3EQ1A

The crystal structure of human porphobilinogen deaminase at 2.8a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
338
structure length
312
Chain Sequence
b'RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPQHEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structure of human porphobilinogen deaminase at 2.8 A: the molecular basis of acute intermittent porphyria
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 312
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3eq1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A02
2DWJA 4YKKA 2F8DA 2NWJA 3VFJA 4ZEDA 1D9VA 2O84X 2Q9TA 3LBSA 1SD3A 2PMSA 4FE8A 2ANJA 3ILUB 2XXVA 1MQDA 3E4RA 3VDFA 4NTLA 5TP9B 2I4BA 1N3WA 3KG2A 1A54A 3FXRA 1BKAA 3O2AA 3TCFA 3VVDA 2RCAA 4U2RA 4OEUA 3TELA 1B4ZA 1D4NA 4GL8A 3LSFB 4EF2A 1OIBA 2ZMBA 4GOTA 1UQWA 3I3VA 3PUZE 2LAOA 4RJZA 4NF5B 1ZLQA 3KFMA 1DSNA 1XT8A 4FEBA 3C34A 3IB0A 2V93A 1B3LA 1PB7A 4LVQA 4ONYA 1A55A 3OEKA 4F1UA 1DTZA 2R71A 1MDQA 1JQFA 5CMMA 4OENA 3RT8A 2XD2A 3G3GA 1O7TA 1B1XA 2ONRA 5AE4A 3Q27A 1SBPA 3VXCA 3OO9A 1GR2A 3KN3A 3DP8A 2HAVA 4H65A 5FHOA 1MM7A 5DT6A 1JETA 3FD3A 4TOZA 1B0HA 1EU8A 1N3XA 4F1VA 3IB2A 2GHAA 4OESA 4F3GA 4LONB 1Q1KA 1L5TA 4I8CA 1GV8A 1I6QA 4GLIA 3TQLA 3PGFA 3U93A 3D4GA 4H6DA 1URDA 2FA7A 1ANFA 1CB6A 1LB8A 1FTJA 3PD9A 1BIYA 3T9XB 3IJOB 1MXVA 3BKIB 4PFUA 5B7DA 4R73A 2X7PA 3IORA 3QXMA 3SEXA 2PBWA 1B40A 4DXUA 1QULA 1I6AA 2IA4A 1Y1MA 3TUSA 3FUZA 1OMPA 3OELA 4MLQA 4N6PA 3V89B 3LSLA 1MH4A 2OWTA 4GD5A 4XKPA 5H8QA 1BP5A 2QRYA 3OENA 3OSRA 4O3CA 3IR1A 4F2OA 2UVGA 3UGWA 3UORA 2DXRA 2PT2A 1SDXA 2HXWA 4YAHX 3G3HA 2B3BA 3T66A 1A8EA 4ZDMA 2O7UA 2I49A 1B0LA 5I2NA 2DVZA 4DDDA 1OVBA 1ZU0A 3KJ7A 5HBCA 4LQ2A 1B52A 4KCCA 2RKMA 4K3FA 3MZBA 2REGA 4X1DA 1WDNA 1NNFA 1PB8A 3WAEA 1FQAA 3G3JA 3FJ7A 2QL3A 3ZSFA 5TPAA 1IITA 1LFGA 4PFWA 2OBGA 1D9YA 5DEXA 1OVTA 3E3KA 4UACA 3TAJA 1OQHA 4POWA 3R26A 3UP9A 3JZJA 4DCXA 4R6YA 3KOSA 4NF8A 4IB2A 1EH3A 3V83A 1A40A 5H8NB 3O66A 4NEDA 1FQDA 4AQ4A 4IY5A 5JK4A 1QW0A 1MH3A 2H9BA 1M5CA 3Q26A 4YICA 5I58A 3MWBA 1B7HA 1B2HA 4F31B 3SEYA 3UA8A 3O6IA 3SESA 2P2AA 4OMBA 1B3FA 3FV2A 3OO8A 2UXAA 2XXUA 3B6WA 2B3FA 1VFDA 4KR5A 3VVFA 2Q89A 2XX8A 4EUOA 5JTYB 4ZEFA 2XXRA 4GXSB 2QMXA 3MVXA 3H4ZA 2P0SA 4YZZA 3M3FA 2QPQA 2YJPA 4EDPA 1H43A 4R9GA 2DQVA 1DMBA 3H7MA 5CMBA 3KSJA 4JSOA 4N07A 4GL0A 4H8IA 2Z8EA 3K1NA 2PYYA 1FTOA 3C33A 3E9XA 2UYEA 3LSWA 3O29A 4MBPA 2VP1A 1POY1 4YKIA 3TTKA 4G8MA 1P99A 3G7WA 2RC9A 3R7XA 2AL4A 2Q2CA 2GHBA 1BLFA 3H03A 4GRKA 4F19A 3MPLA 4LZ7A 4Q5TA 1AIVA 4OVJA 2UYFA 3IOTA 3H6UA 4R75A 5EHSA 3H6VA 1URGA 3VLUA 1HSEA 5L9OA 5CBRA 4GQOA 5DYHA 2NUVA 1DTGA 4FAJA 3KZGA 2FYIA 3LR1A 1OLCA 3IAZA 3B6TA 2Y7WA 4LUBA 4XKNA 4RY1A 4EQBA 1FQFA 2H25A 5CI5A 4NF6A 2ALUA 1PEBA 1EZPA 1LBBA 4I1DA 4ZEKA 1USYE 2I58A 4C1TA 2ABHA 1UIVA 5I59B 2ZNUA 2NXOA 2OLBA 1MM6A 3HHFA 3S9EA 1MY4A 3FXUA 3OO7A 4YB6A 4BDMA 5FHMA 3HHGA 3N6UA 4R74A 2VOZA 3FVGA 4MH5A 4RA1A 2DE3A 1GTKA 5F1QA 4ZS9A 4ELRA 2A5TA 1YPNA 1GVCA 1MQJA 3VLWA 2Z23A 4F2QA 3MZ9A 1B3EA 5H8QB 1QUKA 4DCYA 1SI0A 1WODA 3RQTA 1NL5A 1FTKA 4IY6A 4U4XA 4HTGA 4F18A 3IJXB 2CMOA 3RY3A 1LAHE 2XX7A 3M3LA 2O51A 1XHYA 3H6WA 1USYH 5I57A 4JB7A 4AB6A 3PPRA 3DP6A 4M1VA 5LOMA 1YAEA 3B6QA 3Q25A 1MY3A 3S2VA 1ELJA 2F78A 3W9VA 3QSLA 5KDTB 1SVXB 3N26A 3EF7A 1EZ9A 3ILTB 4G68A 1URSA 2OZZA 3IX1A 4M4GA 1LB9A 2Y7KA 3FASA 4HCYA 4DZ1A 3TTRA 1Y3QA 2QJEA 5TPAB 4FIMA 3TYHA 2F97A 5DEXB 3ODBA 3C32A 4MF3A 4TLLB 4NF8B 1Y1ZA 1LFIA 2V3QA 1SW5A 4OFLA 1AOVA 1B7ZA 4FEDA 2ZYOA 4ELOA 4QSEA 5IKBA 2OCUA 3MPKA 4PFTA 2HZKA 4WEDA 4OTEA 1XOCA 2O7IA 4R2FA 3U94A 2DWAA 1H44A 3G3KA 2OK2A 5KZTA 3A3CA 2F7CA 4U1OA 4ND9A 2HQ0A 4IO6A 1QVSA 4YB5A 5H8HA 3SEVA 1RYXA 1ZMGA 4GVOA 4JWOA 3VV5A 2W7YA 2XXYA 1MXUA 2H5YA 1XVXA 2PVUA 3CG3A 3MUQA 1Q35A 2RC8A 4DIGA 3CSBA 3RUMA 4X9TA 3T9UA 3K4UA 4G8NA 1ATGA 3V8XB 2IEEA 3CR9A 3LUYA 2H99A 1SQYA 1TXFA 5M2VA 2E0SA 3T9VA 3OOAA 2DS9A 3SERA 2XD3A 4I62A 3GXAA 3BBRA 2V84A 3HSTA 5TU0A 2ONSA 4YMAA 2F5XA 4O3BA 2F36A 4AB5A 1NMUA 3TDJA 5JEIA 1JW1A 2RINA 4HW8A 1ZTYA 1P1OA 2HZLA 4E0WA 3K01A 2D21A 5BWJA 5B70A 1P1QA 1P1UA 5AA1A 4NF6B 2F7BA 3EHSA 3GLBA 1KWHA 2YLNA 2QS2A 5ITOA 1US4A 5AA2B 3FZVA 1MY0A 3MVZA 3ZKLA 2XX9A 5I2KA 3IOWA 3O9PA 4P0GA 1SI1A 3RT6B 5A5XA 1OLAA 2X7QA 1PBQA 3N6TA 1B5IA 1B32A 1ZBMA 1XC1A 2Z8DA 3MVYA 1B5JA 1F9BA 3MQ9A 4F1YA 3A3UA 4LA9A 2AYSA 3IOVA 5CRYA 4WEPA 2XXIA 3K6VA 4QSCA 1M5BA 3H6TA 5AA4B 3PPQA 4PP0A 2GFEA 4GWOA 1NNPA 1JW4A 2R6GE 4G4PA 3VLVA 1O63A 1LCTA 3FXQA 1M5DA 4IO3A 3N94A 2XXQA 3RN8A 3PV0E 3U8QA 1MY1A 2I6EA 5I57B 4NF4A 3FVKA 1N7XA 2ZYMA 3S9MC 4XKQA 1XVYA 3QK6A 1P1WA 4OETA 4JWYA 4H0WA 2DOJA 5KCJA 4KYDA 5I56A 2O6AA 3OMBA 1JVXA 1LAGE 2BJJX 5EHMA 1PBPA 4MLVA 3K6WA 1UTHA 3QYTA 4OQOA 4P0IA 4QRZA 1A8FA 1N0TA 2I3WA 3B7DA 1YCJA 3MP6A 3FJGA 4GF8A 4LZ5A 1N7WA 3OD7A 2F6GA 4KD5A 2GRVA 4U1ZA 3IK6B 4I9DA 3IOUA 3K2DA 4R9FA 5TP9A 2F35A 5H8SA 5L8DA 4PE5B 5HPQA 3CRBA 4F3BA 3LSXA 1JW5A 1B3HA 2QS4A 2O1LA 3IB1A 3MBPA 2QS1A 3CSGA 4GXAA 1S9TA 4WXJA 2OJTA 4XKRA 4IGTA 3TCGA 1MXXA 4DXBA 3M8UA 3SEWA 4EQ7A 4NF5A 4F39A 1SYHA 4IO2A 2YPNA 4OZ9A 3L6GA 3PMXA 4KCDA 2Q8JA 4ESXA 4EXLA 1FQEA 1S7YA 2O68A 4EXKA 1ZJLA 4X1BA 3EHTA 2V3TA 3PMWA 3E13X 3KGCA 3U72A 1Y9UA 2DXYA 3K1MA 1SW1A 4P11A 2V3UA 4U4SA 4RXLA 1MQIA 4YB7A 4EQ9A 1I6BA 4IO4A 4HCWA 4F22A 3RGYA 5ISUA 3C36A 4LATA 3FIRA 1PC3A 1B9JA 4BDNA 1LCFA 1XS5A 1IIWA 1B51A 3GZGA 3C4MA 3ZS6A 1B6HA 3PUXE 1Y20A 2B65A 3USDA 4IO7A 1QKAA 1LAFE 5ICTA 1QUIA 4O3AA 4NWDA 2VD3A 3MW0A 4Z0IA 1DPPA 1MXWA 1D3KA 3SKPA 4LZ8A 3G3FA 3PPPA 5HM4B 1IQ7A 1IXHA 1IUDA 4F29A 2DYXA 2DE4A 4R6HA 1AMFA 4PFYA 2Q2AA 4MFIA 3OEMA 3IL1B 2DWIA 4G68C 4QF9A 3SDFA 4RK9A 2VD2A 1VE4A 3GBAA 1A7LA 1JEUA 5FHNA 1B1HA 1H45A 3PUWE 3C31A 3HV1A 5I2NB 1M5FA 3HPIA 3Q29A 5AA2D 2H98A 3DLNA 4R2BA 4BDRA 3CVGA 1RKMA 4BDQA 4EF1A 3K6XA 1JEVA 1SW2A 3WAFA 3C35A 2O1MA 2Y84A 4QFLA 3MVWA 3I6VA 4POXA 5I84A 3W15C 4DE8A 3PPNA 4ELPA 5FTIA 1FQBA 1NNKA 2DE2A 3D4CA 1FCKA 3VE1B 3TMGA 3RNNA 2O69A 5FTHA 1N84A 1SYIA 3BFUA 2G93A 4FECA 4L17A 1OQGA 3AXFA 4R6KA 4ZZEA 5I58B 3H06B 2A5SA 1LFHA 1QJMA 1IXGA 5H8NA 1MXYA 3KN7A 4IO5A 3IO6A 3RTWB 4KQPA 5CC2A 2UVHA 1MQHA 2VHAA 4KPTA 5CMCA 2HEUA 2D3IA 1B05A 1DOTA 4H67A 2ZXTA 2QS3A 3FGSA 3G3IA 5K2YA 1AL3A 3TQWA 3H3GA 1IEJA 3UN6A 4BLAA 3EQ1A 1RYOA 1Y3PA 3TKDA 1MPCA 1MRPA 5JTYA 3PUYE 3MJNA 3P7IA 4ZEBA 2F6PA 5BUUA 4QFKA 2XXPA 2CZLA 1B5HA 1UIUA 3TTLA 3V5AA 3MP1A 4ESWA 2GH9A 4LP2B 3S9LC 3FVOA 3QIMA 1LGBC 3R6UA 3K02A 2E1SA 1JVYA 5H8FA 5CMKA 1MQGA 3CFXA 3TZAA 4YU0A 3K1PA 3KSXA 1IXCA 3TTNA 4JSDA 3SEUA 1Y4TA 2REJA 2X26A 1DPEA 5ICQA 4ZZAA 1UTBA 5L9MA 1B58A 3RPWA 4KYSA 4R72A 3CI8A 4H8JA 1A99A 3FVNA 2I0BA 2ZYKA 1FQCA 4FJPA 2G29A 2I4CA 3TPAA 4QFOA 4FATA 1R9QA 4ZEIA 2RCBA 1AH5A 3EPEA 2QMWA 3S9NC 4HS7A 4YKJA 1MPBA 3TFLA 5DVIA 1NNTA 1QKBA 5I59A 3RTFB 3IO4A 3EHUA 2XHDA 4XTCQ 4KI0E 4XXUA 4KYEA 1HSLA 3OSQA 2A5TB 4QFPA 1TWYA 2ZNTA 4E0XA 1QUJA 4JXIA 2AIXA 4OWDA 2AL5A 1MS7A 1Y3NA 2RC7A 3I5OA 2HCAA 1R6ZA 3MP8A 4G2ZA 1MY2A 2Y7RA 4TQUQ 4RYAA 1NH8A 4F3SA 1LSTA 1NKXA 2DWHA 3GBBA 3ECRA 1H76A 1WVJA 4LQ5A 3TODA 4BDLA 4QFNA 1R1NA 3TCHA 1Y4CA 4PETA 1B7UA 3CFLA 4G68B 2VGQA 3PU5A 1VSOA 5J1DA 3T9HB 2HAUA 3DM0A 3T96B 3MAMA 3O28A 3JV9A 1MDP1 2PT1A 4U21A 1HSJA 5KDTA 5DVJA 4TLMB 4OYVA 2V25A 3T22A 3QUFA 3C9HA 4UA8A 3OXNA 2PX1A 4FORA 5ELVA 1VR5A 5EYFA 1R9LA 3K0VA 4RPNA 1CE2A 3PD8A 4BDOA 1US5A 3THIA 4IGRA 2FNCA 3M3KA 4G77A 2ONKE 4WKMA 2Z22A 1TFAA 4H5FA 1FTMA 1TFDA 4Q8RA 2RF1A 1FTLA 4H1XA 2I48A 1B46A 2XXWA 3O6GA 4OFOA 4YKPA 4RK2A 4DLDA 2I3VA 5H8HB 3S4UA 1EZOA 1J1NA 1POTA 4NE4A 3MC2A 3CG1A 2DP8A 4Z7EA 3DELB 5CBSA 2Y7PA 4C0RA 2KLFA 4ISUA 1S50A 2D5WA 2UVJA 4QHQA 4U23A 2Z8FA 2ESNA 4DXCA 1PB9A 1Z7ME 3SETA 3KOTA 1Z7NE 4KFQA 3VXBA 3FV1A 4KHZE 5ITPA 2F7AA 3UIFA 2NOOA 3PPOA 1BTJA 1B4HA 1O64A 1NH7A 3RLFE 2NVUB 3HCQA 2H4IA 2DVCA 1LBCA 1LAXA 4OHNA 3KEIA 5H8FB 5DVFA 1IXIA 3OO6A 4GFRA 3F11A 3W9WA 3A09A 4OFJA 1N76A 2UVIA 2XXTA 2QSXA 1MG1A 1MXZA 3KN8A 3TTMA 4QSDA 3ZKKA 3PUVE 4ZE8A 4ELQA 4N13A 2XXXA 1SW4A 3PMVA 4THIA 1UTBB 2WKYA 4G8HA 2ZNSA 1P1NA 3U92A 3EN3A 2F34A 5CM6A 1H3DA 3JYRA 4OXVA 1FW0A 3U1OA 4ZECA 3DP4A 3TEPA 5I2KB 4Q0CA 1IZ1A 5A5XB 3L6HA 4JWXA 2HFBA 2ZYNA 4RPOA 1TT1A 2DSFA 2Y7IA 1T0KA 3VVEA 3CFZA 5AA2A 3T93B 1B3GA 3UK4A 3ONMA 3LC8A 3O97A 3QUJA 3K6UA 3HO7A 4Q30B 1JNFA 4OERA 4JBZA 4H5GA 3CIJA 4ECFA 3N5LA 5AA3A 3KJTA 1N04A 1YTVA 4XIGQ 5F7VA 4NWCA 3FJMA 4YMBA 2P1SA 2Q88A 3FATA 5AA4A 1I69A 3MZ1A 3BFTA 4F3PA 4NF4B 1GGGA 2XXHA 3K00A 1ZKBA 1LLSA 5K2XA 4X48A 1ZIUA 1M5EA 4OEVA 1MPDA 5DTBA 4ZE9A 3Q28A 3QAXA 1NFTA 1PDAA 3KBRA 2THIA 5KCJB 4PQJA 4JDFA 2OWSA 3HN0A 4RNSA 5I56B 5L9SA 4NMYA 2I0CA 1II5A 5IAIA 2R9JA 3O6HA 4GIZA 4C1UA 1VFEA 4U22A 2M8CA 1UTHB
chains in the Genus database with same CATH superfamily
4NHBA 2DWJA 4YKKA 2F8DA 2NWJA 3VFJA 4OVRA 3FXBA 5F24A 4ZEDA 1D9VA 1WHQA 3RPLA 2O84X 2Q9TA 4GEQB 3LBSA 1SD3A 5AE2A 2EPKX 2PMSA 1NV7A 4FE8A 2YTPA 2ANJA 1PJSA 3ILUB 2XXVA 1MQDA 3E4RA 3VDFA 4NTLA 2ODRD 2EPNA 3BIDA 5TP9B 2I4BA 1FPLA 1N3WA 2EMFA 1YFHA 3KG2A 1UHZA 2EMGA 1A54A 3FXRA 4LF7E 1BKAA 3O2AA 3TCFA 5F3WA 3VVDA 2RCAA 3ADLA 4U2RA 4PAIA 4OEUA 3TELA 4JI6E 1WJPA 1B4ZA 1D4NA 2EM4A 1UN6B 4GL8A 2YT4A 4LF4E 4P78A 3LSFB 4EF2A 1T39A 1OIBA 2ZMBA 4GOTA 4NAPA 1LBXA 3KZZA 5IWAE 1UBDC 2L2KB 1UQWA 1KA0A 2EWLA 3I3VA 3PUZE 2LAOA 4RJZA 4NF5B 1NV1A 1ZLQA 3KFMA 1P47A 1DSNA 1XT8A 4FEBA 3C34A 3IB0A 2HPGA 2V93A 2WBUA 1B3LA 1PB7A 2HGHA 4LVQA 2YTNA 4LF9E 4ONYA 1A55A 3OEKA 4N8GA 5EQ8A 4F1UA 4PGPA 4R2EA 1DTZA 2R71A 1MDQA 4PDDA 1JQFA 2L3JA 5CMMA 4OENA 3RT8A 2XD2A 1FPBA 2LT7A 3G3GA 1HNXE 1FPGA 1O7TA 1B1XA 2ONRA 5AE4A 3Q27A 1SBPA 4F54A 2UUCE 4OVPA 2LUQA 4JVCA 5KL5A 2EM9A 4WX9A 1FKAE 3VXCA 4O94A 2KQZA 2EJ4A 3J80C 5AC5A 3OO9A 1GR2A 3KN3A 3DP8A 2HAVA 4H65A 5FHOA 4TUIA 4DR6E 2WEFA 2B9DA 1MM7A 4DV3E 4G61A 5DT6A 2EN1A 1JETA 3MSWA 3FD3A 4TOZA 2YWQA 5LL6R 4GWWA 1B0HA 1EU8A 2YU5A 1N3XA 4NG7A 1X47A 4F1VA 2LRSA 2GHAA 3IB2A 4OESA 4F3GA 4LONB 1Q1KA 1L5TA 4I8CA 1GV8A 1I6QA 4GLIA 2VE7C 3TQLA 3J81C 3PGFA 3U93A 2LJUA 4LFBE 3D4GA 4H6DA 1URDA 2FA7A 1ANFA 2M9AA 1CB6A 1LB8A 4BCAA 1FTJA 2DIXA 3PD9A 4P1EA 1BIYA 3T9XB 2ZZWA 3IJOB 1MXVA 3BKIB 4PFUA 4N91A 2ENHA 5B7DA 4R73A 1KA1A 2X7PA 3IORA 3OMLA 3QXMA 3SEXA 2PBWA 1B40A 4H45A 3ISPA 2EPUA 4DXUA 1QULA 1I6AA 1UILA 2JOBA 2IA4A 1Y1MA 2EL5A 2KR0A 3TUSA 3FUZA 1OMPA 4NF0A 3OELA 4MLQA 4N6PA 3V89B 3LSLA 1MH4A 3BBGA 2OWTA 4GD5A 4XKPA 5H8QA 1XMOE 1BP5A 2QRYA 3OENA 3OSRA 1IMEA 4O3CA 5A6AA 3IR1A 4XFEA 2WYKA 4F2OA 2UVGA 3UGWA 3UORA 1IMUA 2DXRA 3E79A 2PT2A 1SDXA 2EOMA 5DW8A 1X6EA 2HXWA 4GWUA 4YAHX 5IGAA 3G3HA 3VHTB 4PF8A 2RQLA 2B3BA 3T66A 1A8EA 4ZDMA 2O7UA 2I49A 2YTQA 1B0LA 5I2NA 2DVZA 4DDDA 1OVBA 1ZU0A 3KJ7A 5HBCA 4KWYA 4I40A 1N34E 4LQ2A 1B52A 4KCCA 1DI2A 2RKMA 4K3FA 3MZBA 4MMPA 2B7TA 4WXDA 2YTEA 2REGA 4X1DA 2YTFA 1WDNA 1NNFA 2EMWA 1PB8A 3WAEA 1FQAA 3G3JA 3FJ7A 1LEVA 2QL3A 2OX3A 3ZSFA 4F6NA 2RS6A 5ET7A 5TPAA 1IITA 2EL6A 4ZYEA 1LFGA 4PFWA 4KHPE 2OBGA 1D9YA 5DEXA 1OVTA 2EPPA 3E3KA 4UACA 4DKKA 3TAJA 1OQHA 4POWA 2V8QB 3R26A 3UP9A 3JZJA 4R6YA 4DCXA 4Q28A 2KONA 3KOSA 4R2SA 1EH3A 4IB2A 4N8YA 2EOSA 4NF8A 3V83A 4PFBA 1FPDA 5AE1A 1A40A 5H8NB 3O66A 4NEDA 1FQDA 4AQ4A 4IY5A 5JK4A 1FBGA 1QW0A 2WYPA 3IWDA 1MH3A 4O4KA 2H9BA 1M5CA 3Q26A 5IV8B 4YICA 2VQEE 5I58A 2NA2A 3MWBA 1B7HA 1NUWA 1ZR9A 1B2HA 4F31B 3SEYA 3UA8A 2YTGA 3VYXA 3O6IA 3SESA 4XF5A 2CPNA 2FIXA 2P2AA 4OMBA 1B3FA 2RS7A 3HTXA 3FV2A 3OO8A 2UXAA 2XXUA 5AE3A 3B6WA 2B3FA 2CT1A 4GX3A 1VFDA 4KR5A 3VVFA 2Q89A 4O7MA 2XX8A 4EUOA 4R2CA 5JTYB 4ZEFA 2XXRA 2VRDA 4GXSB 2QMXA 3MVXA 3H4ZA 2EPMX 2P0SA 4YZZA 3M3FA 2QPQA 2YJPA 3CHGA 2YTIA 4EDPA 1H43A 4R9GA 2YZTA 2DQVA 1DMBA 3JU0A 3H7MA 4BBYA 3KBZA 5CMBA 1O0WA 3KSJA 4JSOA 4N07A 4GL0A 4H8IA 2Z8EA 4MEVA 3K1NA 2PYYA 1FTOA 3C33A 3J7AG 3E9XA 3IWBA 2CSHA 2UYEA 3LSWA 2JWOA 3O29A 4MBPA 2VP1A 2E1MA 1POY1 1NV0A 4YKIA 3TTKA 4G8MA 2QFLA 1P99A 3G7WA 2RC9A 3R7XA 2AL4A 2Q2CA 2GHBA 1BLFA 3H03A 4GRKA 2YTOA 4F19A 3MPLA 4PFIA 1KZ8A 4LZ7A 2EM5A 2JXPA 4Q5TA 4OVJA 1AIVA 2UYFA 4N81A 1STUA 3IOTA 3H6UA 4R75A 5EHSA 3H6VA 1URGA 3VLUA 1HSEA 1X6FA 5L9OA 5CBRA 4GQOA 4N15A 1IMBA 4LFAE 5DYHA 2MKDA 2EORA 2NUVA 1DTGA 4FAJA 4N4RB 3KZGA 2FYIA 3LR1A 1OLCA 2EOJA 3IAZA 1X48A 2Y7WA 3B6TA 3C4TA 4LUBA 4XKNA 4RY1A 4EQBA 4ZYDA 1FQFA 4JI4E 2H25A 1ZBQA 5CI5A 4NF6A 2ALUA 1PEBA 1EZPA 1LBBA 4I1DA 4ZEKA 1USYE 2I58A 4HE0A 2JY9A 4C1TA 2EM7A 1UIVA 2ABHA 5I59B 2ZNUA 2NXOA 2OLBA 1MM6A 3HHFA 3S9EA 1MY4A 3FXUA 3OO7A 4YB6A 4BDMA 5FHMA 3IFCA 2Y5KA 2LE2A 3HHGA 2EOYA 1YUIA 3N6UA 4R74A 2VOZA 3FVGA 4MH5A 4RA1A 2VT5A 2DE3A 1GTKA 2V87A 5F1QA 2DSYA 3MSTA 2EMBA 1XNQE 2R1FA 4ZS9A 4ELRA 2A5TA 1YPNA 1GVCA 1MQJA 4FK5C 1T4LB 3VLWA 2B7VA 2Z23A 4F2QA 2R8TA 3MZ9A 1B3EA 5H8QB 2EOFA 1QUKA 4DCYA 1SI0A 2XA5A 1WODA 2EM8A 3RQTA 1NL5A 1L4SA 1FTKA 4IY6A 4U4XA 4HTGA 1B69A 4R03A 4F18A 1YYKA 4LFCE 2EZ6A 2CMOA 3IJXB 2J7JA 3RY3A 3LLHA 1GZ6A 1LAHE 2XX7A 4GX6A 3M3LA 2EMLA 2O51A 1XHYA 3H6WA 4NQ8A 2EP3A 4PE3A 1USYH 5I57A 1JK2A 2FVZA 4JB7A 4AB6A 3PPRA 1IMAA 3DP6A 4M1VA 2GLIA 4NN3A 5LOMA 1YAEA 3B6QA 2YTJA 4OVTA 5KL4A 1LBWA 4P47A 3Q25A 1K9YA 1EH7A 1MY3A 3S2VA 3BGHA 2L92A 1ELJA 2F78A 2F3BA 3W9VA 3QSLA 5KDTB 1SVXB 2R76A 3N26A 3EF7A 1EZ9A 4M2ZA 2CZIA 3ILTB 4G68A 4PFRA 1URSA 2OZZA 1FBFA 1A1JA 3IX1A 4M4GA 2EM0A 1LB9A 2Y7KA 3FASA 4HCYA 2PRTA 4DZ1A 3ADIA 3TTRA 1Y3QA 2QJEA 5TPAB 4FIMA 3TYHA 2F97A 5DEXB 3ODBA 2WBDA 3C32A 4MF3A 4TLLB 4NF8B 1RDXA 2EN3A 4HEIA 1Y1ZA 4OANA 4KXPA 2EN4A 1LFIA 2V3QA 1X5WA 5BR8E 1SW5A 4OFLA 2B4MA 1AOVA 1B7ZA 4FEDA 3C6MA 2ZYOA 4ELOA 4QSEA 5IKBA 2BB8A 2OCUA 3MPKA 1DGCA 4PFTA 2HZKA 4WEDA 4L8NA 4OTEA 1XOCA 4BS9A 1N33E 1NUZA 2O7IA 4R2FA 3U94A 2DWAA 1H44A 3G3KA 2OK2A 2HHHE 5KZTA 2LBSB 2NUFA 3A3CA 2F7CA 4U1OA 4ND9A 2HQ0A 3FBPA 1GQEA 2RPCA 2EMXA 4HXVA 1QU6A 1F2IG 4IO6A 2EOIA 1QVSA 4YB5A 5H8HA 3SEVA 1RYXA 4I8OA 2EPLX 4YHHE 1ZMGA 4I3YA 3TQMA 2EPXA 1NV4A 5A6KA 4GVOA 4PBQA 4JWOA 2EOZA 1RDZA 3VV5A 2W7YA 2GHFA 2XXYA 1MXUA 2H5YA 1XVXA 2PVUA 3CG3A 3MUQA 1Q35A 2LUPB 2RC8A 4JI3E 2PCRA 1I94E 1EYKA 4OOGC 5A2QC 4DIGA 1NV2A 3CSBA 3P1XA 3RUMA 3HFUA 4X9TA 3T9UA 3K4UA 4G8NA 1ATGA 4DI3D 3EPHA 3V8XB 2IEEA 3M99B 3CR9A 3LUYA 2H99A 1SQYA 2HC5A 4DV0E 1TXFA 5M2VA 2E0SA 2DDKA 3T9VA 3OOAA 1FBCA 2DS9A 3SERA 2V4CA 2XD3A 4I62A 3GXAA 2LV2A 2RSMA 3BBRA 2V84A 3HSTA 5TU0A 2ONSA 4YMAA 2F5XA 2EOQA 4O3BA 2F8BA 3VYYA 2F36A 4P9KA 4AB5A 1NMUA 3TDJA 5JEIA 4X65E 1JW1A 2EMIA 2RINA 4HW8A 1JK1A 5IZ3B 2VQFE 1ZTYA 2E5LE 4O5GA 1P1OA 2HZLA 4E0WA 3K01A 1FTAA 2D21A 5BWJA 1EYIA 5B70A 4GKJE 4MHFA 1P1QA 2CTDA 1P1UA 3D1RA 5AA1A 4NF6B 1MEYC 1RDYA 1IBLE 2F7BA 3EHSA 1KWHA 3GLBA 3GYYA 2MDRA 2YLNA 2E72A 2QS2A 2VPOA 4KZSA 5ITOA 1BBGA 4WSGA 3C4BA 3EPJA 1US4A 5AA2B 1MGTA 3FZVA 1RQ0A 1MY0A 3MVZA 3ZKLA 1CNQA 2XX9A 4JI1E 5I2KA 3IOWA 3O9PA 2V85A 4P0GA 1SI1A 3RT6B 5A5XA 1OLAA 2X7QA 1PBQA 3N6TA 4X62E 1B5IA 5EQ7A 1B32A 1ZBMA 1XC1A 5LMNE 2Z8DA 4MJOA 4PF6A 2DLQA 2D9HA 4DMIA 3MVYA 4O24A 4B3RE 1B5JA 1F9BA 3MQ9A 2DMIA 1YUJA 4F1YA 3A3UA 1T38A 4PDHA 4LA9A 2AYSA 3IOVA 1N32E 2HXRA 4HE1A 5CRYA 4WEPA 2EN7A 2XXIA 3IFAA 3K6VA 4QSCA 1M5BA 4GWYA 4P56A 1N36E 3H6TA 5AA4B 3PPQA 4PP0A 2GFEA 4GWOA 4YY3E 1NNPA 1JW4A 2N8XA 4JYAE 3ADGA 2R6GE 4G4PA 4R2RA 3VLVA 3HQ1A 2MKNA 1O63A 1LCTA 2I9IA 3FXQA 1M5DA 4IO3A 3N94A 2XXQA 3RN8A 1YZ9A 4MNIA 3PV0E 3U8QA 1MY1A 4DR3E 2I6EA 5I57B 4NF4A 3L00A 3FVKA 1N7XA 2ZYMA 3S9MC 4XKQA 1XVYA 5A6JA 3QK6A 1P1WA 2Q8MA 4OETA 1FPIA 4JWYA 3ADJA 4H0WA 2DOJA 2XXKA 5KCJA 3C6KA 4KYDA 4DR4E 1IMDA 4B3SE 2O6AA 3OMBA 5I56A 1JVXA 3F6GA 1LAGE 2BJJX 3T1YE 5ET6A 4MAGA 5EHMA 2EM2A 1PBPA 2HHMA 3RPLB 4ZYGA 4MLVA 3K6WA 4X66E 4PTKA 1UTHA 3QYTA 2UXCE 4OQOA 1NV3A 4P0IA 4QRZA 2L2NA 3AUZA 5T6JA 1FBDA 2A25A 1A8FA 2NUEA 1N0TA 2I3WA 3B7DA 2L2MA 2QVUA 1YCJA 3MP6A 4LN5A 3FJGA 4GF8A 4LZ5A 1N7WA 2ZM6E 3OD7A 2L33A 2F6GA 3DJWA 4KD5A 3RMPA 2GRVA 1WRJA 4U1ZA 3IK6B 4I9DA 4JV5E 4PC9A 2YTDA 3IOUA 3K2DA 2LCEA 4R9FA 2EOHA 4GBVA 2WX9A 5TP9A 2F35A 4DV2E 4OA4A 1NCSA 5H8SA 5L8DA 1K9ZA 5IT9C 4K0KE 4PE5B 5HPQA 3CRBA 1DQ3A 4F3BA 3LSXA 1JW5A 4DR7E 1B3HA 2QS4A 3RYDA 2O1LA 2UUBE 3IB1A 3MBPA 2QS1A 2P3VA 4AS5A 3CSGA 4GXAA 4X64E 1S9TA 4GBWA 5AASA 4WXJA 2OJTA 5A6BD 5LLQA 1LBZA 4XKRA 4IGTA 3TCGA 4MX6A 1MXXA 4DXBA 2EM6A 3M8UA 3SEWA 4EQ7A 1T4NA 1KJKA 4NF5A 2VF1A 3LV0A 1T4OA 4F39A 1SYHA 4IO2A 4HE2A 2YPNA 4OZ9A 3L6GA 2OWZA 3PMXA 4KCDA 5FLXC 2YSOA 4DR1E 2PFYA 2Q8JA 1RC7A 1NI9A 5TSEA 4ESXA 4EXLA 1FJ6A 4FBPA 1FQEA 1S7YA 3OTOE 2O68A 4EXKA 1X3CA 1ZJLA 4GX4A 4X1BA 3EHTA 2V3TA 3PMWA 4NGUA 3E13X 3KGCA 3U72A 1Y9UA 2DXYA 1PJQA 1X6HA 4MCOA 2NABA 3K1MA 1HNZE 1SW1A 1FBHA 5I5PA 4P11A 3J7Yp 2V3UA 1FRPA 4U4SA 4F6MA 2CZKA 1MQIA 4RXLA 4YB7A 4EQ9A 1I6BA 4IO4A 1FPJA 1LBYA 1DCUA 4HCWA 2DGCA 4F9AB 4F22A 3RGYA 3KC0A 1KYQA 5ISUA 3C36A 2M1SA 2JOXA 3B8BA 4LATA 3FIRA 1PC3A 1B9JA 1J26A 1YYZA 4BDNA 1LCFA 5ADZA 4WYQB 2M4IA 2EMKA 1XS5A 1IIWA 3T1HE 4WPYA 2KOUA 1B51A 3GZGA 3C4MA 5T3JA 3ZS6A 2ELYA 1B6HA 3PUXE 1Y20A 2B65A 3USDA 4IO7A 2EOOA 2EOEA 1QKAA 1LAFE 5ICTA 4LF6E 1QUIA 1G0HA 4O3AA 2ODRC 4NWDA 2VD3A 3T1BA 3MW0A 2V83A 4Z0IA 1DPPA 1MXWA 1D3KA 3SKPA 1ZU1A 4H46A 1DBZA 3NOHA 2IHR1 1JP4A 4LZ8A 1TF6A 3H09A 3G3FA 3PPPA 2EPCA 5HM4B 4JI2E 1IQ7A 1IXHA 1IUDA 2LO3A 2FGGA 4X04A 4F29A 5CFFE 5I3SA 2FTXB 5J16A 2DYXA 2DE4A 4R6HA 1D9QA 1AMFA 4PFYA 2Q2AA 4MFIA 1EH6A 4WXCA 3OEMA 3IL1B 1SPIA 4R2QA 2DWIA 4G68C 4NX1A 1NV5A 2VPNA 4QF9A 3SDFA 4RK9A 2VD2A 1VE4A 2WBBA 3GBAA 1A7LA 1JEUA 5FHNA 1B1HA 1H45A 3PUWE 5KL3A 3C31A 4R2PA 3THNA 3HV1A 2EPRA 5I2NB 1M5FA 3HPIA 3Q29A 5AA2D 2H98A 4F9CB 1LBVA 3DLNA 4R2BA 2WCC3 2RTXA 4BDRA 2XWOA 3CVGA 1RKMA 4BMJA 4BC9A 4NXME 4BDQA 4EF1A 1YZ0A 3K6XA 2DRPA 1JEVA 2EN6A 2ZZVA 1SW2A 3WAFA 3C35A 2O1MA 2Y5LA 3ROJA 2Y84A 2FIEA 4QFLA 3MVWA 3I6VA 4R2AA 4POXA 2BBGA 5I84A 3W15C 4DE8A 5IZZA 3PPNA 4ELPA 5FTIA 1FQBA 1NNKA 3HXLA 2DE2A 3AV0A 1FCKA 3D4CA 3VE1B 3TMGA 2YRMA 2HJJA 3DF6A 1IQOA 2EMHA 2O69A 3RNNA 4R8OA 1N84A 5FTHA 1SYIA 4AQYE 1HNWE 3BFUA 2G93A 4FECA 1X49A 4L17A 2CEXA 2JYAA 2EQ3A 1OQGA 2Q74A 2XWVA 3AXFA 4R6KA 4LTYA 2EOXA 4ZZEA 5I58B 3H06B 1XI6A 3U65A 4BC7A 2N3HA 2L5VA 2MC5A 4F9BB 1FJ9A 2A5SA 3LMLA 1XNRE 1LFHA 1QJMA 2WZOA 1IXGA 5H8NA 1TN9A 1MXYA 3KN7A 4IO5A 5LDZA 3FIGA 3IO6A 3RTWB 4NZVA 4KQPA 3K6QA 1XMQE 5CC2A 1BB8A 2UVHA 1MQHA 2QVRA 4QXDA 2VHAA 4M0VA 1EKZA 4KPTA 5CMCA 1IMCA 2HEUA 2D3IA 2YSPA 1B05A 1DOTA 3EPKA 4PGNA 2LJHA 4H67A 2JJKA 2ZXTA 1SR9A 2QS3A 4WSPA 3FGSA 3G3IA 5K2YA 4NHRA 1AL3A 4DV1E 3TQWA 1WHNA 4LF5E 2DMYA 3H3GA 1NEIA 2I13A 1IEJA 3UN6A 4BLAA 3EQ1A 1RYOA 1AWBA 4GKKE 1Y3PA 4P1LA 3TKDA 1MPCA 1MRPA 5JTYA 2WBTA 3HPSA 4R2DA 3MJNA 3PUYE 2G7HA 3P7IA 1FJGE 4ZEBA 4DV6E 2F6PA 5BUUA 4QFKA 3BIHA 2XXPA 2FV4B 2CZLA 1B5HA 4N4UA 2EM3A 1UIUA 4DUYE 2M7QA 3TTLA 3V5AA 3MP1A 4ESWA 3QMFA 2K7IA 2ENAA 2GH9A 4LP2B 4B3TE 3S9LC 3FVOA 3QIMA 1LGBC 3R6UA 3K02A 2E1SA 3PTYA 1JVYA 5H8FA 4X9JA 2JPAA 5CMKA 1MQGA 3CFXA 3TZAA 4YU0A 1ZBTA 3K1PA 2QVVA 3KSXA 5ET8A 2DB2A 2UXDE 1IXCA 3TTNA 2YRKA 4BHBA 4JSDA 3SEUA 1YYOA 1Y4TA 4RH8A 2REJA 2X26A 3UK3C 4GWXA 4JVIA 1NUXA 2LTRA 4JI7E 3T0JA 4IS1C 1DPEA 4X8RA 5ICQA 4ZZAA 1UTBA 5L9MA 5A5LA 3B50A 2Q8UA 4OVSA 1B58A 3RPWA 4KYSA 3MHSC 2EQ1A 4R72A 2UU9E 3CI8A 1IBKE 4H8JA 1A99A 3FVNA 2I0BA 2ZYKA 2EMAA 1FQCA 4FJPA 2G29A 3THOB 1EH8A 2I4CA 2KHXA 3TPAA 4QFOA 4FATA 1R9QA 4ZEIA 2RCBA 1AH5A 4F2JC 3EPEA 4PBHA 2QMWA 2EN8A 4HS7A 3S9NC 4YKJA 1MPBA 3TFLA 4M30A 3KZYA 4QBAA 2ZZXA 4P8BA 5DVIA 1NNTA 4O7IA 1QKBA 2UXBE 1PKPA 3ZOQB 5I59A 1FPKA 3RTFB 5FBPA 3IO4A 5AC4A 3EHUA 2XHDA 4XTCQ 4KI0E 4XXUA 4KYEA 3IWCA 1HSLA 3OSQA 2A5TB 4QFPA 2EPOA 2L3CA 1TWYA 2ZNTA 4L5NC 4E0XA 1QUJA 4JXIA 2AIXA 4OWDA 2AL5A 1MS7A 1Y3NA 2RC7A 1WXRA 3I5OA 4IJDA 2HCAA 4P3LA 1R6ZA 3MP8A 4G2ZA 1MY2A 2Y7RA 1BK4A 4TQUQ 2LVHA 1FBEA 4RYAA 3MHHC 1G2DC 4N6KA 1NH8A 4F3SA 1LSTA 1NKXA 2DWHA 2RSIA 3GBBA 3ECRA 2F4VE 4DR2E 1H76A 1WVJA 2H36X 4LQ5A 3TODA 5KL7A 5ESYA 4BDLA 4QFNA 5IM2A 4M9VC 1AAYA 1R1NA 3TCHA 1Y4CA 5LMUE 4PETA 1B7UA 3CFLA 3F6HA 2N3GA 1TF3A 2EPZA 4G68B 2VGQA 3PU5A 1VSOA 1NV6A 4GWSA 5J1DA 3T9HB 2HAUA 2BJIA 3DM0A 3T96B 3MAMA 3O28A 3JV9A 1MDP1 2PT1A 1YYWA 4U21A 1HSJA 2EMYA 5KDTA 3JAMC 5A6BA 5DVJA 4TLMB 4PAFA 4OYVA 2V25A 4O43A 3T22A 3QUFA 4OVQA 3C9HA 4UA8A 3OXNA 1LLMC 2PX1A 4GZNC 4FORA 3JTZA 5ELVA 1VR5A 1PJTA 5EYFA 1FPEA 1G2FC 1R9LA 3K0VA 4RPNA 1CE2A 1HR0E 4MNCA 3PD8A 2B3TB 2EE8A 4BDOA 1US5A 3THIA 4IGRA 2FNCA 3M3KA 4G77A 1IBME 2ONKE 4WKMA 2Z22A 1Z1BA 1TFAA 4DR5E 4H5FA 3E78A 2CEYA 1FTMA 2JR1A 1TFDA 4Q8RA 2RF1A 1FTLA 4H1XA 2I48A 1B46A 2XXWA 3O6GA 1QNTA 4P7DA 2UUAE 1ZAAC 1Q9DA 4OFOA 4YKPA 2L8TA 4RK2A 3KWRA 2XWIA 4DLDA 2I3VA 5EYHA 2V89A 5H8HB 3S4UA 5A69A 1EZOA 2LTSA 1J1NA 4N17A 5IZ1A 1POTA 4NE4A 4O8MA 4B3ME 3CG1A 3MC2A 1VDWA 2DP8A 4Z7EA 2YU8A 3DELB 5CBSA 2Y7PA 4C0RA 2KLFA 4ISUA 1S50A 2D5WA 2UVJA 4QHQA 4U23A 2Z8FA 2ESNA 1FSAA 4DXCA 1PB9A 1Z7ME 4DV7E 3SETA 1DK4A 3KOTA 1IMFA 1Z7NE 4KFQA 3LUZA 5EQAA 3VXBA 3FV1A 2P3NA 4KHZE 4JI0E 5KL6A 5ITPA 2F7AA 3UIFA 4NXNE 2NOOA 3PPOA 1BTJA 4Q35B 2B4LA 1B4HA 1O64A 2F3DA 1NH7A 3MYUA 3RLFE 2NVUB 3HCQA 2H4IA 1N3GA 2LMZA 4MIJA 2DVCA 1LBCA 1LAXA 4OHNA 3KEIA 5H8FB 2EMZA 5DVFA 1IXIA 3OO6A 4LF8E 4GFRA 5IXMB 3F11A 3W9WA 2YRHA 3A09A 4OFJA 4LU9A 2EL4A 1INPA 1N76A 2UVIA 2XXTA 4J8ZA 2QSXA 1MG1A 1MXZA 3KC1A 3KN8A 5ET5A 3TTMA 4QSDA 3ZKKA 3PUVE 4PCDA 1A1KA 4ZE8A 4ELQA 4N13A 2XXXA 1SW4A 3PMVA 4XEQA 1EYJA 2V86A 2FHYA 1NUYA 2PFZA 4X8WA 1UTBB 4THIA 2WKYA 4G8HA 2ZNSA 1G0IA 1P1NA 3U92A 3EN3A 2F34A 5LTCA 5CM6A 4JI8E 2NUGA 2WBSA 5IZ3A 2EMCA 4RHBB 1H3DA 3JYRA 4OXVA 1FW0A 2CZHA 3U1OA 4ZECA 2DLKA 3DP4A 3TEPA 4JVDA 5I2KB 1IQSA 4OX9E 4Q0CA 1IZ1A 4AS4A 5A5XB 3L6HA 1A1HA 4JWXA 2HFBA 2ZYNA 2K4VA 4RPOA 2EPAA 1TT1A 2DSFA 2Y7IA 1T0KA 3VVEA 3CFZA 5AA2A 1RMDA 1J5EE 5EYGA 3T93B 1B3GA 3UK4A 4MNPA 3ONMA 1FBPA 3EKIA 3LC8A 3O97A 2JP9A 1SFEA 3VK6A 4BHCA 1YSAC 3QUJA 3K6UA 3HO7A 1A1IA 2MDGA 4Q30B 1YXIA 5EQ9A 1JNFA 4OERA 2EN2A 1BBOA 4H5GA 4JBZA 4DUZE 3CIJA 4ECFA 3N5LA 4JI5E 5AA3A 4DV5E 3SZPA 4IR8A 3KJTA 3A29A 1N04A 1YTVA 2MKZA 2MC6A 4XIGQ 5F7VA 5DNYA 2V88A 4NWCA 1QGXA 1FPFA 3FJMA 4YMBA 2P1SA 4I3EA 2Q88A 2ELZA 2JVAA 3FATA 5AA4A 4DV4E 1I69A 3MZ1A 3BFTA 4F3PA 4PAKA 4ZYHA 4NF4B 3BIGA 1GGGA 2XXHA 3K00A 1ZKBA 1LLSA 2GPIA 5K2XA 3BF2A 4X48A 1ZIUA 1M5EA 4OEVA 1MPDA 5DTBA 2EQ0A 3Q28A 4ZE9A 3QAXA 4TUGA 1NFTA 1PDAA 3KBRA 4UABA 2THIA 3HPZA 5KCJB 4PQJA 4JDFA 2L6MA 2OWSA 3HN0A 4RNSA 5I56B 5L9SA 4NMYA 2XWKA 1A1LA 2I0CA 1II5A 2FBPA 5IAIA 5I7IA 2R9JA 1A1GA 2ADRA 3EPLA 3O6HA 4DI4B 4N6DA 4GIZA 4WFTA 4C1UA 1VFEA 4U22A 2M8CA 2GQ1A 5KL2A 2ENCA 1UTHB 4GWZA 1A1FA 3QG5C
chains in the Genus database with same CATH topology
2DWJA 4YKKA 2F8DA 2NWJA 3VFJA 4ZEDA 1D9VA 2O84X 2Q9TA 3LBSA 1SD3A 2PMSA 4FE8A 2ANJA 3ILUB 2XXVA 1MQDA 3E4RA 3VDFA 4NTLA 5TP9B 2I4BA 1N3WA 3KG2A 1A54A 3FXRA 1BKAA 3O2AA 3TCFA 3VVDA 2RCAA 4U2RA 4OEUA 3TELA 1B4ZA 1D4NA 4GL8A 3LSFB 4EF2A 1OIBA 2ZMBA 4GOTA 1UQWA 3I3VA 3PUZE 2LAOA 4RJZA 4NF5B 1ZLQA 3KFMA 1DSNA 1XT8A 4FEBA 3C34A 3IB0A 2V93A 1B3LA 1PB7A 4LVQA 4ONYA 1A55A 3OEKA 4F1UA 1DTZA 2R71A 1MDQA 1JQFA 5CMMA 4OENA 3RT8A 2XD2A 3G3GA 1O7TA 1B1XA 2ONRA 5AE4A 3Q27A 1SBPA 3VXCA 3OO9A 1GR2A 3KN3A 3DP8A 2HAVA 4H65A 5FHOA 1MM7A 5DT6A 1JETA 3FD3A 4TOZA 1B0HA 1EU8A 1N3XA 4F1VA 3IB2A 2GHAA 4OESA 4F3GA 4LONB 1Q1KA 1L5TA 4I8CA 1GV8A 1I6QA 4GLIA 3TQLA 3PGFA 3U93A 3D4GA 4H6DA 1URDA 2FA7A 1ANFA 1CB6A 1LB8A 1FTJA 3PD9A 1BIYA 3T9XB 3IJOB 1MXVA 3BKIB 4PFUA 5B7DA 4R73A 2X7PA 3IORA 3QXMA 3SEXA 2PBWA 1B40A 4DXUA 1QULA 1I6AA 2IA4A 1Y1MA 3TUSA 3FUZA 1OMPA 3OELA 4MLQA 4N6PA 3V89B 3LSLA 1MH4A 2OWTA 4GD5A 4XKPA 5H8QA 1BP5A 2QRYA 3OENA 3OSRA 4O3CA 3IR1A 4F2OA 2UVGA 3UGWA 3UORA 2DXRA 2PT2A 1SDXA 2HXWA 4YAHX 3G3HA 2B3BA 3T66A 1A8EA 4ZDMA 2O7UA 2I49A 1B0LA 5I2NA 2DVZA 4DDDA 1OVBA 1ZU0A 3KJ7A 5HBCA 4LQ2A 1B52A 4KCCA 2RKMA 4K3FA 3MZBA 2REGA 4X1DA 1WDNA 1NNFA 1PB8A 3WAEA 1FQAA 3G3JA 3FJ7A 2QL3A 3ZSFA 5TPAA 1IITA 1LFGA 4PFWA 2OBGA 1D9YA 5DEXA 1OVTA 3E3KA 4UACA 3TAJA 1OQHA 4POWA 3R26A 3UP9A 3JZJA 4DCXA 4R6YA 3KOSA 4NF8A 4IB2A 1EH3A 3V83A 1A40A 5H8NB 3O66A 4NEDA 1FQDA 4AQ4A 4IY5A 5JK4A 1QW0A 1MH3A 2H9BA 1M5CA 3Q26A 4YICA 5I58A 3MWBA 1B7HA 1B2HA 4F31B 3SEYA 3UA8A 3O6IA 3SESA 2P2AA 4OMBA 1B3FA 3FV2A 3OO8A 2UXAA 2XXUA 3B6WA 2B3FA 1VFDA 4KR5A 3VVFA 2Q89A 2XX8A 4EUOA 5JTYB 4ZEFA 2XXRA 4GXSB 2QMXA 3MVXA 3H4ZA 2P0SA 4YZZA 3M3FA 2QPQA 2YJPA 4EDPA 1H43A 4R9GA 2DQVA 1DMBA 3H7MA 5CMBA 3KSJA 4JSOA 4N07A 4GL0A 4H8IA 2Z8EA 3K1NA 2PYYA 1FTOA 3C33A 3E9XA 2UYEA 3LSWA 3O29A 4MBPA 2VP1A 1POY1 4YKIA 3TTKA 4G8MA 1P99A 3G7WA 2RC9A 3R7XA 2AL4A 2Q2CA 2GHBA 1BLFA 3H03A 4GRKA 4F19A 3MPLA 4LZ7A 4Q5TA 1AIVA 4OVJA 2UYFA 3IOTA 3H6UA 4R75A 5EHSA 3H6VA 1URGA 3VLUA 1HSEA 5L9OA 5CBRA 4GQOA 5DYHA 2NUVA 1DTGA 4FAJA 3KZGA 2FYIA 3LR1A 1OLCA 3IAZA 3B6TA 2Y7WA 4LUBA 4XKNA 4RY1A 4EQBA 1FQFA 2H25A 5CI5A 4NF6A 2ALUA 1PEBA 1EZPA 1LBBA 4I1DA 4ZEKA 1USYE 2I58A 4C1TA 2ABHA 1UIVA 5I59B 2ZNUA 2NXOA 2OLBA 1MM6A 3HHFA 3S9EA 1MY4A 3FXUA 3OO7A 4YB6A 4BDMA 5FHMA 3HHGA 3N6UA 4R74A 2VOZA 3FVGA 4MH5A 4RA1A 2DE3A 1GTKA 5F1QA 4ZS9A 4ELRA 2A5TA 1YPNA 1GVCA 1MQJA 3VLWA 2Z23A 4F2QA 3MZ9A 1B3EA 5H8QB 1QUKA 4DCYA 1SI0A 1WODA 3RQTA 1NL5A 1FTKA 4IY6A 4U4XA 4HTGA 4F18A 3IJXB 2CMOA 3RY3A 1LAHE 2XX7A 3M3LA 2O51A 1XHYA 3H6WA 1USYH 5I57A 4JB7A 4AB6A 3PPRA 3DP6A 4M1VA 5LOMA 1YAEA 3B6QA 3Q25A 1MY3A 3S2VA 1ELJA 2F78A 3W9VA 3QSLA 5KDTB 1SVXB 3N26A 3EF7A 1EZ9A 3ILTB 4G68A 1URSA 2OZZA 3IX1A 4M4GA 1LB9A 2Y7KA 3FASA 4HCYA 4DZ1A 3TTRA 1Y3QA 2QJEA 5TPAB 4FIMA 3TYHA 2F97A 5DEXB 3ODBA 3C32A 4MF3A 4TLLB 4NF8B 1Y1ZA 1LFIA 2V3QA 1SW5A 4OFLA 1AOVA 1B7ZA 4FEDA 2ZYOA 4ELOA 4QSEA 5IKBA 2OCUA 3MPKA 4PFTA 2HZKA 4WEDA 4OTEA 1XOCA 2O7IA 4R2FA 3U94A 2DWAA 1H44A 3G3KA 2OK2A 5KZTA 3A3CA 2F7CA 4U1OA 4ND9A 2HQ0A 4IO6A 1QVSA 4YB5A 5H8HA 3SEVA 1RYXA 1ZMGA 4GVOA 4JWOA 3VV5A 2W7YA 2XXYA 1MXUA 2H5YA 1XVXA 2PVUA 3CG3A 3MUQA 1Q35A 2RC8A 4DIGA 3CSBA 3RUMA 4X9TA 3T9UA 3K4UA 4G8NA 1ATGA 3V8XB 2IEEA 3CR9A 3LUYA 2H99A 1SQYA 1TXFA 5M2VA 2E0SA 3T9VA 3OOAA 2DS9A 3SERA 2XD3A 4I62A 3GXAA 3BBRA 2V84A 3HSTA 5TU0A 2ONSA 4YMAA 2F5XA 4O3BA 2F36A 4AB5A 1NMUA 3TDJA 5JEIA 1JW1A 2RINA 4HW8A 1ZTYA 1P1OA 2HZLA 4E0WA 3K01A 2D21A 5BWJA 5B70A 1P1QA 1P1UA 5AA1A 4NF6B 2F7BA 3EHSA 3GLBA 1KWHA 2YLNA 2QS2A 5ITOA 1US4A 5AA2B 3FZVA 1MY0A 3MVZA 3ZKLA 2XX9A 5I2KA 3IOWA 3O9PA 4P0GA 1SI1A 3RT6B 5A5XA 1OLAA 2X7QA 1PBQA 3N6TA 1B5IA 1B32A 1ZBMA 1XC1A 2Z8DA 3MVYA 1B5JA 1F9BA 3MQ9A 4F1YA 3A3UA 4LA9A 2AYSA 3IOVA 5CRYA 4WEPA 2XXIA 3K6VA 4QSCA 1M5BA 3H6TA 5AA4B 3PPQA 4PP0A 2GFEA 4GWOA 1NNPA 1JW4A 2R6GE 4G4PA 3VLVA 1O63A 1LCTA 3FXQA 1M5DA 4IO3A 3N94A 2XXQA 3RN8A 3PV0E 3U8QA 1MY1A 2I6EA 5I57B 4NF4A 3FVKA 1N7XA 2ZYMA 3S9MC 4XKQA 1XVYA 3QK6A 1P1WA 4OETA 4JWYA 4H0WA 2DOJA 5KCJA 4KYDA 5I56A 2O6AA 3OMBA 1JVXA 1LAGE 2BJJX 5EHMA 1PBPA 4MLVA 3K6WA 1UTHA 3QYTA 4OQOA 4P0IA 4QRZA 1A8FA 1N0TA 2I3WA 3B7DA 1YCJA 3MP6A 3FJGA 4GF8A 4LZ5A 1N7WA 3OD7A 2F6GA 4KD5A 2GRVA 4U1ZA 3IK6B 4I9DA 3IOUA 3K2DA 4R9FA 5TP9A 2F35A 5H8SA 5L8DA 4PE5B 5HPQA 3CRBA 4F3BA 3LSXA 1JW5A 1B3HA 2QS4A 2O1LA 3IB1A 3MBPA 2QS1A 3CSGA 4GXAA 1S9TA 4WXJA 2OJTA 4XKRA 4IGTA 3TCGA 1MXXA 4DXBA 3M8UA 3SEWA 4EQ7A 4NF5A 4F39A 1SYHA 4IO2A 2YPNA 4OZ9A 3L6GA 3PMXA 4KCDA 2Q8JA 4ESXA 4EXLA 1FQEA 1S7YA 2O68A 4EXKA 1ZJLA 4X1BA 3EHTA 2V3TA 3PMWA 3E13X 3KGCA 3U72A 1Y9UA 2DXYA 3K1MA 1SW1A 4P11A 2V3UA 4U4SA 4RXLA 1MQIA 4YB7A 4EQ9A 1I6BA 4IO4A 4HCWA 4F22A 3RGYA 5ISUA 3C36A 4LATA 3FIRA 1PC3A 1B9JA 4BDNA 1LCFA 1XS5A 1IIWA 1B51A 3GZGA 3C4MA 3ZS6A 1B6HA 3PUXE 1Y20A 2B65A 3USDA 4IO7A 1QKAA 1LAFE 5ICTA 1QUIA 4O3AA 4NWDA 2VD3A 3MW0A 4Z0IA 1DPPA 1MXWA 1D3KA 3SKPA 4LZ8A 3G3FA 3PPPA 5HM4B 1IQ7A 1IXHA 1IUDA 4F29A 2DYXA 2DE4A 4R6HA 1AMFA 4PFYA 2Q2AA 4MFIA 3OEMA 3IL1B 2DWIA 4G68C 4QF9A 3SDFA 4RK9A 2VD2A 1VE4A 3GBAA 1A7LA 1JEUA 5FHNA 1B1HA 1H45A 3PUWE 3C31A 3HV1A 5I2NB 1M5FA 3HPIA 3Q29A 5AA2D 2H98A 3DLNA 4R2BA 4BDRA 3CVGA 1RKMA 4BDQA 4EF1A 3K6XA 1JEVA 1SW2A 3WAFA 3C35A 2O1MA 2Y84A 4QFLA 3MVWA 3I6VA 4POXA 5I84A 3W15C 4DE8A 3PPNA 4ELPA 5FTIA 1FQBA 1NNKA 2DE2A 3D4CA 1FCKA 3VE1B 3TMGA 3RNNA 2O69A 5FTHA 1N84A 1SYIA 3BFUA 2G93A 4FECA 4L17A 1OQGA 3AXFA 4R6KA 4ZZEA 5I58B 3H06B 2A5SA 1LFHA 1QJMA 1IXGA 5H8NA 1MXYA 3KN7A 4IO5A 3IO6A 3RTWB 4KQPA 5CC2A 2UVHA 1MQHA 2VHAA 4KPTA 5CMCA 2HEUA 2D3IA 1B05A 1DOTA 4H67A 2ZXTA 2QS3A 3FGSA 3G3IA 5K2YA 1AL3A 3TQWA 3H3GA 1IEJA 3UN6A 4BLAA 3EQ1A 1RYOA 1Y3PA 3TKDA 1MPCA 1MRPA 5JTYA 3PUYE 3MJNA 3P7IA 4ZEBA 2F6PA 5BUUA 4QFKA 2XXPA 2CZLA 1B5HA 1UIUA 3TTLA 3V5AA 3MP1A 4ESWA 2GH9A 4LP2B 3S9LC 3FVOA 3QIMA 1LGBC 3R6UA 3K02A 2E1SA 1JVYA 5H8FA 5CMKA 1MQGA 3CFXA 3TZAA 4YU0A 3K1PA 3KSXA 1IXCA 3TTNA 4JSDA 3SEUA 1Y4TA 2REJA 2X26A 1DPEA 5ICQA 4ZZAA 1UTBA 5L9MA 1B58A 3RPWA 4KYSA 4R72A 3CI8A 4H8JA 1A99A 3FVNA 2I0BA 2ZYKA 1FQCA 4FJPA 2G29A 2I4CA 3TPAA 4QFOA 4FATA 1R9QA 4ZEIA 2RCBA 1AH5A 3EPEA 2QMWA 3S9NC 4HS7A 4YKJA 1MPBA 3TFLA 5DVIA 1NNTA 1QKBA 5I59A 3RTFB 3IO4A 3EHUA 2XHDA 4XTCQ 4KI0E 4XXUA 4KYEA 1HSLA 3OSQA 2A5TB 4QFPA 1TWYA 2ZNTA 4E0XA 1QUJA 4JXIA 2AIXA 4OWDA 2AL5A 1MS7A 1Y3NA 2RC7A 3I5OA 2HCAA 1R6ZA 3MP8A 4G2ZA 1MY2A 2Y7RA 4TQUQ 4RYAA 1NH8A 4F3SA 1LSTA 1NKXA 2DWHA 3GBBA 3ECRA 1H76A 1WVJA 4LQ5A 3TODA 4BDLA 4QFNA 1R1NA 3TCHA 1Y4CA 4PETA 1B7UA 3CFLA 4G68B 2VGQA 3PU5A 1VSOA 5J1DA 3T9HB 2HAUA 3DM0A 3T96B 3MAMA 3O28A 3JV9A 1MDP1 2PT1A 4U21A 1HSJA 5KDTA 5DVJA 4TLMB 4OYVA 2V25A 3T22A 3QUFA 3C9HA 4UA8A 3OXNA 2PX1A 4FORA 5ELVA 1VR5A 5EYFA 1R9LA 3K0VA 4RPNA 1CE2A 3PD8A 4BDOA 1US5A 3THIA 4IGRA 2FNCA 3M3KA 4G77A 2ONKE 4WKMA 2Z22A 1TFAA 4H5FA 1FTMA 1TFDA 4Q8RA 2RF1A 1FTLA 4H1XA 2I48A 1B46A 2XXWA 3O6GA 4OFOA 4YKPA 4RK2A 4DLDA 2I3VA 5H8HB 3S4UA 1EZOA 1J1NA 1POTA 4NE4A 3MC2A 3CG1A 2DP8A 4Z7EA 3DELB 5CBSA 2Y7PA 4C0RA 2KLFA 4ISUA 1S50A 2D5WA 2UVJA 4QHQA 4U23A 2Z8FA 2ESNA 4DXCA 1PB9A 1Z7ME 3SETA 3KOTA 1Z7NE 4KFQA 3VXBA 3FV1A 4KHZE 5ITPA 2F7AA 3UIFA 2NOOA 3PPOA 1BTJA 1B4HA 1O64A 1NH7A 3RLFE 2NVUB 3HCQA 2H4IA 2DVCA 1LBCA 1LAXA 4OHNA 3KEIA 5H8FB 5DVFA 1IXIA 3OO6A 4GFRA 3F11A 3W9WA 3A09A 4OFJA 1N76A 2UVIA 2XXTA 2QSXA 1MG1A 1MXZA 3KN8A 3TTMA 4QSDA 3ZKKA 3PUVE 4ZE8A 4ELQA 4N13A 2XXXA 1SW4A 3PMVA 4THIA 1UTBB 2WKYA 4G8HA 2ZNSA 1P1NA 3U92A 3EN3A 2F34A 5CM6A 1H3DA 3JYRA 4OXVA 1FW0A 3U1OA 4ZECA 3DP4A 3TEPA 5I2KB 4Q0CA 1IZ1A 5A5XB 3L6HA 4JWXA 2HFBA 2ZYNA 4RPOA 1TT1A 2DSFA 2Y7IA 1T0KA 3VVEA 3CFZA 5AA2A 3T93B 1B3GA 3UK4A 3ONMA 3LC8A 3O97A 3QUJA 3K6UA 3HO7A 4Q30B 1JNFA 4OERA 4JBZA 4H5GA 3CIJA 4ECFA 3N5LA 5AA3A 3KJTA 1N04A 1YTVA 4XIGQ 5F7VA 4NWCA 3FJMA 4YMBA 2P1SA 2Q88A 3FATA 5AA4A 1I69A 3MZ1A 3BFTA 4F3PA 4NF4B 1GGGA 2XXHA 3K00A 1ZKBA 1LLSA 5K2XA 4X48A 1ZIUA 1M5EA 4OEVA 1MPDA 5DTBA 4ZE9A 3Q28A 3QAXA 1NFTA 1PDAA 3KBRA 2THIA 5KCJB 4PQJA 4JDFA 2OWSA 3HN0A 4RNSA 5I56B 5L9SA 4NMYA 2I0CA 1II5A 5IAIA 2R9JA 3O6HA 4GIZA 4C1UA 1VFEA 4U22A 2M8CA 1UTHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWJ A;  4YKK A;  2F8D A;  2NWJ A;  3VFJ A;  4ZED A;  1D9V A;  2O84 X;  2Q9T A;  3LBS A;  1SD3 A;  2PMS A;  4FE8 A;  2ANJ A;  3ILU B;  2XXV A;  1MQD A;  3E4R A;  3VDF A;  4NTL A;  5TP9 B;  2I4B A;  1N3W A;  3KG2 A;  1A54 A;  3FXR A;  1BKA A;  3O2A A;  3TCF A;  3VVD A;  2RCA A;  4U2R A;  4OEU A;  3TEL A;  1B4Z A;  1D4N A;  4GL8 A;  3LSF B;  4EF2 A;  1OIB A;  2ZMB A;  4GOT A;  1UQW A;  3I3V A;  3PUZ E;  2LAO A;  4RJZ A;  4NF5 B;  1ZLQ A;  3KFM A;  1DSN A;  1XT8 A;  4FEB A;  3C34 A;  3IB0 A;  2V93 A;  1B3L A;  1PB7 A;  4LVQ A;  4ONY A;  1A55 A;  3OEK A;  4F1U A;  1DTZ A;  2R71 A;  1MDQ A;  1JQF A;  5CMM A;  4OEN A;  3RT8 A;  2XD2 A;  3G3G A;  1O7T A;  1B1X A;  2ONR A;  5AE4 A;  3Q27 A;  1SBP A;  3VXC A;  3OO9 A;  1GR2 A;  3KN3 A;  3DP8 A;  2HAV A;  4H65 A;  5FHO A;  1MM7 A;  5DT6 A;  1JET A;  3FD3 A;  4TOZ A;  1B0H A;  1EU8 A;  1N3X A;  4F1V A;  3IB2 A;  2GHA A;  4OES A;  4F3G A;  4LON B;  1Q1K A;  1L5T A;  4I8C A;  1GV8 A;  1I6Q A;  4GLI A;  3TQL A;  3PGF A;  3U93 A;  3D4G A;  4H6D A;  1URD A;  2FA7 A;  1ANF A;  1CB6 A;  1LB8 A;  1FTJ A;  3PD9 A;  1BIY A;  3T9X B;  3IJO B;  1MXV A;  3BKI B;  4PFU A;  5B7D A;  4R73 A;  2X7P A;  3IOR A;  3QXM A;  3SEX A;  2PBW A;  1B40 A;  4DXU A;  1QUL A;  1I6A A;  2IA4 A;  1Y1M A;  3TUS A;  3FUZ A;  1OMP A;  3OEL A;  4MLQ A;  4N6P A;  3V89 B;  3LSL A;  1MH4 A;  2OWT A;  4GD5 A;  4XKP A;  5H8Q A;  1BP5 A;  2QRY A;  3OEN A;  3OSR A;  4O3C A;  3IR1 A;  4F2O A;  2UVG A;  3UGW A;  3UOR A;  2DXR A;  2PT2 A;  1SDX A;  2HXW A;  4YAH X;  3G3H A;  2B3B A;  3T66 A;  1A8E A;  4ZDM A;  2O7U A;  2I49 A;  1B0L A;  5I2N A;  2DVZ A;  4DDD A;  1OVB A;  1ZU0 A;  3KJ7 A;  5HBC A;  4LQ2 A;  1B52 A;  4KCC A;  2RKM A;  4K3F A;  3MZB A;  2REG A;  4X1D A;  1WDN A;  1NNF A;  1PB8 A;  3WAE A;  1FQA A;  3G3J A;  3FJ7 A;  2QL3 A;  3ZSF A;  5TPA A;  1IIT A;  1LFG A;  4PFW A;  2OBG A;  1D9Y A;  5DEX A;  1OVT A;  3E3K A;  4UAC A;  3TAJ A;  1OQH A;  4POW A;  3R26 A;  3UP9 A;  3JZJ A;  4DCX A;  4R6Y A;  3KOS A;  4NF8 A;  4IB2 A;  1EH3 A;  3V83 A;  1A40 A;  5H8N B;  3O66 A;  4NED A;  1FQD A;  4AQ4 A;  4IY5 A;  5JK4 A;  1QW0 A;  1MH3 A;  2H9B A;  1M5C A;  3Q26 A;  4YIC A;  5I58 A;  3MWB A;  1B7H A;  1B2H A;  4F31 B;  3SEY A;  3UA8 A;  3O6I A;  3SES A;  2P2A A;  4OMB A;  1B3F A;  3FV2 A;  3OO8 A;  2UXA A;  2XXU A;  3B6W A;  2B3F A;  1VFD A;  4KR5 A;  3VVF A;  2Q89 A;  2XX8 A;  4EUO A;  5JTY B;  4ZEF A;  2XXR A;  4GXS B;  2QMX A;  3MVX A;  3H4Z A;  2P0S A;  4YZZ A;  3M3F A;  2QPQ A;  2YJP A;  4EDP A;  1H43 A;  4R9G A;  2DQV A;  1DMB A;  3H7M A;  5CMB A;  3KSJ A;  4JSO A;  4N07 A;  4GL0 A;  4H8I A;  2Z8E A;  3K1N A;  2PYY A;  1FTO A;  3C33 A;  3E9X A;  2UYE A;  3LSW A;  3O29 A;  4MBP A;  2VP1 A;  1POY 1;  4YKI A;  3TTK A;  4G8M A;  1P99 A;  3G7W A;  2RC9 A;  3R7X A;  2AL4 A;  2Q2C A;  2GHB A;  1BLF A;  3H03 A;  4GRK A;  4F19 A;  3MPL A;  4LZ7 A;  4Q5T A;  1AIV A;  4OVJ A;  2UYF A;  3IOT A;  3H6U A;  4R75 A;  5EHS A;  3H6V A;  1URG A;  3VLU A;  1HSE A;  5L9O A;  5CBR A;  4GQO A;  5DYH A;  2NUV A;  1DTG A;  4FAJ A;  3KZG A;  2FYI A;  3LR1 A;  1OLC A;  3IAZ A;  3B6T A;  2Y7W A;  4LUB A;  4XKN A;  4RY1 A;  4EQB A;  1FQF A;  2H25 A;  5CI5 A;  4NF6 A;  2ALU A;  1PEB A;  1EZP A;  1LBB A;  4I1D A;  4ZEK A;  1USY E;  2I58 A;  4C1T A;  2ABH A;  1UIV A;  5I59 B;  2ZNU A;  2NXO A;  2OLB A;  1MM6 A;  3HHF A;  3S9E A;  1MY4 A;  3FXU A;  3OO7 A;  4YB6 A;  4BDM A;  5FHM A;  3HHG A;  3N6U A;  4R74 A;  2VOZ A;  3FVG A;  4MH5 A;  4RA1 A;  2DE3 A;  1GTK A;  5F1Q A;  4ZS9 A;  4ELR A;  2A5T A;  1YPN A;  1GVC A;  1MQJ A;  3VLW A;  2Z23 A;  4F2Q A;  3MZ9 A;  1B3E A;  5H8Q B;  1QUK A;  4DCY A;  1SI0 A;  1WOD A;  3RQT A;  1NL5 A;  1FTK A;  4IY6 A;  4U4X A;  4HTG A;  4F18 A;  3IJX B;  2CMO A;  3RY3 A;  1LAH E;  2XX7 A;  3M3L A;  2O51 A;  1XHY A;  3H6W A;  1USY H;  5I57 A;  4JB7 A;  4AB6 A;  3PPR A;  3DP6 A;  4M1V A;  5LOM A;  1YAE A;  3B6Q A;  3Q25 A;  1MY3 A;  3S2V A;  1ELJ A;  2F78 A;  3W9V A;  3QSL A;  5KDT B;  1SVX B;  3N26 A;  3EF7 A;  1EZ9 A;  3ILT B;  4G68 A;  1URS A;  2OZZ A;  3IX1 A;  4M4G A;  1LB9 A;  2Y7K A;  3FAS A;  4HCY A;  4DZ1 A;  3TTR A;  1Y3Q A;  2QJE A;  5TPA B;  4FIM A;  3TYH A;  2F97 A;  5DEX B;  3ODB A;  3C32 A;  4MF3 A;  4TLL B;  4NF8 B;  1Y1Z A;  1LFI A;  2V3Q A;  1SW5 A;  4OFL A;  1AOV A;  1B7Z A;  4FED A;  2ZYO A;  4ELO A;  4QSE A;  5IKB A;  2OCU A;  3MPK A;  4PFT A;  2HZK A;  4WED A;  4OTE A;  1XOC A;  2O7I A;  4R2F A;  3U94 A;  2DWA A;  1H44 A;  3G3K A;  2OK2 A;  5KZT A;  3A3C A;  2F7C A;  4U1O A;  4ND9 A;  2HQ0 A;  4IO6 A;  1QVS A;  4YB5 A;  5H8H A;  3SEV A;  1RYX A;  1ZMG A;  4GVO A;  4JWO A;  3VV5 A;  2W7Y A;  2XXY A;  1MXU A;  2H5Y A;  1XVX A;  2PVU A;  3CG3 A;  3MUQ A;  1Q35 A;  2RC8 A;  4DIG A;  3CSB A;  3RUM A;  4X9T A;  3T9U A;  3K4U A;  4G8N A;  1ATG A;  3V8X B;  2IEE A;  3CR9 A;  3LUY A;  2H99 A;  1SQY A;  1TXF A;  5M2V A;  2E0S A;  3T9V A;  3OOA A;  2DS9 A;  3SER A;  2XD3 A;  4I62 A;  3GXA A;  3BBR A;  2V84 A;  3HST A;  5TU0 A;  2ONS A;  4YMA A;  2F5X A;  4O3B A;  2F36 A;  4AB5 A;  1NMU A;  3TDJ A;  5JEI A;  1JW1 A;  2RIN A;  4HW8 A;  1ZTY A;  1P1O A;  2HZL A;  4E0W A;  3K01 A;  2D21 A;  5BWJ A;  5B70 A;  1P1Q A;  1P1U A;  5AA1 A;  4NF6 B;  2F7B A;  3EHS A;  3GLB A;  1KWH A;  2YLN A;  2QS2 A;  5ITO A;  1US4 A;  5AA2 B;  3FZV A;  1MY0 A;  3MVZ A;  3ZKL A;  2XX9 A;  5I2K A;  3IOW A;  3O9P A;  4P0G A;  1SI1 A;  3RT6 B;  5A5X A;  1OLA A;  2X7Q A;  1PBQ A;  3N6T A;  1B5I A;  1B32 A;  1ZBM A;  1XC1 A;  2Z8D A;  3MVY A;  1B5J A;  1F9B A;  3MQ9 A;  4F1Y A;  3A3U A;  4LA9 A;  2AYS A;  3IOV A;  5CRY A;  4WEP A;  2XXI A;  3K6V A;  4QSC A;  1M5B A;  3H6T A;  5AA4 B;  3PPQ A;  4PP0 A;  2GFE A;  4GWO A;  1NNP A;  1JW4 A;  2R6G E;  4G4P A;  3VLV A;  1O63 A;  1LCT A;  3FXQ A;  1M5D A;  4IO3 A;  3N94 A;  2XXQ A;  3RN8 A;  3PV0 E;  3U8Q A;  1MY1 A;  2I6E A;  5I57 B;  4NF4 A;  3FVK A;  1N7X A;  2ZYM A;  3S9M C;  4XKQ A;  1XVY A;  3QK6 A;  1P1W A;  4OET A;  4JWY A;  4H0W A;  2DOJ A;  5KCJ A;  4KYD A;  5I56 A;  2O6A A;  3OMB A;  1JVX A;  1LAG E;  2BJJ X;  5EHM A;  1PBP A;  4MLV A;  3K6W A;  1UTH A;  3QYT A;  4OQO A;  4P0I A;  4QRZ A;  1A8F A;  1N0T A;  2I3W A;  3B7D A;  1YCJ A;  3MP6 A;  3FJG A;  4GF8 A;  4LZ5 A;  1N7W A;  3OD7 A;  2F6G A;  4KD5 A;  2GRV A;  4U1Z A;  3IK6 B;  4I9D A;  3IOU A;  3K2D A;  4R9F A;  5TP9 A;  2F35 A;  5H8S A;  5L8D A;  4PE5 B;  5HPQ A;  3CRB A;  4F3B A;  3LSX A;  1JW5 A;  1B3H A;  2QS4 A;  2O1L A;  3IB1 A;  3MBP A;  2QS1 A;  3CSG A;  4GXA A;  1S9T A;  4WXJ A;  2OJT A;  4XKR A;  4IGT A;  3TCG A;  1MXX A;  4DXB A;  3M8U A;  3SEW A;  4EQ7 A;  4NF5 A;  4F39 A;  1SYH A;  4IO2 A;  2YPN A;  4OZ9 A;  3L6G A;  3PMX A;  4KCD A;  2Q8J A;  4ESX A;  4EXL A;  1FQE A;  1S7Y A;  2O68 A;  4EXK A;  1ZJL A;  4X1B A;  3EHT A;  2V3T A;  3PMW A;  3E13 X;  3KGC A;  3U72 A;  1Y9U A;  2DXY A;  3K1M A;  1SW1 A;  4P11 A;  2V3U A;  4U4S A;  4RXL A;  1MQI A;  4YB7 A;  4EQ9 A;  1I6B A;  4IO4 A;  4HCW A;  4F22 A;  3RGY A;  5ISU A;  3C36 A;  4LAT A;  3FIR A;  1PC3 A;  1B9J A;  4BDN A;  1LCF A;  1XS5 A;  1IIW A;  1B51 A;  3GZG A;  3C4M A;  3ZS6 A;  1B6H A;  3PUX E;  1Y20 A;  2B65 A;  3USD A;  4IO7 A;  1QKA A;  1LAF E;  5ICT A;  1QUI A;  4O3A A;  4NWD A;  2VD3 A;  3MW0 A;  4Z0I A;  1DPP A;  1MXW A;  1D3K A;  3SKP A;  4LZ8 A;  3G3F A;  3PPP A;  5HM4 B;  1IQ7 A;  1IXH A;  1IUD A;  4F29 A;  2DYX A;  2DE4 A;  4R6H A;  1AMF A;  4PFY A;  2Q2A A;  4MFI A;  3OEM A;  3IL1 B;  2DWI A;  4G68 C;  4QF9 A;  3SDF A;  4RK9 A;  2VD2 A;  1VE4 A;  3GBA A;  1A7L A;  1JEU A;  5FHN A;  1B1H A;  1H45 A;  3PUW E;  3C31 A;  3HV1 A;  5I2N B;  1M5F A;  3HPI A;  3Q29 A;  5AA2 D;  2H98 A;  3DLN A;  4R2B A;  4BDR A;  3CVG A;  1RKM A;  4BDQ A;  4EF1 A;  3K6X A;  1JEV A;  1SW2 A;  3WAF A;  3C35 A;  2O1M A;  2Y84 A;  4QFL A;  3MVW A;  3I6V A;  4POX A;  5I84 A;  3W15 C;  4DE8 A;  3PPN A;  4ELP A;  5FTI A;  1FQB A;  1NNK A;  2DE2 A;  3D4C A;  1FCK A;  3VE1 B;  3TMG A;  3RNN A;  2O69 A;  5FTH A;  1N84 A;  1SYI A;  3BFU A;  2G93 A;  4FEC A;  4L17 A;  1OQG A;  3AXF A;  4R6K A;  4ZZE A;  5I58 B;  3H06 B;  2A5S A;  1LFH A;  1QJM A;  1IXG A;  5H8N A;  1MXY A;  3KN7 A;  4IO5 A;  3IO6 A;  3RTW B;  4KQP A;  5CC2 A;  2UVH A;  1MQH A;  2VHA A;  4KPT A;  5CMC A;  2HEU A;  2D3I A;  1B05 A;  1DOT A;  4H67 A;  2ZXT A;  2QS3 A;  3FGS A;  3G3I A;  5K2Y A;  1AL3 A;  3TQW A;  3H3G A;  1IEJ A;  3UN6 A;  4BLA A;  3EQ1 A;  1RYO A;  1Y3P A;  3TKD A;  1MPC A;  1MRP A;  5JTY A;  3PUY E;  3MJN A;  3P7I A;  4ZEB A;  2F6P A;  5BUU A;  4QFK A;  2XXP A;  2CZL A;  1B5H A;  1UIU A;  3TTL A;  3V5A A;  3MP1 A;  4ESW A;  2GH9 A;  4LP2 B;  3S9L C;  3FVO A;  3QIM A;  1LGB C;  3R6U A;  3K02 A;  2E1S A;  1JVY A;  5H8F A;  5CMK A;  1MQG A;  3CFX A;  3TZA A;  4YU0 A;  3K1P A;  3KSX A;  1IXC A;  3TTN A;  4JSD A;  3SEU A;  1Y4T A;  2REJ A;  2X26 A;  1DPE A;  5ICQ A;  4ZZA A;  1UTB A;  5L9M A;  1B58 A;  3RPW A;  4KYS A;  4R72 A;  3CI8 A;  4H8J A;  1A99 A;  3FVN A;  2I0B A;  2ZYK A;  1FQC A;  4FJP A;  2G29 A;  2I4C A;  3TPA A;  4QFO A;  4FAT A;  1R9Q A;  4ZEI A;  2RCB A;  1AH5 A;  3EPE A;  2QMW A;  3S9N C;  4HS7 A;  4YKJ A;  1MPB A;  3TFL A;  5DVI A;  1NNT A;  1QKB A;  5I59 A;  3RTF B;  3IO4 A;  3EHU A;  2XHD A;  4XTC Q;  4KI0 E;  4XXU A;  4KYE A;  1HSL A;  3OSQ A;  2A5T B;  4QFP A;  1TWY A;  2ZNT A;  4E0X A;  1QUJ A;  4JXI A;  2AIX A;  4OWD A;  2AL5 A;  1MS7 A;  1Y3N A;  2RC7 A;  3I5O A;  2HCA A;  1R6Z A;  3MP8 A;  4G2Z A;  1MY2 A;  2Y7R A;  4TQU Q;  4RYA A;  1NH8 A;  4F3S A;  1LST A;  1NKX A;  2DWH A;  3GBB A;  3ECR A;  1H76 A;  1WVJ A;  4LQ5 A;  3TOD A;  4BDL A;  4QFN A;  1R1N A;  3TCH A;  1Y4C A;  4PET A;  1B7U A;  3CFL A;  4G68 B;  2VGQ A;  3PU5 A;  1VSO A;  5J1D A;  3T9H B;  2HAU A;  3DM0 A;  3T96 B;  3MAM A;  3O28 A;  3JV9 A;  1MDP 1;  2PT1 A;  4U21 A;  1HSJ A;  5KDT A;  5DVJ A;  4TLM B;  4OYV A;  2V25 A;  3T22 A;  3QUF A;  3C9H A;  4UA8 A;  3OXN A;  2PX1 A;  4FOR A;  5ELV A;  1VR5 A;  5EYF A;  1R9L A;  3K0V A;  4RPN A;  1CE2 A;  3PD8 A;  4BDO A;  1US5 A;  3THI A;  4IGR A;  2FNC A;  3M3K A;  4G77 A;  2ONK E;  4WKM A;  2Z22 A;  1TFA A;  4H5F A;  1FTM A;  1TFD A;  4Q8R A;  2RF1 A;  1FTL A;  4H1X A;  2I48 A;  1B46 A;  2XXW A;  3O6G A;  4OFO A;  4YKP A;  4RK2 A;  4DLD A;  2I3V A;  5H8H B;  3S4U A;  1EZO A;  1J1N A;  1POT A;  4NE4 A;  3MC2 A;  3CG1 A;  2DP8 A;  4Z7E A;  3DEL B;  5CBS A;  2Y7P A;  4C0R A;  2KLF A;  4ISU A;  1S50 A;  2D5W A;  2UVJ A;  4QHQ A;  4U23 A;  2Z8F A;  2ESN A;  4DXC A;  1PB9 A;  1Z7M E;  3SET A;  3KOT A;  1Z7N E;  4KFQ A;  3VXB A;  3FV1 A;  4KHZ E;  5ITP A;  2F7A A;  3UIF A;  2NOO A;  3PPO A;  1BTJ A;  1B4H A;  1O64 A;  1NH7 A;  3RLF E;  2NVU B;  3HCQ A;  2H4I A;  2DVC A;  1LBC A;  1LAX A;  4OHN A;  3KEI A;  5H8F B;  5DVF A;  1IXI A;  3OO6 A;  4GFR A;  3F11 A;  3W9W A;  3A09 A;  4OFJ A;  1N76 A;  2UVI A;  2XXT A;  2QSX A;  1MG1 A;  1MXZ A;  3KN8 A;  3TTM A;  4QSD A;  3ZKK A;  3PUV E;  4ZE8 A;  4ELQ A;  4N13 A;  2XXX A;  1SW4 A;  3PMV A;  4THI A;  1UTB B;  2WKY A;  4G8H A;  2ZNS A;  1P1N A;  3U92 A;  3EN3 A;  2F34 A;  5CM6 A;  1H3D A;  3JYR A;  4OXV A;  1FW0 A;  3U1O A;  4ZEC A;  3DP4 A;  3TEP A;  5I2K B;  4Q0C A;  1IZ1 A;  5A5X B;  3L6H A;  4JWX A;  2HFB A;  2ZYN A;  4RPO A;  1TT1 A;  2DSF A;  2Y7I A;  1T0K A;  3VVE A;  3CFZ A;  5AA2 A;  3T93 B;  1B3G A;  3UK4 A;  3ONM A;  3LC8 A;  3O97 A;  3QUJ A;  3K6U A;  3HO7 A;  4Q30 B;  1JNF A;  4OER A;  4JBZ A;  4H5G A;  3CIJ A;  4ECF A;  3N5L A;  5AA3 A;  3KJT A;  1N04 A;  1YTV A;  4XIG Q;  5F7V A;  4NWC A;  3FJM A;  4YMB A;  2P1S A;  2Q88 A;  3FAT A;  5AA4 A;  1I69 A;  3MZ1 A;  3BFT A;  4F3P A;  4NF4 B;  1GGG A;  2XXH A;  3K00 A;  1ZKB A;  1LLS A;  5K2X A;  4X48 A;  1ZIU A;  1M5E A;  4OEV A;  1MPD A;  5DTB A;  4ZE9 A;  3Q28 A;  3QAX A;  1NFT A;  1PDA A;  3KBR A;  2THI A;  5KCJ B;  4PQJ A;  4JDF A;  2OWS A;  3HN0 A;  4RNS A;  5I56 B;  5L9S A;  4NMY A;  2I0C A;  1II5 A;  5IAI A;  2R9J A;  3O6H A;  4GIZ A;  4C1U A;  1VFE A;  4U22 A;  2M8C A;  1UTH B; 
#chains in the Genus database with same CATH topology
 4NHB A;  2DWJ A;  4YKK A;  2F8D A;  2NWJ A;  3VFJ A;  4OVR A;  3FXB A;  5F24 A;  4ZED A;  1D9V A;  1WHQ A;  3RPL A;  2O84 X;  2Q9T A;  4GEQ B;  3LBS A;  1SD3 A;  5AE2 A;  2EPK X;  2PMS A;  1NV7 A;  4FE8 A;  2YTP A;  2ANJ A;  1PJS A;  3ILU B;  2XXV A;  1MQD A;  3E4R A;  3VDF A;  4NTL A;  2ODR D;  2EPN A;  3BID A;  5TP9 B;  2I4B A;  1FPL A;  1N3W A;  2EMF A;  1YFH A;  3KG2 A;  1UHZ A;  2EMG A;  1A54 A;  3FXR A;  4LF7 E;  1BKA A;  3O2A A;  3TCF A;  5F3W A;  3VVD A;  2RCA A;  3ADL A;  4U2R A;  4PAI A;  4OEU A;  3TEL A;  4JI6 E;  1WJP A;  1B4Z A;  1D4N A;  2EM4 A;  1UN6 B;  4GL8 A;  2YT4 A;  4LF4 E;  4P78 A;  3LSF B;  4EF2 A;  1T39 A;  1OIB A;  2ZMB A;  4GOT A;  4NAP A;  1LBX A;  3KZZ A;  5IWA E;  1UBD C;  2L2K B;  1UQW A;  1KA0 A;  2EWL A;  3I3V A;  3PUZ E;  2LAO A;  4RJZ A;  4NF5 B;  1NV1 A;  1ZLQ A;  3KFM A;  1P47 A;  1DSN A;  1XT8 A;  4FEB A;  3C34 A;  3IB0 A;  2HPG A;  2V93 A;  2WBU A;  1B3L A;  1PB7 A;  2HGH A;  4LVQ A;  2YTN A;  4LF9 E;  4ONY A;  1A55 A;  3OEK A;  4N8G A;  5EQ8 A;  4F1U A;  4PGP A;  4R2E A;  1DTZ A;  2R71 A;  1MDQ A;  4PDD A;  1JQF A;  2L3J A;  5CMM A;  4OEN A;  3RT8 A;  2XD2 A;  1FPB A;  2LT7 A;  3G3G A;  1HNX E;  1FPG A;  1O7T A;  1B1X A;  2ONR A;  5AE4 A;  3Q27 A;  1SBP A;  4F54 A;  2UUC E;  4OVP A;  2LUQ A;  4JVC A;  5KL5 A;  2EM9 A;  4WX9 A;  1FKA E;  3VXC A;  4O94 A;  2KQZ A;  2EJ4 A;  3J80 C;  5AC5 A;  3OO9 A;  1GR2 A;  3KN3 A;  3DP8 A;  2HAV A;  4H65 A;  5FHO A;  4TUI A;  4DR6 E;  2WEF A;  2B9D A;  1MM7 A;  4DV3 E;  4G61 A;  5DT6 A;  2EN1 A;  1JET A;  3MSW A;  3FD3 A;  4TOZ A;  2YWQ A;  5LL6 R;  4GWW A;  1B0H A;  1EU8 A;  2YU5 A;  1N3X A;  4NG7 A;  1X47 A;  4F1V A;  2LRS A;  2GHA A;  3IB2 A;  4OES A;  4F3G A;  4LON B;  1Q1K A;  1L5T A;  4I8C A;  1GV8 A;  1I6Q A;  4GLI A;  2VE7 C;  3TQL A;  3J81 C;  3PGF A;  3U93 A;  2LJU A;  4LFB E;  3D4G A;  4H6D A;  1URD A;  2FA7 A;  1ANF A;  2M9A A;  1CB6 A;  1LB8 A;  4BCA A;  1FTJ A;  2DIX A;  3PD9 A;  4P1E A;  1BIY A;  3T9X B;  2ZZW A;  3IJO B;  1MXV A;  3BKI B;  4PFU A;  4N91 A;  2ENH A;  5B7D A;  4R73 A;  1KA1 A;  2X7P A;  3IOR A;  3OML A;  3QXM A;  3SEX A;  2PBW A;  1B40 A;  4H45 A;  3ISP A;  2EPU A;  4DXU A;  1QUL A;  1I6A A;  1UIL A;  2JOB A;  2IA4 A;  1Y1M A;  2EL5 A;  2KR0 A;  3TUS A;  3FUZ A;  1OMP A;  4NF0 A;  3OEL A;  4MLQ A;  4N6P A;  3V89 B;  3LSL A;  1MH4 A;  3BBG A;  2OWT A;  4GD5 A;  4XKP A;  5H8Q A;  1XMO E;  1BP5 A;  2QRY A;  3OEN A;  3OSR A;  1IME A;  4O3C A;  5A6A A;  3IR1 A;  4XFE A;  2WYK A;  4F2O A;  2UVG A;  3UGW A;  3UOR A;  1IMU A;  2DXR A;  3E79 A;  2PT2 A;  1SDX A;  2EOM A;  5DW8 A;  1X6E A;  2HXW A;  4GWU A;  4YAH X;  5IGA A;  3G3H A;  3VHT B;  4PF8 A;  2RQL A;  2B3B A;  3T66 A;  1A8E A;  4ZDM A;  2O7U A;  2I49 A;  2YTQ A;  1B0L A;  5I2N A;  2DVZ A;  4DDD A;  1OVB A;  1ZU0 A;  3KJ7 A;  5HBC A;  4KWY A;  4I40 A;  1N34 E;  4LQ2 A;  1B52 A;  4KCC A;  1DI2 A;  2RKM A;  4K3F A;  3MZB A;  4MMP A;  2B7T A;  4WXD A;  2YTE A;  2REG A;  4X1D A;  2YTF A;  1WDN A;  1NNF A;  2EMW A;  1PB8 A;  3WAE A;  1FQA A;  3G3J A;  3FJ7 A;  1LEV A;  2QL3 A;  2OX3 A;  3ZSF A;  4F6N A;  2RS6 A;  5ET7 A;  5TPA A;  1IIT A;  2EL6 A;  4ZYE A;  1LFG A;  4PFW A;  4KHP E;  2OBG A;  1D9Y A;  5DEX A;  1OVT A;  2EPP A;  3E3K A;  4UAC A;  4DKK A;  3TAJ A;  1OQH A;  4POW A;  2V8Q B;  3R26 A;  3UP9 A;  3JZJ A;  4R6Y A;  4DCX A;  4Q28 A;  2KON A;  3KOS A;  4R2S A;  1EH3 A;  4IB2 A;  4N8Y A;  2EOS A;  4NF8 A;  3V83 A;  4PFB A;  1FPD A;  5AE1 A;  1A40 A;  5H8N B;  3O66 A;  4NED A;  1FQD A;  4AQ4 A;  4IY5 A;  5JK4 A;  1FBG A;  1QW0 A;  2WYP A;  3IWD A;  1MH3 A;  4O4K A;  2H9B A;  1M5C A;  3Q26 A;  5IV8 B;  4YIC A;  2VQE E;  5I58 A;  2NA2 A;  3MWB A;  1B7H A;  1NUW A;  1ZR9 A;  1B2H A;  4F31 B;  3SEY A;  3UA8 A;  2YTG A;  3VYX A;  3O6I A;  3SES A;  4XF5 A;  2CPN A;  2FIX A;  2P2A A;  4OMB A;  1B3F A;  2RS7 A;  3HTX A;  3FV2 A;  3OO8 A;  2UXA A;  2XXU A;  5AE3 A;  3B6W A;  2B3F A;  2CT1 A;  4GX3 A;  1VFD A;  4KR5 A;  3VVF A;  2Q89 A;  4O7M A;  2XX8 A;  4EUO A;  4R2C A;  5JTY B;  4ZEF A;  2XXR A;  2VRD A;  4GXS B;  2QMX A;  3MVX A;  3H4Z A;  2EPM X;  2P0S A;  4YZZ A;  3M3F A;  2QPQ A;  2YJP A;  3CHG A;  2YTI A;  4EDP A;  1H43 A;  4R9G A;  2YZT A;  2DQV A;  1DMB A;  3JU0 A;  3H7M A;  4BBY A;  3KBZ A;  5CMB A;  1O0W A;  3KSJ A;  4JSO A;  4N07 A;  4GL0 A;  4H8I A;  2Z8E A;  4MEV A;  3K1N A;  2PYY A;  1FTO A;  3C33 A;  3J7A G;  3E9X A;  3IWB A;  2CSH A;  2UYE A;  3LSW A;  2JWO A;  3O29 A;  4MBP A;  2VP1 A;  2E1M A;  1POY 1;  1NV0 A;  4YKI A;  3TTK A;  4G8M A;  2QFL A;  1P99 A;  3G7W A;  2RC9 A;  3R7X A;  2AL4 A;  2Q2C A;  2GHB A;  1BLF A;  3H03 A;  4GRK A;  2YTO A;  4F19 A;  3MPL A;  4PFI A;  1KZ8 A;  4LZ7 A;  2EM5 A;  2JXP A;  4Q5T A;  4OVJ A;  1AIV A;  2UYF A;  4N81 A;  1STU A;  3IOT A;  3H6U A;  4R75 A;  5EHS A;  3H6V A;  1URG A;  3VLU A;  1HSE A;  1X6F A;  5L9O A;  5CBR A;  4GQO A;  4N15 A;  1IMB A;  4LFA E;  5DYH A;  2MKD A;  2EOR A;  2NUV A;  1DTG A;  4FAJ A;  4N4R B;  3KZG A;  2FYI A;  3LR1 A;  1OLC A;  2EOJ A;  3IAZ A;  1X48 A;  2Y7W A;  3B6T A;  3C4T A;  4LUB A;  4XKN A;  4RY1 A;  4EQB A;  4ZYD A;  1FQF A;  4JI4 E;  2H25 A;  1ZBQ A;  5CI5 A;  4NF6 A;  2ALU A;  1PEB A;  1EZP A;  1LBB A;  4I1D A;  4ZEK A;  1USY E;  2I58 A;  4HE0 A;  2JY9 A;  4C1T A;  2EM7 A;  1UIV A;  2ABH A;  5I59 B;  2ZNU A;  2NXO A;  2OLB A;  1MM6 A;  3HHF A;  3S9E A;  1MY4 A;  3FXU A;  3OO7 A;  4YB6 A;  4BDM A;  5FHM A;  3IFC A;  2Y5K A;  2LE2 A;  3HHG A;  2EOY A;  1YUI A;  3N6U A;  4R74 A;  2VOZ A;  3FVG A;  4MH5 A;  4RA1 A;  2VT5 A;  2DE3 A;  1GTK A;  2V87 A;  5F1Q A;  2DSY A;  3MST A;  2EMB A;  1XNQ E;  2R1F A;  4ZS9 A;  4ELR A;  2A5T A;  1YPN A;  1GVC A;  1MQJ A;  4FK5 C;  1T4L B;  3VLW A;  2B7V A;  2Z23 A;  4F2Q A;  2R8T A;  3MZ9 A;  1B3E A;  5H8Q B;  2EOF A;  1QUK A;  4DCY A;  1SI0 A;  2XA5 A;  1WOD A;  2EM8 A;  3RQT A;  1NL5 A;  1L4S A;  1FTK A;  4IY6 A;  4U4X A;  4HTG A;  1B69 A;  4R03 A;  4F18 A;  1YYK A;  4LFC E;  2EZ6 A;  2CMO A;  3IJX B;  2J7J A;  3RY3 A;  3LLH A;  1GZ6 A;  1LAH E;  2XX7 A;  4GX6 A;  3M3L A;  2EML A;  2O51 A;  1XHY A;  3H6W A;  4NQ8 A;  2EP3 A;  4PE3 A;  1USY H;  5I57 A;  1JK2 A;  2FVZ A;  4JB7 A;  4AB6 A;  3PPR A;  1IMA A;  3DP6 A;  4M1V A;  2GLI A;  4NN3 A;  5LOM A;  1YAE A;  3B6Q A;  2YTJ A;  4OVT A;  5KL4 A;  1LBW A;  4P47 A;  3Q25 A;  1K9Y A;  1EH7 A;  1MY3 A;  3S2V A;  3BGH A;  2L92 A;  1ELJ A;  2F78 A;  2F3B A;  3W9V A;  3QSL A;  5KDT B;  1SVX B;  2R76 A;  3N26 A;  3EF7 A;  1EZ9 A;  4M2Z A;  2CZI A;  3ILT B;  4G68 A;  4PFR A;  1URS A;  2OZZ A;  1FBF A;  1A1J A;  3IX1 A;  4M4G A;  2EM0 A;  1LB9 A;  2Y7K A;  3FAS A;  4HCY A;  2PRT A;  4DZ1 A;  3ADI A;  3TTR A;  1Y3Q A;  2QJE A;  5TPA B;  4FIM A;  3TYH A;  2F97 A;  5DEX B;  3ODB A;  2WBD A;  3C32 A;  4MF3 A;  4TLL B;  4NF8 B;  1RDX A;  2EN3 A;  4HEI A;  1Y1Z A;  4OAN A;  4KXP A;  2EN4 A;  1LFI A;  2V3Q A;  1X5W A;  5BR8 E;  1SW5 A;  4OFL A;  2B4M A;  1AOV A;  1B7Z A;  4FED A;  3C6M A;  2ZYO A;  4ELO A;  4QSE A;  5IKB A;  2BB8 A;  2OCU A;  3MPK A;  1DGC A;  4PFT A;  2HZK A;  4WED A;  4L8N A;  4OTE A;  1XOC A;  4BS9 A;  1N33 E;  1NUZ A;  2O7I A;  4R2F A;  3U94 A;  2DWA A;  1H44 A;  3G3K A;  2OK2 A;  2HHH E;  5KZT A;  2LBS B;  2NUF A;  3A3C A;  2F7C A;  4U1O A;  4ND9 A;  2HQ0 A;  3FBP A;  1GQE A;  2RPC A;  2EMX A;  4HXV A;  1QU6 A;  1F2I G;  4IO6 A;  2EOI A;  1QVS A;  4YB5 A;  5H8H A;  3SEV A;  1RYX A;  4I8O A;  2EPL X;  4YHH E;  1ZMG A;  4I3Y A;  3TQM A;  2EPX A;  1NV4 A;  5A6K A;  4GVO A;  4PBQ A;  4JWO A;  2EOZ A;  1RDZ A;  3VV5 A;  2W7Y A;  2GHF A;  2XXY A;  1MXU A;  2H5Y A;  1XVX A;  2PVU A;  3CG3 A;  3MUQ A;  1Q35 A;  2LUP B;  2RC8 A;  4JI3 E;  2PCR A;  1I94 E;  1EYK A;  4OOG C;  5A2Q C;  4DIG A;  1NV2 A;  3CSB A;  3P1X A;  3RUM A;  3HFU A;  4X9T A;  3T9U A;  3K4U A;  4G8N A;  1ATG A;  4DI3 D;  3EPH A;  3V8X B;  2IEE A;  3M99 B;  3CR9 A;  3LUY A;  2H99 A;  1SQY A;  2HC5 A;  4DV0 E;  1TXF A;  5M2V A;  2E0S A;  2DDK A;  3T9V A;  3OOA A;  1FBC A;  2DS9 A;  3SER A;  2V4C A;  2XD3 A;  4I62 A;  3GXA A;  2LV2 A;  2RSM A;  3BBR A;  2V84 A;  3HST A;  5TU0 A;  2ONS A;  4YMA A;  2F5X A;  2EOQ A;  4O3B A;  2F8B A;  3VYY A;  2F36 A;  4P9K A;  4AB5 A;  1NMU A;  3TDJ A;  5JEI A;  4X65 E;  1JW1 A;  2EMI A;  2RIN A;  4HW8 A;  1JK1 A;  5IZ3 B;  2VQF E;  1ZTY A;  2E5L E;  4O5G A;  1P1O A;  2HZL A;  4E0W A;  3K01 A;  1FTA A;  2D21 A;  5BWJ A;  1EYI A;  5B70 A;  4GKJ E;  4MHF A;  1P1Q A;  2CTD A;  1P1U A;  3D1R A;  5AA1 A;  4NF6 B;  1MEY C;  1RDY A;  1IBL E;  2F7B A;  3EHS A;  1KWH A;  3GLB A;  3GYY A;  2MDR A;  2YLN A;  2E72 A;  2QS2 A;  2VPO A;  4KZS A;  5ITO A;  1BBG A;  4WSG A;  3C4B A;  3EPJ A;  1US4 A;  5AA2 B;  1MGT A;  3FZV A;  1RQ0 A;  1MY0 A;  3MVZ A;  3ZKL A;  1CNQ A;  2XX9 A;  4JI1 E;  5I2K A;  3IOW A;  3O9P A;  2V85 A;  4P0G A;  1SI1 A;  3RT6 B;  5A5X A;  1OLA A;  2X7Q A;  1PBQ A;  3N6T A;  4X62 E;  1B5I A;  5EQ7 A;  1B32 A;  1ZBM A;  1XC1 A;  5LMN E;  2Z8D A;  4MJO A;  4PF6 A;  2DLQ A;  2D9H A;  4DMI A;  3MVY A;  4O24 A;  4B3R E;  1B5J A;  1F9B A;  3MQ9 A;  2DMI A;  1YUJ A;  4F1Y A;  3A3U A;  1T38 A;  4PDH A;  4LA9 A;  2AYS A;  3IOV A;  1N32 E;  2HXR A;  4HE1 A;  5CRY A;  4WEP A;  2EN7 A;  2XXI A;  3IFA A;  3K6V A;  4QSC A;  1M5B A;  4GWY A;  4P56 A;  1N36 E;  3H6T A;  5AA4 B;  3PPQ A;  4PP0 A;  2GFE A;  4GWO A;  4YY3 E;  1NNP A;  1JW4 A;  2N8X A;  4JYA E;  3ADG A;  2R6G E;  4G4P A;  4R2R A;  3VLV A;  3HQ1 A;  2MKN A;  1O63 A;  1LCT A;  2I9I A;  3FXQ A;  1M5D A;  4IO3 A;  3N94 A;  2XXQ A;  3RN8 A;  1YZ9 A;  4MNI A;  3PV0 E;  3U8Q A;  1MY1 A;  4DR3 E;  2I6E A;  5I57 B;  4NF4 A;  3L00 A;  3FVK A;  1N7X A;  2ZYM A;  3S9M C;  4XKQ A;  1XVY A;  5A6J A;  3QK6 A;  1P1W A;  2Q8M A;  4OET A;  1FPI A;  4JWY A;  3ADJ A;  4H0W A;  2DOJ A;  2XXK A;  5KCJ A;  3C6K A;  4KYD A;  4DR4 E;  1IMD A;  4B3S E;  2O6A A;  3OMB A;  5I56 A;  1JVX A;  3F6G A;  1LAG E;  2BJJ X;  3T1Y E;  5ET6 A;  4MAG A;  5EHM A;  2EM2 A;  1PBP A;  2HHM A;  3RPL B;  4ZYG A;  4MLV A;  3K6W A;  4X66 E;  4PTK A;  1UTH A;  3QYT A;  2UXC E;  4OQO A;  1NV3 A;  4P0I A;  4QRZ A;  2L2N A;  3AUZ A;  5T6J A;  1FBD A;  2A25 A;  1A8F A;  2NUE A;  1N0T A;  2I3W A;  3B7D A;  2L2M A;  2QVU A;  1YCJ A;  3MP6 A;  4LN5 A;  3FJG A;  4GF8 A;  4LZ5 A;  1N7W A;  2ZM6 E;  3OD7 A;  2L33 A;  2F6G A;  3DJW A;  4KD5 A;  3RMP A;  2GRV A;  1WRJ A;  4U1Z A;  3IK6 B;  4I9D A;  4JV5 E;  4PC9 A;  2YTD A;  3IOU A;  3K2D A;  2LCE A;  4R9F A;  2EOH A;  4GBV A;  2WX9 A;  5TP9 A;  2F35 A;  4DV2 E;  4OA4 A;  1NCS A;  5H8S A;  5L8D A;  1K9Z A;  5IT9 C;  4K0K E;  4PE5 B;  5HPQ A;  3CRB A;  1DQ3 A;  4F3B A;  3LSX A;  1JW5 A;  4DR7 E;  1B3H A;  2QS4 A;  3RYD A;  2O1L A;  2UUB E;  3IB1 A;  3MBP A;  2QS1 A;  2P3V A;  4AS5 A;  3CSG A;  4GXA A;  4X64 E;  1S9T A;  4GBW A;  5AAS A;  4WXJ A;  2OJT A;  5A6B D;  5LLQ A;  1LBZ A;  4XKR A;  4IGT A;  3TCG A;  4MX6 A;  1MXX A;  4DXB A;  2EM6 A;  3M8U A;  3SEW A;  4EQ7 A;  1T4N A;  1KJK A;  4NF5 A;  2VF1 A;  3LV0 A;  1T4O A;  4F39 A;  1SYH A;  4IO2 A;  4HE2 A;  2YPN A;  4OZ9 A;  3L6G A;  2OWZ A;  3PMX A;  4KCD A;  5FLX C;  2YSO A;  4DR1 E;  2PFY A;  2Q8J A;  1RC7 A;  1NI9 A;  5TSE A;  4ESX A;  4EXL A;  1FJ6 A;  4FBP A;  1FQE A;  1S7Y A;  3OTO E;  2O68 A;  4EXK A;  1X3C A;  1ZJL A;  4GX4 A;  4X1B A;  3EHT A;  2V3T A;  3PMW A;  4NGU A;  3E13 X;  3KGC A;  3U72 A;  1Y9U A;  2DXY A;  1PJQ A;  1X6H A;  4MCO A;  2NAB A;  3K1M A;  1HNZ E;  1SW1 A;  1FBH A;  5I5P A;  4P11 A;  3J7Y p;  2V3U A;  1FRP A;  4U4S A;  4F6M A;  2CZK A;  1MQI A;  4RXL A;  4YB7 A;  4EQ9 A;  1I6B A;  4IO4 A;  1FPJ A;  1LBY A;  1DCU A;  4HCW A;  2DGC A;  4F9A B;  4F22 A;  3RGY A;  3KC0 A;  1KYQ A;  5ISU A;  3C36 A;  2M1S A;  2JOX A;  3B8B A;  4LAT A;  3FIR A;  1PC3 A;  1B9J A;  1J26 A;  1YYZ A;  4BDN A;  1LCF A;  5ADZ A;  4WYQ B;  2M4I A;  2EMK A;  1XS5 A;  1IIW A;  3T1H E;  4WPY A;  2KOU A;  1B51 A;  3GZG A;  3C4M A;  5T3J A;  3ZS6 A;  2ELY A;  1B6H A;  3PUX E;  1Y20 A;  2B65 A;  3USD A;  4IO7 A;  2EOO A;  2EOE A;  1QKA A;  1LAF E;  5ICT A;  4LF6 E;  1QUI A;  1G0H A;  4O3A A;  2ODR C;  4NWD A;  2VD3 A;  3T1B A;  3MW0 A;  2V83 A;  4Z0I A;  1DPP A;  1MXW A;  1D3K A;  3SKP A;  1ZU1 A;  4H46 A;  1DBZ A;  3NOH A;  2IHR 1;  1JP4 A;  4LZ8 A;  1TF6 A;  3H09 A;  3G3F A;  3PPP A;  2EPC A;  5HM4 B;  4JI2 E;  1IQ7 A;  1IXH A;  1IUD A;  2LO3 A;  2FGG A;  4X04 A;  4F29 A;  5CFF E;  5I3S A;  2FTX B;  5J16 A;  2DYX A;  2DE4 A;  4R6H A;  1D9Q A;  1AMF A;  4PFY A;  2Q2A A;  4MFI A;  1EH6 A;  4WXC A;  3OEM A;  3IL1 B;  1SPI A;  4R2Q A;  2DWI A;  4G68 C;  4NX1 A;  1NV5 A;  2VPN A;  4QF9 A;  3SDF A;  4RK9 A;  2VD2 A;  1VE4 A;  2WBB A;  3GBA A;  1A7L A;  1JEU A;  5FHN A;  1B1H A;  1H45 A;  3PUW E;  5KL3 A;  3C31 A;  4R2P A;  3THN A;  3HV1 A;  2EPR A;  5I2N B;  1M5F A;  3HPI A;  3Q29 A;  5AA2 D;  2H98 A;  4F9C B;  1LBV A;  3DLN A;  4R2B A;  2WCC 3;  2RTX A;  4BDR A;  2XWO A;  3CVG A;  1RKM A;  4BMJ A;  4BC9 A;  4NXM E;  4BDQ A;  4EF1 A;  1YZ0 A;  3K6X A;  2DRP A;  1JEV A;  2EN6 A;  2ZZV A;  1SW2 A;  3WAF A;  3C35 A;  2O1M A;  2Y5L A;  3ROJ A;  2Y84 A;  2FIE A;  4QFL A;  3MVW A;  3I6V A;  4R2A A;  4POX A;  2BBG A;  5I84 A;  3W15 C;  4DE8 A;  5IZZ A;  3PPN A;  4ELP A;  5FTI A;  1FQB A;  1NNK A;  3HXL A;  2DE2 A;  3AV0 A;  1FCK A;  3D4C A;  3VE1 B;  3TMG A;  2YRM A;  2HJJ A;  3DF6 A;  1IQO A;  2EMH A;  2O69 A;  3RNN A;  4R8O A;  1N84 A;  5FTH A;  1SYI A;  4AQY E;  1HNW E;  3BFU A;  2G93 A;  4FEC A;  1X49 A;  4L17 A;  2CEX A;  2JYA A;  2EQ3 A;  1OQG A;  2Q74 A;  2XWV A;  3AXF A;  4R6K A;  4LTY A;  2EOX A;  4ZZE A;  5I58 B;  3H06 B;  1XI6 A;  3U65 A;  4BC7 A;  2N3H A;  2L5V A;  2MC5 A;  4F9B B;  1FJ9 A;  2A5S A;  3LML A;  1XNR E;  1LFH A;  1QJM A;  2WZO A;  1IXG A;  5H8N A;  1TN9 A;  1MXY A;  3KN7 A;  4IO5 A;  5LDZ A;  3FIG A;  3IO6 A;  3RTW B;  4NZV A;  4KQP A;  3K6Q A;  1XMQ E;  5CC2 A;  1BB8 A;  2UVH A;  1MQH A;  2QVR A;  4QXD A;  2VHA A;  4M0V A;  1EKZ A;  4KPT A;  5CMC A;  1IMC A;  2HEU A;  2D3I A;  2YSP A;  1B05 A;  1DOT A;  3EPK A;  4PGN A;  2LJH A;  4H67 A;  2JJK A;  2ZXT A;  1SR9 A;  2QS3 A;  4WSP A;  3FGS A;  3G3I A;  5K2Y A;  4NHR A;  1AL3 A;  4DV1 E;  3TQW A;  1WHN A;  4LF5 E;  2DMY A;  3H3G A;  1NEI A;  2I13 A;  1IEJ A;  3UN6 A;  4BLA A;  3EQ1 A;  1RYO A;  1AWB A;  4GKK E;  1Y3P A;  4P1L A;  3TKD A;  1MPC A;  1MRP A;  5JTY A;  2WBT A;  3HPS A;  4R2D A;  3MJN A;  3PUY E;  2G7H A;  3P7I A;  1FJG E;  4ZEB A;  4DV6 E;  2F6P A;  5BUU A;  4QFK A;  3BIH A;  2XXP A;  2FV4 B;  2CZL A;  1B5H A;  4N4U A;  2EM3 A;  1UIU A;  4DUY E;  2M7Q A;  3TTL A;  3V5A A;  3MP1 A;  4ESW A;  3QMF A;  2K7I A;  2ENA A;  2GH9 A;  4LP2 B;  4B3T E;  3S9L C;  3FVO A;  3QIM A;  1LGB C;  3R6U A;  3K02 A;  2E1S A;  3PTY A;  1JVY A;  5H8F A;  4X9J A;  2JPA A;  5CMK A;  1MQG A;  3CFX A;  3TZA A;  4YU0 A;  1ZBT A;  3K1P A;  2QVV A;  3KSX A;  5ET8 A;  2DB2 A;  2UXD E;  1IXC A;  3TTN A;  2YRK A;  4BHB A;  4JSD A;  3SEU A;  1YYO A;  1Y4T A;  4RH8 A;  2REJ A;  2X26 A;  3UK3 C;  4GWX A;  4JVI A;  1NUX A;  2LTR A;  4JI7 E;  3T0J A;  4IS1 C;  1DPE A;  4X8R A;  5ICQ A;  4ZZA A;  1UTB A;  5L9M A;  5A5L A;  3B50 A;  2Q8U A;  4OVS A;  1B58 A;  3RPW A;  4KYS A;  3MHS C;  2EQ1 A;  4R72 A;  2UU9 E;  3CI8 A;  1IBK E;  4H8J A;  1A99 A;  3FVN A;  2I0B A;  2ZYK A;  2EMA A;  1FQC A;  4FJP A;  2G29 A;  3THO B;  1EH8 A;  2I4C A;  2KHX A;  3TPA A;  4QFO A;  4FAT A;  1R9Q A;  4ZEI A;  2RCB A;  1AH5 A;  4F2J C;  3EPE A;  4PBH A;  2QMW A;  2EN8 A;  4HS7 A;  3S9N C;  4YKJ A;  1MPB A;  3TFL A;  4M30 A;  3KZY A;  4QBA A;  2ZZX A;  4P8B A;  5DVI A;  1NNT A;  4O7I A;  1QKB A;  2UXB E;  1PKP A;  3ZOQ B;  5I59 A;  1FPK A;  3RTF B;  5FBP A;  3IO4 A;  5AC4 A;  3EHU A;  2XHD A;  4XTC Q;  4KI0 E;  4XXU A;  4KYE A;  3IWC A;  1HSL A;  3OSQ A;  2A5T B;  4QFP A;  2EPO A;  2L3C A;  1TWY A;  2ZNT A;  4L5N C;  4E0X A;  1QUJ A;  4JXI A;  2AIX A;  4OWD A;  2AL5 A;  1MS7 A;  1Y3N A;  2RC7 A;  1WXR A;  3I5O A;  4IJD A;  2HCA A;  4P3L A;  1R6Z A;  3MP8 A;  4G2Z A;  1MY2 A;  2Y7R A;  1BK4 A;  4TQU Q;  2LVH A;  1FBE A;  4RYA A;  3MHH C;  1G2D C;  4N6K A;  1NH8 A;  4F3S A;  1LST A;  1NKX A;  2DWH A;  2RSI A;  3GBB A;  3ECR A;  2F4V E;  4DR2 E;  1H76 A;  1WVJ A;  2H36 X;  4LQ5 A;  3TOD A;  5KL7 A;  5ESY A;  4BDL A;  4QFN A;  5IM2 A;  4M9V C;  1AAY A;  1R1N A;  3TCH A;  1Y4C A;  5LMU E;  4PET A;  1B7U A;  3CFL A;  3F6H A;  2N3G A;  1TF3 A;  2EPZ A;  4G68 B;  2VGQ A;  3PU5 A;  1VSO A;  1NV6 A;  4GWS A;  5J1D A;  3T9H B;  2HAU A;  2BJI A;  3DM0 A;  3T96 B;  3MAM A;  3O28 A;  3JV9 A;  1MDP 1;  2PT1 A;  1YYW A;  4U21 A;  1HSJ A;  2EMY A;  5KDT A;  3JAM C;  5A6B A;  5DVJ A;  4TLM B;  4PAF A;  4OYV A;  2V25 A;  4O43 A;  3T22 A;  3QUF A;  4OVQ A;  3C9H A;  4UA8 A;  3OXN A;  1LLM C;  2PX1 A;  4GZN C;  4FOR A;  3JTZ A;  5ELV A;  1VR5 A;  1PJT A;  5EYF A;  1FPE A;  1G2F C;  1R9L A;  3K0V A;  4RPN A;  1CE2 A;  1HR0 E;  4MNC A;  3PD8 A;  2B3T B;  2EE8 A;  4BDO A;  1US5 A;  3THI A;  4IGR A;  2FNC A;  3M3K A;  4G77 A;  1IBM E;  2ONK E;  4WKM A;  2Z22 A;  1Z1B A;  1TFA A;  4DR5 E;  4H5F A;  3E78 A;  2CEY A;  1FTM A;  2JR1 A;  1TFD A;  4Q8R A;  2RF1 A;  1FTL A;  4H1X A;  2I48 A;  1B46 A;  2XXW A;  3O6G A;  1QNT A;  4P7D A;  2UUA E;  1ZAA C;  1Q9D A;  4OFO A;  4YKP A;  2L8T A;  4RK2 A;  3KWR A;  2XWI A;  4DLD A;  2I3V A;  5EYH A;  2V89 A;  5H8H B;  3S4U A;  5A69 A;  1EZO A;  2LTS A;  1J1N A;  4N17 A;  5IZ1 A;  1POT A;  4NE4 A;  4O8M A;  4B3M E;  3CG1 A;  3MC2 A;  1VDW A;  2DP8 A;  4Z7E A;  2YU8 A;  3DEL B;  5CBS A;  2Y7P A;  4C0R A;  2KLF A;  4ISU A;  1S50 A;  2D5W A;  2UVJ A;  4QHQ A;  4U23 A;  2Z8F A;  2ESN A;  1FSA A;  4DXC A;  1PB9 A;  1Z7M E;  4DV7 E;  3SET A;  1DK4 A;  3KOT A;  1IMF A;  1Z7N E;  4KFQ A;  3LUZ A;  5EQA A;  3VXB A;  3FV1 A;  2P3N A;  4KHZ E;  4JI0 E;  5KL6 A;  5ITP A;  2F7A A;  3UIF A;  4NXN E;  2NOO A;  3PPO A;  1BTJ A;  4Q35 B;  2B4L A;  1B4H A;  1O64 A;  2F3D A;  1NH7 A;  3MYU A;  3RLF E;  2NVU B;  3HCQ A;  2H4I A;  1N3G A;  2LMZ A;  4MIJ A;  2DVC A;  1LBC A;  1LAX A;  4OHN A;  3KEI A;  5H8F B;  2EMZ A;  5DVF A;  1IXI A;  3OO6 A;  4LF8 E;  4GFR A;  5IXM B;  3F11 A;  3W9W A;  2YRH A;  3A09 A;  4OFJ A;  4LU9 A;  2EL4 A;  1INP A;  1N76 A;  2UVI A;  2XXT A;  4J8Z A;  2QSX A;  1MG1 A;  1MXZ A;  3KC1 A;  3KN8 A;  5ET5 A;  3TTM A;  4QSD A;  3ZKK A;  3PUV E;  4PCD A;  1A1K A;  4ZE8 A;  4ELQ A;  4N13 A;  2XXX A;  1SW4 A;  3PMV A;  4XEQ A;  1EYJ A;  2V86 A;  2FHY A;  1NUY A;  2PFZ A;  4X8W A;  1UTB B;  4THI A;  2WKY A;  4G8H A;  2ZNS A;  1G0I A;  1P1N A;  3U92 A;  3EN3 A;  2F34 A;  5LTC A;  5CM6 A;  4JI8 E;  2NUG A;  2WBS A;  5IZ3 A;  2EMC A;  4RHB B;  1H3D A;  3JYR A;  4OXV A;  1FW0 A;  2CZH A;  3U1O A;  4ZEC A;  2DLK A;  3DP4 A;  3TEP A;  4JVD A;  5I2K B;  1IQS A;  4OX9 E;  4Q0C A;  1IZ1 A;  4AS4 A;  5A5X B;  3L6H A;  1A1H A;  4JWX A;  2HFB A;  2ZYN A;  2K4V A;  4RPO A;  2EPA A;  1TT1 A;  2DSF A;  2Y7I A;  1T0K A;  3VVE A;  3CFZ A;  5AA2 A;  1RMD A;  1J5E E;  5EYG A;  3T93 B;  1B3G A;  3UK4 A;  4MNP A;  3ONM A;  1FBP A;  3EKI A;  3LC8 A;  3O97 A;  2JP9 A;  1SFE A;  3VK6 A;  4BHC A;  1YSA C;  3QUJ A;  3K6U A;  3HO7 A;  1A1I A;  2MDG A;  4Q30 B;  1YXI A;  5EQ9 A;  1JNF A;  4OER A;  2EN2 A;  1BBO A;  4H5G A;  4JBZ A;  4DUZ E;  3CIJ A;  4ECF A;  3N5L A;  4JI5 E;  5AA3 A;  4DV5 E;  3SZP A;  4IR8 A;  3KJT A;  3A29 A;  1N04 A;  1YTV A;  2MKZ A;  2MC6 A;  4XIG Q;  5F7V A;  5DNY A;  2V88 A;  4NWC A;  1QGX A;  1FPF A;  3FJM A;  4YMB A;  2P1S A;  4I3E A;  2Q88 A;  2ELZ A;  2JVA A;  3FAT A;  5AA4 A;  4DV4 E;  1I69 A;  3MZ1 A;  3BFT A;  4F3P A;  4PAK A;  4ZYH A;  4NF4 B;  3BIG A;  1GGG A;  2XXH A;  3K00 A;  1ZKB A;  1LLS A;  2GPI A;  5K2X A;  3BF2 A;  4X48 A;  1ZIU A;  1M5E A;  4OEV A;  1MPD A;  5DTB A;  2EQ0 A;  3Q28 A;  4ZE9 A;  3QAX A;  4TUG A;  1NFT A;  1PDA A;  3KBR A;  4UAB A;  2THI A;  3HPZ A;  5KCJ B;  4PQJ A;  4JDF A;  2L6M A;  2OWS A;  3HN0 A;  4RNS A;  5I56 B;  5L9S A;  4NMY A;  2XWK A;  1A1L A;  2I0C A;  1II5 A;  2FBP A;  5IAI A;  5I7I A;  2R9J A;  1A1G A;  2ADR A;  3EPL A;  3O6H A;  4DI4 B;  4N6D A;  4GIZ A;  4WFT A;  4C1U A;  1VFE A;  4U22 A;  2M8C A;  2GQ1 A;  5KL2 A;  2ENC A;  1UTH B;  4GWZ A;  1A1F A;  3QG5 C; 
#chains in the Genus database with same CATH homology
 2DWJ A;  4YKK A;  2F8D A;  2NWJ A;  3VFJ A;  4ZED A;  1D9V A;  2O84 X;  2Q9T A;  3LBS A;  1SD3 A;  2PMS A;  4FE8 A;  2ANJ A;  3ILU B;  2XXV A;  1MQD A;  3E4R A;  3VDF A;  4NTL A;  5TP9 B;  2I4B A;  1N3W A;  3KG2 A;  1A54 A;  3FXR A;  1BKA A;  3O2A A;  3TCF A;  3VVD A;  2RCA A;  4U2R A;  4OEU A;  3TEL A;  1B4Z A;  1D4N A;  4GL8 A;  3LSF B;  4EF2 A;  1OIB A;  2ZMB A;  4GOT A;  1UQW A;  3I3V A;  3PUZ E;  2LAO A;  4RJZ A;  4NF5 B;  1ZLQ A;  3KFM A;  1DSN A;  1XT8 A;  4FEB A;  3C34 A;  3IB0 A;  2V93 A;  1B3L A;  1PB7 A;  4LVQ A;  4ONY A;  1A55 A;  3OEK A;  4F1U A;  1DTZ A;  2R71 A;  1MDQ A;  1JQF A;  5CMM A;  4OEN A;  3RT8 A;  2XD2 A;  3G3G A;  1O7T A;  1B1X A;  2ONR A;  5AE4 A;  3Q27 A;  1SBP A;  3VXC A;  3OO9 A;  1GR2 A;  3KN3 A;  3DP8 A;  2HAV A;  4H65 A;  5FHO A;  1MM7 A;  5DT6 A;  1JET A;  3FD3 A;  4TOZ A;  1B0H A;  1EU8 A;  1N3X A;  4F1V A;  3IB2 A;  2GHA A;  4OES A;  4F3G A;  4LON B;  1Q1K A;  1L5T A;  4I8C A;  1GV8 A;  1I6Q A;  4GLI A;  3TQL A;  3PGF A;  3U93 A;  3D4G A;  4H6D A;  1URD A;  2FA7 A;  1ANF A;  1CB6 A;  1LB8 A;  1FTJ A;  3PD9 A;  1BIY A;  3T9X B;  3IJO B;  1MXV A;  3BKI B;  4PFU A;  5B7D A;  4R73 A;  2X7P A;  3IOR A;  3QXM A;  3SEX A;  2PBW A;  1B40 A;  4DXU A;  1QUL A;  1I6A A;  2IA4 A;  1Y1M A;  3TUS A;  3FUZ A;  1OMP A;  3OEL A;  4MLQ A;  4N6P A;  3V89 B;  3LSL A;  1MH4 A;  2OWT A;  4GD5 A;  4XKP A;  5H8Q A;  1BP5 A;  2QRY A;  3OEN A;  3OSR A;  4O3C A;  3IR1 A;  4F2O A;  2UVG A;  3UGW A;  3UOR A;  2DXR A;  2PT2 A;  1SDX A;  2HXW A;  4YAH X;  3G3H A;  2B3B A;  3T66 A;  1A8E A;  4ZDM A;  2O7U A;  2I49 A;  1B0L A;  5I2N A;  2DVZ A;  4DDD A;  1OVB A;  1ZU0 A;  3KJ7 A;  5HBC A;  4LQ2 A;  1B52 A;  4KCC A;  2RKM A;  4K3F A;  3MZB A;  2REG A;  4X1D A;  1WDN A;  1NNF A;  1PB8 A;  3WAE A;  1FQA A;  3G3J A;  3FJ7 A;  2QL3 A;  3ZSF A;  5TPA A;  1IIT A;  1LFG A;  4PFW A;  2OBG A;  1D9Y A;  5DEX A;  1OVT A;  3E3K A;  4UAC A;  3TAJ A;  1OQH A;  4POW A;  3R26 A;  3UP9 A;  3JZJ A;  4DCX A;  4R6Y A;  3KOS A;  4NF8 A;  4IB2 A;  1EH3 A;  3V83 A;  1A40 A;  5H8N B;  3O66 A;  4NED A;  1FQD A;  4AQ4 A;  4IY5 A;  5JK4 A;  1QW0 A;  1MH3 A;  2H9B A;  1M5C A;  3Q26 A;  4YIC A;  5I58 A;  3MWB A;  1B7H A;  1B2H A;  4F31 B;  3SEY A;  3UA8 A;  3O6I A;  3SES A;  2P2A A;  4OMB A;  1B3F A;  3FV2 A;  3OO8 A;  2UXA A;  2XXU A;  3B6W A;  2B3F A;  1VFD A;  4KR5 A;  3VVF A;  2Q89 A;  2XX8 A;  4EUO A;  5JTY B;  4ZEF A;  2XXR A;  4GXS B;  2QMX A;  3MVX A;  3H4Z A;  2P0S A;  4YZZ A;  3M3F A;  2QPQ A;  2YJP A;  4EDP A;  1H43 A;  4R9G A;  2DQV A;  1DMB A;  3H7M A;  5CMB A;  3KSJ A;  4JSO A;  4N07 A;  4GL0 A;  4H8I A;  2Z8E A;  3K1N A;  2PYY A;  1FTO A;  3C33 A;  3E9X A;  2UYE A;  3LSW A;  3O29 A;  4MBP A;  2VP1 A;  1POY 1;  4YKI A;  3TTK A;  4G8M A;  1P99 A;  3G7W A;  2RC9 A;  3R7X A;  2AL4 A;  2Q2C A;  2GHB A;  1BLF A;  3H03 A;  4GRK A;  4F19 A;  3MPL A;  4LZ7 A;  4Q5T A;  1AIV A;  4OVJ A;  2UYF A;  3IOT A;  3H6U A;  4R75 A;  5EHS A;  3H6V A;  1URG A;  3VLU A;  1HSE A;  5L9O A;  5CBR A;  4GQO A;  5DYH A;  2NUV A;  1DTG A;  4FAJ A;  3KZG A;  2FYI A;  3LR1 A;  1OLC A;  3IAZ A;  3B6T A;  2Y7W A;  4LUB A;  4XKN A;  4RY1 A;  4EQB A;  1FQF A;  2H25 A;  5CI5 A;  4NF6 A;  2ALU A;  1PEB A;  1EZP A;  1LBB A;  4I1D A;  4ZEK A;  1USY E;  2I58 A;  4C1T A;  2ABH A;  1UIV A;  5I59 B;  2ZNU A;  2NXO A;  2OLB A;  1MM6 A;  3HHF A;  3S9E A;  1MY4 A;  3FXU A;  3OO7 A;  4YB6 A;  4BDM A;  5FHM A;  3HHG A;  3N6U A;  4R74 A;  2VOZ A;  3FVG A;  4MH5 A;  4RA1 A;  2DE3 A;  1GTK A;  5F1Q A;  4ZS9 A;  4ELR A;  2A5T A;  1YPN A;  1GVC A;  1MQJ A;  3VLW A;  2Z23 A;  4F2Q A;  3MZ9 A;  1B3E A;  5H8Q B;  1QUK A;  4DCY A;  1SI0 A;  1WOD A;  3RQT A;  1NL5 A;  1FTK A;  4IY6 A;  4U4X A;  4HTG A;  4F18 A;  3IJX B;  2CMO A;  3RY3 A;  1LAH E;  2XX7 A;  3M3L A;  2O51 A;  1XHY A;  3H6W A;  1USY H;  5I57 A;  4JB7 A;  4AB6 A;  3PPR A;  3DP6 A;  4M1V A;  5LOM A;  1YAE A;  3B6Q A;  3Q25 A;  1MY3 A;  3S2V A;  1ELJ A;  2F78 A;  3W9V A;  3QSL A;  5KDT B;  1SVX B;  3N26 A;  3EF7 A;  1EZ9 A;  3ILT B;  4G68 A;  1URS A;  2OZZ A;  3IX1 A;  4M4G A;  1LB9 A;  2Y7K A;  3FAS A;  4HCY A;  4DZ1 A;  3TTR A;  1Y3Q A;  2QJE A;  5TPA B;  4FIM A;  3TYH A;  2F97 A;  5DEX B;  3ODB A;  3C32 A;  4MF3 A;  4TLL B;  4NF8 B;  1Y1Z A;  1LFI A;  2V3Q A;  1SW5 A;  4OFL A;  1AOV A;  1B7Z A;  4FED A;  2ZYO A;  4ELO A;  4QSE A;  5IKB A;  2OCU A;  3MPK A;  4PFT A;  2HZK A;  4WED A;  4OTE A;  1XOC A;  2O7I A;  4R2F A;  3U94 A;  2DWA A;  1H44 A;  3G3K A;  2OK2 A;  5KZT A;  3A3C A;  2F7C A;  4U1O A;  4ND9 A;  2HQ0 A;  4IO6 A;  1QVS A;  4YB5 A;  5H8H A;  3SEV A;  1RYX A;  1ZMG A;  4GVO A;  4JWO A;  3VV5 A;  2W7Y A;  2XXY A;  1MXU A;  2H5Y A;  1XVX A;  2PVU A;  3CG3 A;  3MUQ A;  1Q35 A;  2RC8 A;  4DIG A;  3CSB A;  3RUM A;  4X9T A;  3T9U A;  3K4U A;  4G8N A;  1ATG A;  3V8X B;  2IEE A;  3CR9 A;  3LUY A;  2H99 A;  1SQY A;  1TXF A;  5M2V A;  2E0S A;  3T9V A;  3OOA A;  2DS9 A;  3SER A;  2XD3 A;  4I62 A;  3GXA A;  3BBR A;  2V84 A;  3HST A;  5TU0 A;  2ONS A;  4YMA A;  2F5X A;  4O3B A;  2F36 A;  4AB5 A;  1NMU A;  3TDJ A;  5JEI A;  1JW1 A;  2RIN A;  4HW8 A;  1ZTY A;  1P1O A;  2HZL A;  4E0W A;  3K01 A;  2D21 A;  5BWJ A;  5B70 A;  1P1Q A;  1P1U A;  5AA1 A;  4NF6 B;  2F7B A;  3EHS A;  3GLB A;  1KWH A;  2YLN A;  2QS2 A;  5ITO A;  1US4 A;  5AA2 B;  3FZV A;  1MY0 A;  3MVZ A;  3ZKL A;  2XX9 A;  5I2K A;  3IOW A;  3O9P A;  4P0G A;  1SI1 A;  3RT6 B;  5A5X A;  1OLA A;  2X7Q A;  1PBQ A;  3N6T A;  1B5I A;  1B32 A;  1ZBM A;  1XC1 A;  2Z8D A;  3MVY A;  1B5J A;  1F9B A;  3MQ9 A;  4F1Y A;  3A3U A;  4LA9 A;  2AYS A;  3IOV A;  5CRY A;  4WEP A;  2XXI A;  3K6V A;  4QSC A;  1M5B A;  3H6T A;  5AA4 B;  3PPQ A;  4PP0 A;  2GFE A;  4GWO A;  1NNP A;  1JW4 A;  2R6G E;  4G4P A;  3VLV A;  1O63 A;  1LCT A;  3FXQ A;  1M5D A;  4IO3 A;  3N94 A;  2XXQ A;  3RN8 A;  3PV0 E;  3U8Q A;  1MY1 A;  2I6E A;  5I57 B;  4NF4 A;  3FVK A;  1N7X A;  2ZYM A;  3S9M C;  4XKQ A;  1XVY A;  3QK6 A;  1P1W A;  4OET A;  4JWY A;  4H0W A;  2DOJ A;  5KCJ A;  4KYD A;  5I56 A;  2O6A A;  3OMB A;  1JVX A;  1LAG E;  2BJJ X;  5EHM A;  1PBP A;  4MLV A;  3K6W A;  1UTH A;  3QYT A;  4OQO A;  4P0I A;  4QRZ A;  1A8F A;  1N0T A;  2I3W A;  3B7D A;  1YCJ A;  3MP6 A;  3FJG A;  4GF8 A;  4LZ5 A;  1N7W A;  3OD7 A;  2F6G A;  4KD5 A;  2GRV A;  4U1Z A;  3IK6 B;  4I9D A;  3IOU A;  3K2D A;  4R9F A;  5TP9 A;  2F35 A;  5H8S A;  5L8D A;  4PE5 B;  5HPQ A;  3CRB A;  4F3B A;  3LSX A;  1JW5 A;  1B3H A;  2QS4 A;  2O1L A;  3IB1 A;  3MBP A;  2QS1 A;  3CSG A;  4GXA A;  1S9T A;  4WXJ A;  2OJT A;  4XKR A;  4IGT A;  3TCG A;  1MXX A;  4DXB A;  3M8U A;  3SEW A;  4EQ7 A;  4NF5 A;  4F39 A;  1SYH A;  4IO2 A;  2YPN A;  4OZ9 A;  3L6G A;  3PMX A;  4KCD A;  2Q8J A;  4ESX A;  4EXL A;  1FQE A;  1S7Y A;  2O68 A;  4EXK A;  1ZJL A;  4X1B A;  3EHT A;  2V3T A;  3PMW A;  3E13 X;  3KGC A;  3U72 A;  1Y9U A;  2DXY A;  3K1M A;  1SW1 A;  4P11 A;  2V3U A;  4U4S A;  4RXL A;  1MQI A;  4YB7 A;  4EQ9 A;  1I6B A;  4IO4 A;  4HCW A;  4F22 A;  3RGY A;  5ISU A;  3C36 A;  4LAT A;  3FIR A;  1PC3 A;  1B9J A;  4BDN A;  1LCF A;  1XS5 A;  1IIW A;  1B51 A;  3GZG A;  3C4M A;  3ZS6 A;  1B6H A;  3PUX E;  1Y20 A;  2B65 A;  3USD A;  4IO7 A;  1QKA A;  1LAF E;  5ICT A;  1QUI A;  4O3A A;  4NWD A;  2VD3 A;  3MW0 A;  4Z0I A;  1DPP A;  1MXW A;  1D3K A;  3SKP A;  4LZ8 A;  3G3F A;  3PPP A;  5HM4 B;  1IQ7 A;  1IXH A;  1IUD A;  4F29 A;  2DYX A;  2DE4 A;  4R6H A;  1AMF A;  4PFY A;  2Q2A A;  4MFI A;  3OEM A;  3IL1 B;  2DWI A;  4G68 C;  4QF9 A;  3SDF A;  4RK9 A;  2VD2 A;  1VE4 A;  3GBA A;  1A7L A;  1JEU A;  5FHN A;  1B1H A;  1H45 A;  3PUW E;  3C31 A;  3HV1 A;  5I2N B;  1M5F A;  3HPI A;  3Q29 A;  5AA2 D;  2H98 A;  3DLN A;  4R2B A;  4BDR A;  3CVG A;  1RKM A;  4BDQ A;  4EF1 A;  3K6X A;  1JEV A;  1SW2 A;  3WAF A;  3C35 A;  2O1M A;  2Y84 A;  4QFL A;  3MVW A;  3I6V A;  4POX A;  5I84 A;  3W15 C;  4DE8 A;  3PPN A;  4ELP A;  5FTI A;  1FQB A;  1NNK A;  2DE2 A;  3D4C A;  1FCK A;  3VE1 B;  3TMG A;  3RNN A;  2O69 A;  5FTH A;  1N84 A;  1SYI A;  3BFU A;  2G93 A;  4FEC A;  4L17 A;  1OQG A;  3AXF A;  4R6K A;  4ZZE A;  5I58 B;  3H06 B;  2A5S A;  1LFH A;  1QJM A;  1IXG A;  5H8N A;  1MXY A;  3KN7 A;  4IO5 A;  3IO6 A;  3RTW B;  4KQP A;  5CC2 A;  2UVH A;  1MQH A;  2VHA A;  4KPT A;  5CMC A;  2HEU A;  2D3I A;  1B05 A;  1DOT A;  4H67 A;  2ZXT A;  2QS3 A;  3FGS A;  3G3I A;  5K2Y A;  1AL3 A;  3TQW A;  3H3G A;  1IEJ A;  3UN6 A;  4BLA A;  3EQ1 A;  1RYO A;  1Y3P A;  3TKD A;  1MPC A;  1MRP A;  5JTY A;  3PUY E;  3MJN A;  3P7I A;  4ZEB A;  2F6P A;  5BUU A;  4QFK A;  2XXP A;  2CZL A;  1B5H A;  1UIU A;  3TTL A;  3V5A A;  3MP1 A;  4ESW A;  2GH9 A;  4LP2 B;  3S9L C;  3FVO A;  3QIM A;  1LGB C;  3R6U A;  3K02 A;  2E1S A;  1JVY A;  5H8F A;  5CMK A;  1MQG A;  3CFX A;  3TZA A;  4YU0 A;  3K1P A;  3KSX A;  1IXC A;  3TTN A;  4JSD A;  3SEU A;  1Y4T A;  2REJ A;  2X26 A;  1DPE A;  5ICQ A;  4ZZA A;  1UTB A;  5L9M A;  1B58 A;  3RPW A;  4KYS A;  4R72 A;  3CI8 A;  4H8J A;  1A99 A;  3FVN A;  2I0B A;  2ZYK A;  1FQC A;  4FJP A;  2G29 A;  2I4C A;  3TPA A;  4QFO A;  4FAT A;  1R9Q A;  4ZEI A;  2RCB A;  1AH5 A;  3EPE A;  2QMW A;  3S9N C;  4HS7 A;  4YKJ A;  1MPB A;  3TFL A;  5DVI A;  1NNT A;  1QKB A;  5I59 A;  3RTF B;  3IO4 A;  3EHU A;  2XHD A;  4XTC Q;  4KI0 E;  4XXU A;  4KYE A;  1HSL A;  3OSQ A;  2A5T B;  4QFP A;  1TWY A;  2ZNT A;  4E0X A;  1QUJ A;  4JXI A;  2AIX A;  4OWD A;  2AL5 A;  1MS7 A;  1Y3N A;  2RC7 A;  3I5O A;  2HCA A;  1R6Z A;  3MP8 A;  4G2Z A;  1MY2 A;  2Y7R A;  4TQU Q;  4RYA A;  1NH8 A;  4F3S A;  1LST A;  1NKX A;  2DWH A;  3GBB A;  3ECR A;  1H76 A;  1WVJ A;  4LQ5 A;  3TOD A;  4BDL A;  4QFN A;  1R1N A;  3TCH A;  1Y4C A;  4PET A;  1B7U A;  3CFL A;  4G68 B;  2VGQ A;  3PU5 A;  1VSO A;  5J1D A;  3T9H B;  2HAU A;  3DM0 A;  3T96 B;  3MAM A;  3O28 A;  3JV9 A;  1MDP 1;  2PT1 A;  4U21 A;  1HSJ A;  5KDT A;  5DVJ A;  4TLM B;  4OYV A;  2V25 A;  3T22 A;  3QUF A;  3C9H A;  4UA8 A;  3OXN A;  2PX1 A;  4FOR A;  5ELV A;  1VR5 A;  5EYF A;  1R9L A;  3K0V A;  4RPN A;  1CE2 A;  3PD8 A;  4BDO A;  1US5 A;  3THI A;  4IGR A;  2FNC A;  3M3K A;  4G77 A;  2ONK E;  4WKM A;  2Z22 A;  1TFA A;  4H5F A;  1FTM A;  1TFD A;  4Q8R A;  2RF1 A;  1FTL A;  4H1X A;  2I48 A;  1B46 A;  2XXW A;  3O6G A;  4OFO A;  4YKP A;  4RK2 A;  4DLD A;  2I3V A;  5H8H B;  3S4U A;  1EZO A;  1J1N A;  1POT A;  4NE4 A;  3MC2 A;  3CG1 A;  2DP8 A;  4Z7E A;  3DEL B;  5CBS A;  2Y7P A;  4C0R A;  2KLF A;  4ISU A;  1S50 A;  2D5W A;  2UVJ A;  4QHQ A;  4U23 A;  2Z8F A;  2ESN A;  4DXC A;  1PB9 A;  1Z7M E;  3SET A;  3KOT A;  1Z7N E;  4KFQ A;  3VXB A;  3FV1 A;  4KHZ E;  5ITP A;  2F7A A;  3UIF A;  2NOO A;  3PPO A;  1BTJ A;  1B4H A;  1O64 A;  1NH7 A;  3RLF E;  2NVU B;  3HCQ A;  2H4I A;  2DVC A;  1LBC A;  1LAX A;  4OHN A;  3KEI A;  5H8F B;  5DVF A;  1IXI A;  3OO6 A;  4GFR A;  3F11 A;  3W9W A;  3A09 A;  4OFJ A;  1N76 A;  2UVI A;  2XXT A;  2QSX A;  1MG1 A;  1MXZ A;  3KN8 A;  3TTM A;  4QSD A;  3ZKK A;  3PUV E;  4ZE8 A;  4ELQ A;  4N13 A;  2XXX A;  1SW4 A;  3PMV A;  4THI A;  1UTB B;  2WKY A;  4G8H A;  2ZNS A;  1P1N A;  3U92 A;  3EN3 A;  2F34 A;  5CM6 A;  1H3D A;  3JYR A;  4OXV A;  1FW0 A;  3U1O A;  4ZEC A;  3DP4 A;  3TEP A;  5I2K B;  4Q0C A;  1IZ1 A;  5A5X B;  3L6H A;  4JWX A;  2HFB A;  2ZYN A;  4RPO A;  1TT1 A;  2DSF A;  2Y7I A;  1T0K A;  3VVE A;  3CFZ A;  5AA2 A;  3T93 B;  1B3G A;  3UK4 A;  3ONM A;  3LC8 A;  3O97 A;  3QUJ A;  3K6U A;  3HO7 A;  4Q30 B;  1JNF A;  4OER A;  4JBZ A;  4H5G A;  3CIJ A;  4ECF A;  3N5L A;  5AA3 A;  3KJT A;  1N04 A;  1YTV A;  4XIG Q;  5F7V A;  4NWC A;  3FJM A;  4YMB A;  2P1S A;  2Q88 A;  3FAT A;  5AA4 A;  1I69 A;  3MZ1 A;  3BFT A;  4F3P A;  4NF4 B;  1GGG A;  2XXH A;  3K00 A;  1ZKB A;  1LLS A;  5K2X A;  4X48 A;  1ZIU A;  1M5E A;  4OEV A;  1MPD A;  5DTB A;  4ZE9 A;  3Q28 A;  3QAX A;  1NFT A;  1PDA A;  3KBR A;  2THI A;  5KCJ B;  4PQJ A;  4JDF A;  2OWS A;  3HN0 A;  4RNS A;  5I56 B;  5L9S A;  4NMY A;  2I0C A;  1II5 A;  5IAI A;  2R9J A;  3O6H A;  4GIZ A;  4C1U A;  1VFE A;  4U22 A;  2M8C A;  1UTH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...