  3OEL A;  5DTB A;  3IK6 B;  3CR9 A;  3K1N A;  1B6H A;  1A7L A;  1YTV A;  1ANF A;  3PMW A;  2Z23 A;  2H5Y A;  4HS7 A;  4WED A;  3T9V A;  3TKD A;  4H8I A;  4NF5 A;  1B3G A;  4F2O A;  1JW4 A;  4AB6 A;  4FE8 A;  3PPN A;  1DOT A;  3K02 A;  1LCT A;  4UAC A;  3IB2 A;  3QUJ A;  5B70 A;  4OXV A;  5KCJ B;  1B46 A;  1XC1 A;  3M3K A;  5EHM A;  2QPQ A;  3UP9 A;  2PT1 A;  4OFJ A;  1MPB A;  2F6P A;  4E0X A;  5FTI A;  3QK6 A;  4YZZ A;  2PX1 A;  3MC2 A;  1SW2 A;  3KEI A;  3KOT A;  4XKN A;  1QUJ A;  3MQ9 A;  3FGS A;  4H5G A;  3VXC A;  3OEN A;  4BDL A;  5I57 B;  1R9L A;  4I62 A;  3N6U A;  1B05 A;  2P1S A;  4U1O A;  2V25 A;  3VLU A;  4FAJ A;  1DPP A;  4O3A A;  3RPW A;  3PD8 A;  3VLW A;  3CI8 A;  3GBA A;  5DEX A;  3OSQ A;  4R2B A;  3EHS A;  1PEB A;  1PBQ A;  4N6P A;  4OER A;  2ZNT A;  5TP9 A;  2F36 A;  3H03 A;  2WKY A;  4R2F A;  1FQF A;  3ECR A;  1I6A A;  1B3H A;  1AIV A;  1NL5 A;  3THI A;  2PMS A;  2XXW A;  4OZ9 A;  4KFQ A;  5KDT B;  1MPC A;  4O3C A;  3D4C A;  3WAF A;  3S9L C;  3H06 B;  1SI1 A;  1N7W A;  3QUF A;  1OVB A;  3HCQ A;  3IR1 A;  2H4I A;  4TLL B;  2A5T A;  1XVX A;  4OTE A;  2XX8 A;  3FVK A;  3OO8 A;  3TTL A;  3PUX E;  1D9Y A;  2QS3 A;  3FVO A;  3TAJ A;  1EH3 A;  2D21 A;  1US5 A;  2PT2 A;  3ZKK A;  1MY0 A;  3G3H A;  2KLF A;  1F9B A;  3S9N C;  4PFY A;  1QJM A;  2I58 A;  3CIJ A;  4GF8 A;  3OXN A;  4LVQ A;  1B2H A;  2Y7R A;  4OWD A;  3C4M A;  1PDA A;  3DP8 A;  1MQH A;  2DWH A;  5H8H A;  4F3S A;  1CB6 A;  2DWI A;  1QUK A;  1Y4T A;  3L6G A;  2O7U A;  5I59 B;  3D4G A;  3RTF B;  2HZL A;  3U94 A;  3MZ1 A;  3G3F A;  4XKR A;  3W9V A;  1Z7N E;  4R75 A;  2HAV A;  2F5X A;  2AL5 A;  3MJN A;  2RCA A;  3H6T A;  3TUS A;  3LSF B;  1MXV A;  2ZMB A;  3I5O A;  4ZZE A;  2UYE A;  1FQE A;  3UGW A;  5CBS A;  1JQF A;  4G68 C;  2ONS A;  5FHN A;  4O3B A;  4JB7 A;  1RYX A;  3SEU A;  5AA1 A;  4IGR A;  3T93 B;  2UVG A;  5H8N A;  4F1U A;  2XXH A;  4G8M A;  5TP9 B;  4KYS A;  4KR5 A;  3G3J A;  3RT6 B;  1ZMG A;  1S7Y A;  1B3L A;  4JDF A;  4PET A;  5I56 B;  5AA4 B;  2F6G A;  1MY3 A;  3OEK A;  1FTM A;  1PC3 A;  4WKM A;  4HCY A;  1BP5 A;  3C33 A;  4GD5 A;  1T0K A;  4NF6 A;  3IJO B;  3I6V A;  3MZB A;  5JTY A;  1R1N A;  1JW5 A;  2P2A A;  3CSG A;  3K6U A;  3QXM A;  3QSL A;  3TTN A;  4NE4 A;  3IOV A;  1B4Z A;  1LB9 A;  1YAE A;  1MDP 1;  4GIZ A;  3BFT A;  3V83 A;  3OSR A;  5H8Q B;  1NH7 A;  4WEP A;  4IO4 A;  4XTC Q;  4U2R A;  3V8X B;  4Q5T A;  4KHZ E;  1Y1Z A;  4EQ9 A;  1I6Q A;  2DXY A;  2ZYK A;  5AA2 D;  4H67 A;  4I9D A;  1VR5 A;  4JWY A;  1USY E;  1CE2 A;  1VSO A;  1SI0 A;  3O66 A;  1USY H;  4DCX A;  3FVN A;  3Q26 A;  1UTH A;  3KG2 A;  2Y7P A;  4ZE9 A;  3UIF A;  4Z0I A;  3Q25 A;  1PBP A;  1EZ9 A;  4IY5 A;  4RPN A;  4R6Y A;  1S9T A;  1SD3 A;  4C1T A;  2RKM A;  3SET A;  3SKP A;  2DWJ A;  4I8C A;  3IB0 A;  1LBB A;  4U23 A;  5KCJ A;  1B1X A;  5B7D A;  4ZS9 A;  4YIC A;  4BDN A;  5DVI A;  2ZYO A;  4PE5 B;  4N07 A;  3MVZ A;  1FQD A;  2ZXT A;  5L9S A;  4OFL A;  1LAX A;  4G4P A;  4GQO A;  1ZLQ A;  2RC8 A;  3C31 A;  4IO2 A;  1M5D A;  5I57 A;  3IJX B;  5L9O A;  3O6G A;  1B3E A;  1MH3 A;  1SW4 A;  4C1U A;  3TYH A;  3SEX A;  3O28 A;  4ESW A;  3FXR A;  3PUW E;  2LAO A;  2GH9 A;  4EF2 A;  2G93 A;  1SBP A;  3PD9 A;  1FTJ A;  2R71 A;  3CFL A;  1UQW A;  1FCK A;  4FEB A;  1TFA A;  3PU5 A;  2UVH A;  5DVJ A;  5CM6 A;  2GHB A;  3VXB A;  4M4G A;  2OCU A;  3PUZ E;  2I0C A;  4ND9 A;  3PPP A;  1R6Z A;  5KDT A;  2F97 A;  3SDF A;  4QRZ A;  1MXZ A;  5CMK A;  5DVF A;  3TTR A;  2V3U A;  5ITP A;  1FW0 A;  2DE2 A;  5ICT A;  4YKK A;  4U21 A;  1EZP A;  1URD A;  4OES A;  3FIR A;  2AL4 A;  1A40 A;  5ISU A;  5AE4 A;  2Z22 A;  3IX1 A;  2HFB A;  2O1L A;  3RGY A;  3W15 C;  3O6H A;  3R6U A;  2V84 A;  3UN6 A;  4KYE A;  2H99 A;  1MG1 A;  3KJT A;  3OO7 A;  5I58 B;  1NNP A;  4RJZ A;  2XXV A;  4H65 A;  1B7Z A;  1MQI A;  3GZG A;  1YCJ A;  4YB6 A;  1OIB A;  3KOS A;  5H8F B;  1AMF A;  3MVY A;  4RYA A;  3PV0 E;  3SEY A;  1QKA A;  2UVI A;  4TLM B;  2G29 A;  4IY6 A;  5ICQ A;  3KSX A;  2CMO A;  4OEN A;  5TPA B;  4H6D A;  1SW1 A;  5I59 A;  3U92 A;  4QFO A;  3AXF A;  4RK9 A;  4BLA A;  3PMX A;  2XXU A;  3PUY E;  3CG1 A;  3GXA A;  1O7T A;  1IXI A;  2F78 A;  3E9X A;  4BDQ A;  3IO6 A;  1LLS A;  3HV1 A;  2XX7 A;  3FVG A;  3IOW A;  3TEL A;  5CC2 A;  1LCF A;  3HHF A;  4MH5 A;  3TPA A;  2UXA A;  1MXW A;  5K2Y A;  4EXK A;  2Z8F A;  2X7P A;  4GL8 A;  2Z8D A;  3KZG A;  4UA8 A;  2B3F A;  4POW A;  1H76 A;  3DLN A;  3BFU A;  2AIX A;  1SDX A;  3N5L A;  2I4B A;  2XXI A;  4YKP A;  1Q35 A;  2FNC A;  5HM4 B;  4ESX A;  5LOM A;  1JNF A;  2VGQ A;  4F3G A;  4DXC A;  3BKI B;  5JK4 A;  1RKM A;  2YJP A;  3A09 A;  3IOR A;  2ONR A;  3VFJ A;  4RA1 A;  5ELV A;  2DYX A;  2VP1 A;  5I56 A;  3JZJ A;  4XXU A;  5AA4 A;  2F35 A;  1Y3Q A;  1Y3P A;  4GFR A;  2NUV A;  4ZDM A;  1I6B A;  4OET A;  2XXP A;  2X26 A;  3ILU B;  4NWD A;  3UK4 A;  1M5C A;  1B52 A;  2HQ0 A;  3O6I A;  3RY3 A;  5BUU A;  2XHD A;  1QUI A;  4PFU A;  3O9P A;  1P1O A;  5CRY A;  1VFD A;  4ISU A;  3H6W A;  3RN8 A;  1R9Q A;  5I84 A;  4U4S A;  4PFT A;  3PMV A;  5H8Q A;  3OD7 A;  1Q1K A;  4EDP A;  1POT A;  3K2D A;  1ZJL A;  2H98 A;  1H44 A;  3MPK A;  1N0T A;  3OO9 A;  3KGC A;  1ELJ A;  4IB2 A;  3G3G A;  3MVX A;  3CFX A;  3GBB A;  1Y4C A;  3FV1 A;  5DT6 A;  3VV5 A;  1OVT A;  3P7I A;  4U22 A;  3QAX A;  4OEV A;  3TEP A;  1MM7 A;  4Q30 B;  2OJT A;  3B6W A;  1MQJ A;  2RCB A;  1RYO A;  1SVX B;  1B7H A;  2A5S A;  4IO6 A;  3S2V A;  3CRB A;  3MPL A;  4MLV A;  5HPQ A;  1UTB B;  4P0I A;  1MPD A;  3ZSF A;  1DSN A;  1ZBM A;  2VD3 A;  4NMY A;  1LAF E;  3SEV A;  3MW0 A;  2F7B A;  1B40 A;  3T9H B;  2O68 A;  3SER A;  2CZL A;  3LBS A;  4LP2 B;  2O6A A;  1MY4 A;  2DE3 A;  3OEM A;  4EQ7 A;  1NNK A;  1MXX A;  2F7C A;  4OQO A;  4GOT A;  4HW8 A;  1GR2 A;  2OK2 A;  4QF9 A;  4F1Y A;  3ODB A;  4YU0 A;  3QYT A;  1LB8 A;  3O2A A;  1WOD A;  1ZU0 A;  2I3V A;  3PPO A;  2XD2 A;  4OHN A;  3KBR A;  5EYF A;  2ZNU A;  4FJP A;  4POX A;  4ELQ A;  4NF8 B;  3RTW B;  4Z7E A;  3RT8 A;  3CG3 A;  3FV2 A;  2P0S A;  1GGG A;  2PYY A;  3ZKL A;  4OYV A;  1MS7 A;  1XS5 A;  4TQU Q;  3IL1 B;  3K1P A;  1H3D A;  1IXH A;  3HN0 A;  1TT1 A;  1B5J A;  4H0W A;  2UVJ A;  1BKA A;  3U72 A;  4XKP A;  4H1X A;  1XOC A;  4HTG A;  3N26 A;  2XX9 A;  3RQT A;  2DE4 A;  3FJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...