3EQ1A

The crystal structure of human porphobilinogen deaminase at 2.8a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
338
structure length
312
Chain Sequence
RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPQHEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structure of human porphobilinogen deaminase at 2.8 A: the molecular basis of acute intermittent porphyria
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 312
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3eq1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A02
1GGGA 1VFEA 2FNCA 2YLNA 2YPNA 3H6TA 2REJA 1IEJA 3MVYA 3B7DA 4JWYA 3PPPA 2GFEA 2Z8DA 1H3DA 3T9XB 4LA9A 1URSA 1HSLA 3T96B 1GTKA 4LQ2A 5HPQA 4F29A 3SETA 3C36A 3TDJA 1LFHA 1R6ZA 5B7DA 4U1ZA 4KFQA 1NH8A 1B32A 2P0SA 3VLUA 3C34A 2ZYNA 4ZZEA 3VVDA 2I4CA 1B52A 3FV1A 4X48A 3TQWA 2WKYA 3PUWE 1B1XA 2I58A 1I6QA 3LUYA 2F6GA 1IITA 4EUOA 1P1OA 5I84A 2FA7A 5ITOA 3TCHA 5DYHA 4C1UA 1XS5A 3E9XA 4PFWA 3CRBA 2OWTA 1J1NA 3RUMA 2O1MA 1M5FA 2GRVA 3TZAA 3LSFB 3TTLA 5L8DA 4THIA 4ZEDA 4DXBA 4QFKA 3HV1A 3CIJA 1Y4TA 2QMXA 4MLQA 1OVTA 4P0GA 3IB0A 3JYRA 2NUVA 3B6WA 3O66A 3K2DA 1I6BA 3RTFB 4H8IA 4M1VA 2OBGA 3UIFA 4QSDA 2OJTA 1VR5A 2RKMA 1FQAA 4U4SA 5CBRA 3AXFA 4LQ5A 4ESXA 5EHMA 1LB9A 4BDOA 2XXIA 2B3FA 3PGFA 4JSDA 5CMMA 3N6TA 3OO9A 1SDXA 3KFMA 4IY5A 4R73A 1DMBA 2RC9A 3O6GA 4K3FA 1B3LA 3BFUA 3E3KA 3BKIB 5KCJB 2XXVA 2HZLA 2Y84A 1LAGE 1AOVA 3FATA 3MP1A 2O7UA 4PE5B 4KR5A 1AIVA 4FEDA 3QUFA 1T0KA 4TOZA 5KDTB 3PUZE 3A3CA 3TCFA 1B3EA 4YICA 4PQJA 4E0WA 3IORA 4M4GA 4OFOA 2AL5A 4KYSA 4DXCA 2VGQA 3CI8A 4QFPA 4GXAA 5CMCA 1PB7A 3O28A 5I59B 1IXCA 3SEUA 2FYIA 3D4CA 4G77A 1FTKA 5TPAA 3TPAA 4BLAA 2CMOA 4DCXA 1SVXB 3MVXA 2ONSA 4PFUA 1US4A 4I8CA 2X7PA 4GL8A 2ZNUA 5A5XB 1B1HA 5AA2D 1WODA 2ZYMA 4C1TA 1Y9UA 2RC8A 3THIA 3VLWA 2V84A 3ODBA 4ELOA 3MP6A 4QFLA 3H6VA 1MPBA 2O68A 5F7VA 1FQEA 4MBPA 5I56B 1MY2A 2ABHA 4YU0A 4RPOA 1GV8A 3RN8A 4EQ7A 2V93A 3TQLA 4AB6A 1FCKA 3P7IA 1LBCA 1P1QA 1US5A 4QFNA 2NVUB 5CMKA 3F11A 2QMWA 3IO6A 4ELPA 4NF5B 5TP9A 2ANJA 4HCYA 3OXNA 1JETA 1POTA 3GXAA 3VVFA 4F2QA 3ZS6A 2F7BA 4NF6A 2E0SA 4DDDA 3RT8A 4QF9A 2Q88A 3IOVA 1JNFA 3TKDA 1N84A 1Y20A 4R2BA 1MY4A 1B5IA 2P2AA 2OZZA 3TMGA 4F3GA 3KSXA 2DSFA 2OWSA 2RINA 1D3KA 1M5EA 5HM4B 3K01A 4FE8A 5H8SA 3WAFA 1N7XA 1JW5A 2DWJA 3BBRA 5EYFA 1I6AA 5K2XA 1TXFA 2PVUA 2XXHA 5DEXB 1MQGA 3H4ZA 4JDFA 3IK6B 4JBZA 3OOAA 1URDA 1SYIA 3T66A 3I5OA 4JXIA 3SEVA 1YPNA 4I1DA 1DSNA 4UACA 2QL3A 1M5DA 2VOZA 3LBSA 4EF1A 3K4UA 4OQOA 1FTJA 2B3BA 1LAHE 3D4GA 1LAXA 3TELA 1H44A 3SKPA 2AYSA 4DZ1A 1PB8A 2XXTA 5CM6A 4TLMB 3H6UA 3ZKKA 3O6IA 2THIA 3ECRA 3LC8A 2E1SA 3H3GA 1ZTYA 3A3UA 2QS2A 1XHYA 1FQCA 4FEBA 2DP8A 2ZXTA 4YZZA 4X1BA 4EXLA 3DELB 2OLBA 3EHUA 1MS7A 4ZECA 1LCTA 1WVJA 2F35A 3C9HA 1B51A 4F22A 4G68C 1LFGA 3SDFA 5AA2A 1NNPA 2XHDA 5K2YA 1UIUA 3KGCA 4PETA 3SESA 4BDQA 3CSGA 4BDMA 1MQJA 3TFLA 5ICTA 2GHBA 5FTIA 4KYEA 4ISUA 4JWXA 1ZBMA 2GHAA 3PMVA 4F1UA 1CE2A 3MJNA 4F3PA 4NMYA 1F9BA 1YCJA 4OMBA 3PU5A 4GQOA 3UP9A 3Q28A 3OSRA 5CC2A 3OO7A 2O69A 4DLDA 1ZU0A 1Q1KA 4U4XA 4KHZE 5JEIA 4QSCA 3I3VA 3N6UA 4ZDMA 4FORA 1JVYA 2PYYA 2XXRA 4LONB 5ITPA 1RYOA 4FATA 4R2FA 4G4PA 3C35A 5H8QB 1MY0A 4TQUQ 3KOTA 4G8NA 2DWIA 4XTCQ 5DT6A 3PV0E 1D4NA 5CMBA 3CFZA 2HAUA 1SD3A 2UYEA 3K6WA 5AA4A 1LB8A 2IA4A 3Q25A 3S9EA 2R9JA 1B3FA 3FVOA 1PBPA 3G3HA 2I4BA 4LZ7A 1FTOA 4F19A 3R6UA 2HEUA 2XXWA 2UVJA 3PPNA 4G2ZA 4OZ9A 3U72A 1LBBA 1O7TA 4R72A 2XXYA 3C33A 1S7YA 1B6HA 4R74A 1SBPA 3U8QA 4IO2A 1LSTA 2DVZA 2HZKA 2PT1A 1P1UA 1SI0A 2UVHA 4POXA 4FIMA 4UA8A 1A8FA 4GD5A 1NNKA 4KPTA 1XC1A 4ZE9A 3KOSA 4ONYA 1UTBA 3LR1A 2QSXA 1PBQA 4G8HA 1SW4A 3T9UA 4ZE8A 4Q8RA 3K0VA 3OELA 1GVCA 3MVZA 3S9MC 4N13A 3HHGA 4H0WA 2Q2CA 1MH4A 4R6YA 1IQ7A 2QRYA 2QJEA 2V3QA 4NWCA 4Q30B 1JW1A 4OERA 2KLFA 5JTYA 3VXBA 4G68A 2Q2AA 4OHNA 5FHMA 1B4ZA 1B3HA 4GRKA 4H5GA 1EZPA 2H9BA 2F36A 2NOOA 5I57A 1RKMA 2F6PA 2ONRA 1Y1ZA 3IX1A 4G8MA 5BWJA 3IOTA 4ZZAA 3FD3A 1OQGA 2A5TB 2Z23A 2V3UA 3EF7A 1WDNA 3CFXA 1GR2A 2V25A 3FVGA 1BIYA 4XXUA 3IOUA 1R9LA 1B40A 2NWJA 3PMWA 2ONKE 2DWHA 1Y3NA 1MXYA 4OENA 1SW1A 3DP6A 1NH7A 4ELQA 4ZEBA 3FXUA 1P99A 3QUJA 3FXQA 3KN3A 4R9FA 2D5WA 4LUBA 3G3FA 4EQBA 2XD3A 2O84X 2I0CA 5L9SA 3PMXA 3S4UA 2RF1A 4Q5TA 1UIVA 4BDNA 4FJPA 1EZOA 4Z0IA 2PX1A 1OVBA 5CBSA 2F78A 3CG3A 5AA3A 3TTMA 2NXOA 3BFTA 3RTWB 4F18A 3IOWA 3RT6B 4NF8B 1B3GA 3MUQA 1MY1A 5H8HA 3TYHA 5AA4B 1JEVA 3K02A 3Q26A 4RA1A 4RJZA 3C31A 4X1DA 4DCYA 3A09A 4P11A 1QVSA 3QAXA 3UN6A 3PUVE 1FTMA 2VP1A 4GL0A 4F2OA 1POY1 2H98A 2I3WA 1QUKA 3T93B 4IY6A 3C4MA 3UGWA 5DVJA 3FJ7A 1MRPA 1IIWA 4O3AA 3G3KA 1N0TA 3CR9A 2UXAA 3LSXA 3ZSFA 4IO5A 3VXCA 2PMSA 4XKNA 4QFOA 1Z7ME 2Z22A 4NTLA 3O97A 1BKAA 1UTBB 4O3CA 3SERA 5ICQA 1URGA 3W9WA 1USYE 4LVQA 5FTHA 3Q29A 2QS1A 4C0RA 3OO6A 3PUYE 2I3VA 2X26A 1R9QA 4RK2A 4IO3A 1M5CA 1IXHA 4QHQA 3EQ1A 1MDQA 4YKJA 4LP2B 3G3IA 3O2AA 1MQDA 2ZNSA 2F97A 1A40A 1DTZA 5JTYB 5I58A 1MPDA 4U21A 2M8CA 4NF4A 4OXVA 3Q27A 1ZKBA 1LCFA 3S2VA 3IR1A 4OWDA 3MBPA 5I57B 3H6WA 2O1LA 2O51A 3CVGA 2QS3A 3UA8A 4L17A 2X7QA 1MXVA 4OFLA 2Y7KA 1DPEA 4MFIA 3K00A 4EDPA 1H43A 3KN7A 1D9VA 3FVNA 1JEUA 1A8EA 1SW2A 5ELVA 4KCCA 3TTKA 3H06B 1MM6A 1PB9A 5HBCA 4HTGA 1KWHA 3K6UA 4PFYA 1S9TA 4QRZA 1QUJA 2ZYKA 4WEPA 1NNTA 4PFTA 2AL4A 4GVOA 4WXJA 4N6PA 1OIBA 3OO8A 1B5JA 3MZ1A 2V3TA 4XKPA 2F7AA 2LAOA 1QKAA 3WAEA 2HXWA 1A54A 1SW5A 3VLVA 3K6XA 2XXXA 3QYTA 2BJJX 1ELJA 5CI5A 1UQWA 4DE8A 1B9JA 1YAEA 2PBWA 4YB6A 4RPNA 5F1QA 1LGBC 1NKXA 2O6AA 4OESA 1TFDA 4GFRA 5H8HB 5TU0A 4GLIA 4I9DA 5L9MA 3FV2A 5FHOA 4DIGA 4R75A 2YJPA 3CSBA 3U92A 4RXLA 5TPAB 4KD5A 1P1WA 1IXGA 3MWBA 1B4HA 2Q89A 3ONMA 3MC2A 3MPLA 3G3GA 1Z7NE 3FGSA 4KYDA 4KI0E 4KQPA 1JVXA 3I6VA 3TUSA 4R9GA 2W7YA 4WKMA 4F31B 1BP5A 4U1OA 4YKKA 3KSJA 1OLCA 1YTVA 1NMUA 1B05A 4GXSB 3TODA 4H67A 5KZTA 5FHNA 3S9NC 3B6TA 3TAJA 3V8XB 2DE2A 1ZJLA 3KJ7A 4Z7EA 4F1VA 1Q35A 2OK2A 4Q0CA 5EHSA 1IZ1A 4OYVA 2Y7RA 1SQYA 4WEDA 1CB6A 4H8JA 1R1NA 1TWYA 2Z8FA 3TCGA 2F8DA 5TP9B 4PP0A 5KCJA 4H5FA 4EF2A 3KZGA 3IO4A 4JWOA 1BLFA 4NF6B 5I58B 3K1NA 4IGRA 3V89B 3N5LA 2DVCA 4YMBA 5BUUA 1QW0A 4I62A 2CZLA 3TTRA 1ZLQA 3SEYA 4H65A 2ZMBA 1EH3A 1B0HA 2I0BA 3C32A 4NWDA 4ECFA 4IGTA 3DLNA 1HSJA 3QXMA 4FECA 5IKBA 4GOTA 4E0XA 3M3KA 3MQ9A 2REGA 2VD2A 2ZYOA 1ATGA 3V83A 3OEMA 4HW8A 2Z8EA 1TFAA 1EU8A 4IO6A 1BTJA 2I49A 3LSLA 5A5XA 1OQHA 2H5YA 4ELRA 1I69A 2O7IA 3GLBA 4YKPA 3JV9A 1SI1A 3OSQA 4GIZA 1JQFA 3T9VA 1FQFA 2Q9TA 3RQTA 3PPOA 4AB5A 5IAIA 1B0LA 3HHFA 5I56A 4GF8A 2DE3A 1UTHA 1II5A 1B7ZA 2UYFA 2D21A 5LOMA 1ANFA 3R26A 5I2NA 5DVIA 3PPRA 4OFJA 5H8FA 4NF5A 3TEPA 4BDRA 1MXZA 5CRYA 3V5AA 2XXPA 3FIRA 3OENA 4RY1A 1QJMA 3L6GA 3L6HA 5ISUA 3EHTA 5I2KA 4JB7A 2DWAA 3VDFA 5AA2B 3IL1B 4AQ4A 2R71A 3IB2A 3U1OA 1MM7A 2R6GE 3JZJA 1P1NA 3U93A 2DQVA 4X9TA 2VD3A 2D3IA 3HO7A 3E4RA 4YAHX 2XX9A 4IO4A 1PDAA 3CFLA 3OEKA 3FXRA 4YMAA 5DEXA 3R7XA 1A7LA 3MPKA 1AH5A 4OTEA 2QS4A 2I6EA 3RNNA 1VSOA 4KCDA 2DXRA 3MZ9A 2DS9A 3QK6A 1N04A 1DPPA 2H99A 2HCAA 4F3SA 3FASA 4MH5A 3H7MA 1MXXA 2B65A 4OEVA 1MQIA 5JK4A 3EN3A 3W9VA 3HSTA 2I48A 4H6DA 3OMBA 1O63A 4EXKA 5M2VA 2XD2A 3W15C 3O9PA 1LFIA 3CG1A 4FAJA 3UORA 2XXQA 3DM0A 4TLLB 2F5XA 4R6KA 1PC3A 3PD9A 3RLFE 3UK4A 2G93A 1FQBA 4MLVA 3T22A 2DYXA 3FZVA 1B7HA 1QKBA 1QUIA 1B46A 1RYXA 2XX7A 3IB1A 2HAVA 3IJOB 3ILTB 3E13X 1FQDA 3K1PA 2H4IA 2DE4A 4U23A 1MPCA 1O64A 3PPQA 3K1MA 2OCUA 1A99A 1OLAA 2Q8JA 1Y3QA 3TTNA 3MVWA 4O3BA 4HCWA 1LLSA 4RYAA 5AE4A 4YKIA 4HS7A 5J1DA 1N76A 2RCBA 4DXUA 1UTHB 4XKRA 2F34A 3FJGA 4F39A 4LZ5A 5H8NA 1ZMGA 1AL3A 5I2NB 2P1SA 4G68B 1DOTA 5H8QA 5H8FB 3KEIA 4U2RA 3N94A 4ZEFA 1S50A 4IO7A 1N3XA 3SEXA 4GWOA 3QIMA 3B6QA 5DVFA 4YB7A 3DP4A 5I2KB 1D9YA 3RY3A 3IAZA 1IXIA 3SEWA 4H1XA 1NL5A 1OMPA 3QSLA 4OEUA 3KJTA 3USDA 1B5HA 2RCAA 1MQHA 3GBBA 2A5SA 1FTLA 5DTBA 1DTGA 4ND9A 1MG1A 1VFDA 1XVYA 3M3FA 1IUDA 4YB5A 4N07A 3FUZA 4MF3A 1XOCA 4OETA 2ZNTA 1M5BA 3MP8A 3M3LA 3H03A 2ALUA 3IJXB 1Y1MA 3G7WA 3HCQA 2XX8A 1MXUA 4ZS9A 3HPIA 3MAMA 1LAFE 3EPEA 2XXUA 1PEBA 4ESWA 4QSEA 3GZGA 4LATA 3KBRA 4P0IA 1N7WA 4OVJA 1HSEA 3DP8A 3HN0A 3MW0A 3GBAA 2GH9A 1MH3A 3M8UA 1Y3PA 2H25A 1XT8A 3RPWA 2UVIA 4XKQA 2RC7A 2Y7WA 4RK9A 2VHAA 3K6VA 2F7CA 3OD7A 1N3WA 3FVKA 1XVXA 1L5TA 3VV5A 2A5TA 3O6HA 2HFBA 3VE1B 3ZKLA 1ZIUA 4XIGQ 4EQ9A 3PUXE 1B58A 1AMFA 1B7UA 1FW0A 1H45A 5AA1A 3ILUB 4NEDA 3U94A 3O29A 1A55A 1VE4A 1NNFA 1NFTA 3RGYA 4BDLA 1B2HA 3FJMA 2Y7IA 1EZ9A 2Y7PA 4F3BA 3MZBA 4LZ8A 1SYHA 1USYH 3LSWA 4ZEKA 4F1YA 1MDP1 2ESNA 4POWA 3EHSA 2AIXA 5H8NB 2DOJA 3T9HB 3VFJA 2DXYA 3KN8A 5B70A 2IEEA 2QPQA 2G29A 2UVGA 4NF4B 1TT1A 4RNSA 5KDTA 4NE4A 3N26A 3KG2A 4NF8A 4U22A 1JW4A 4IB2A 3VVEA 4R6HA 3G3JA 5L9OA 2HQ0A 3S9LC 4JSOA 4ZEIA 1H76A 5I59A 1MY3A 1Y4CA 1MXWA 2PT2A 3PD8A 1QULA
chains in the Genus database with same CATH superfamily
1WHNA 1GGGA 1ZAAC 1VFEA 2FNCA 1F2IG 2YLNA 2YPNA 3H6TA 2REJA 1IEJA 3MVYA 3B7DA 4JWYA 1G0IA 3PPPA 2GFEA 2Z8DA 4MNPA 4JI8E 1H3DA 3T9XB 2LMZA 4LA9A 1URSA 4HE1A 3JTZA 1HSLA 3T96B 1GTKA 4PFIA 4LQ2A 4JI3E 5HPQA 4F29A 3SETA 3C36A 3TDJA 1YUJA 1LFHA 2V86A 1R6ZA 5B7DA 4U1ZA 2FHYA 4KFQA 1YUIA 2CSHA 1NH8A 1B32A 2VQEE 2EJ4A 3KC1A 2P0SA 2RTXA 2M4IA 3VLUA 3C34A 2ZYNA 1FTAA 4ZZEA 3VVDA 2I4CA 2KHXA 4P1EA 2I13A 1PJQA 1B52A 2B7TA 2ZZXA 3FV1A 4X48A 3TQWA 5KL5A 2WKYA 3PUWE 4MAGA 1NV6A 1DCUA 1B1XA 2I58A 1I6QA 4GWWA 3LUYA 2EMFA 2EMIA 2V4CA 2F6GA 1IITA 4EUOA 1YXIA 3P1XA 1P1OA 5I84A 2FA7A 2F8BA 2YRHA 5ITOA 2LTSA 2L3CA 3TCHA 5DYHA 1BK4A 2MDGA 4C1UA 3LLHA 1XS5A 3E9XA 4PFWA 4GX3A 5KL2A 3CRBA 2EM6A 2OWTA 1J1NA 4DMIA 3RUMA 1FBCA 1LEVA 2O1MA 1J26A 1DGCA 1M5FA 2GRVA 3TZAA 3LSFB 3TTLA 2EN1A 5L8DA 4THIA 4ZEDA 4N81A 3OMLA 4DXBA 5LDZA 4QFKA 4IR8A 3HV1A 3CIJA 3BIDA 1Y4TA 2QMXA 4XEQA 4MLQA 2FV4B 4WYQB 1OVTA 1UN6B 4P0GA 3IB0A 3JYRA 2NUVA 3B6WA 1T4NA 3O66A 3K2DA 1I6BA 1LLMC 1BBOA 3RTFB 2N3HA 4HXVA 1RMDA 4H8IA 5T3JA 5EQ7A 2XWVA 4M1VA 3KZZA 2OBGA 3UIFA 4QSDA 2OJTA 1VR5A 2RKMA 1FQAA 4U4SA 5CBRA 1IQOA 3AXFA 4ZYHA 4LQ5A 3J81C 4ESXA 2PFZA 5EHMA 1LB9A 4BDOA 2XXIA 2EPKX 2B3FA 3PGFA 4JSDA 5CMMA 3N6TA 3OO9A 4OVPA 2EPXA 1SDXA 3KFMA 4IY5A 4R73A 1DMBA 1FPBA 2RC9A 4M9VC 3O6GA 4K3FA 1MGTA 2B7VA 1B3LA 3BFUA 2EOJA 3BKIB 3E3KA 2XXVA 2OWZA 5KCJB 2HZLA 2B4MA 2Y84A 4F2JC 1LAGE 4JVIA 1AOVA 3FATA 4DI3D 1EYIA 3MP1A 4M2ZA 2O7UA 4PE5B 4KR5A 1AIVA 4FEDA 3QUFA 1T0KA 5A6AA 5KL7A 4TOZA 5KDTB 3PUZE 4MHFA 3A3CA 3TCFA 1B3EA 4YICA 2DGCA 4PQJA 2EM0A 4E0WA 3K6QA 2EN4A 3IORA 4M4GA 4OFOA 2AL5A 2EMWA 3IFAA 4KYSA 3RYDA 3E79A 1EYKA 4DXCA 2VGQA 3CI8A 4QFPA 4GXAA 5CMCA 1PB7A 4R2EA 3O28A 5I59B 1IXCA 3SEUA 2FYIA 4GEQB 5ET5A 4O24A 3D4CA 4G77A 2EMLA 1IBLE 1FTKA 4PAFA 4DUYE 2EQ0A 1EKZA 5TPAA 3TPAA 4N8GA 4BLAA 2FGGA 1NV5A 2CMOA 4DCXA 1SVXB 3MVXA 2EMCA 2ONSA 4PFUA 1US4A 4I8CA 1FPDA 4X62E 2X7PA 4GL8A 2LE2A 4PFRA 2ZNUA 4LF9E 4N91A 5ET6A 4HE0A 5A5XB 5LL6R 1ZBTA 2GPIA 1B1HA 5AA2D 1WODA 2ZYMA 3LMLA 1FSAA 5KL4A 3ADLA 4C1TA 1Y9UA 2RC8A 3THIA 3VLWA 4PF6A 2V84A 3ODBA 4LF6E 2NUGA 2UXCE 3MP6A 4QFLA 3H6VA 1MPBA 4ELOA 2O68A 4PFBA 1TN9A 5F7VA 1FQEA 4MBPA 5I56B 2EOEA 1MY2A 2M7QA 2ABHA 4YU0A 4RPOA 1GV8A 3QMFA 3L00A 2L3JA 4R2AA 3RN8A 3RMPA 1DK4A 2QVVA 1YYKA 4EQ7A 2M1SA 2V93A 2I9IA 4MEVA 2P3NA 3TQLA 4AB6A 1FBFA 1FCKA 2YSPA 3P7IA 1LBCA 1P1QA 1LBZA 2DLQA 1US5A 4QFNA 2NVUB 4NXME 5CMKA 3F11A 2QMWA 3IO6A 4ELPA 2CT1A 4NF5B 5TP9A 2ANJA 4I3YA 4HCYA 3OXNA 5LLQA 1PJSA 1JETA 1POTA 3GXAA 3VVFA 4F2QA 3ZS6A 2F7BA 2B3TB 4NF6A 2E0SA 4DDDA 3RT8A 2VPNA 4QF9A 2Q88A 3IOVA 1JNFA 3TKDA 4WXCA 1N84A 1Y20A 4R2BA 1MY4A 1B5IA 2P2AA 2OZZA 3TMGA 4F3GA 2LBSB 1HNWE 3KSXA 2DSFA 2XA5A 2R8TA 2OWSA 2RINA 5A5LA 1D3KA 1A1LA 4LFAE 1M5EA 2BB8A 5HM4B 3K01A 4FE8A 2LJHA 1JK1A 5H8SA 3WAFA 1N7XA 1JW5A 2DWJA 3BBRA 5EYFA 2N8XA 1I6AA 5K2XA 1TXFA 1AAYA 2PVUA 2XXHA 5DEXB 1MQGA 3H4ZA 4BHBA 4JDFA 3IK6B 4JBZA 3OOAA 2A25A 1URDA 1SYIA 1X48A 3T66A 3I5OA 4JXIA 3SEVA 2YTQA 3JU0A 1YPNA 4I1DA 2EMBA 1DSNA 4UACA 2QL3A 1M5DA 2VOZA 4QBAA 5ET8A 3LBSA 4EF1A 3K4UA 4OQOA 2WBBA 1FTJA 2B3BA 2HXRA 1LAHE 3HXLA 3D4GA 1LAXA 5FLXC 3TELA 3KBZA 1H44A 3SKPA 1J5EE 1JK2A 2AYSA 1FBHA 4DZ1A 4LN5A 3AUZA 2EM7A 3ISPA 1PB8A 4KWYA 2XXTA 5CM6A 2EPZA 5I7IA 4TLMB 3H6UA 3ZKKA 3O6IA 1PJTA 2THIA 3ECRA 3LC8A 2WCC3 2ENAA 3MHSC 2ODRD 2E1SA 4GX6A 3H3GA 1ZTYA 3A3UA 2QS2A 1NUXA 1XHYA 1FQCA 4FEBA 2ODRC 2YTPA 2DP8A 2ZXTA 4YZZA 4X1BA 5A6KA 4EXLA 3DELB 2OLBA 3EHUA 1MS7A 4ZECA 1LCTA 1WVJA 4LFCE 2CTDA 2F35A 3C9HA 1B51A 4GWZA 4QXDA 2BJIA 2YZTA 4F22A 4G68C 1LFGA 2L2NA 3SDFA 5AA2A 1NNPA 2XHDA 5K2YA 1UIUA 1EH6A 1G2DC 3KGCA 4PETA 4GX4A 3SESA 4BDQA 3CSGA 1FPKA 4BDMA 1MQJA 3TFLA 5ICTA 2GHBA 4R2CA 5FTIA 4KYEA 5TSEA 4ISUA 4JWXA 1ZBMA 1IMUA 2KQZA 2GHAA 3PMVA 4F1UA 1CE2A 3MJNA 1FJGE 1NV2A 2J7JA 4F3PA 4NMYA 1F9BA 1YCJA 4BHCA 4OMBA 3PU5A 2RSIA 4GQOA 3F6GA 3UP9A 2RS7A 3Q28A 3OSRA 4LTYA 5CC2A 2WX9A 1WHQA 3OO7A 2O69A 2V83A 4DLDA 1ZU0A 1Q1KA 4U4XA 4KHZE 5JEIA 2EM2A 2FTXB 1EYJA 2YTGA 4QSCA 3I3VA 3N6UA 4ZDMA 4FORA 1JVYA 2PYYA 2XXRA 4LONB 4O8MA 5ITPA 1RYOA 4FATA 2WBUA 4G4PA 4R2FA 1YSAC 3C35A 3EPHA 5H8QB 2DRPA 1MY0A 3VHTB 4TQUQ 4GWUA 3KOTA 2EOMA 2DWIA 4G8NA 4XTCQ 5DT6A 3PV0E 1D4NA 2EMZA 5CMBA 3CFZA 2HAUA 1SD3A 2UYEA 3K6WA 3T1BA 2JOXA 4FK5C 5AA4A 1LB8A 2IA4A 3Q25A 1X6EA 3S9EA 2R9JA 1NCSA 1B3FA 4O7IA 5DW8A 3FVOA 1YYWA 1PBPA 3G3HA 2I4BA 4LZ7A 4NXNE 3VYYA 1FTOA 4F19A 3R6UA 2HEUA 4PF8A 2QVUA 2XXWA 2UVJA 3PPNA 3AV0A 4G2ZA 2PRTA 3KZYA 2EWLA 4OZ9A 1UILA 2V87A 1L4SA 3HQ1A 3U72A 1LBBA 4P56A 2L33A 2VE7C 1O7TA 4R72A 2XXYA 3C33A 5ESYA 1S7YA 2DSYA 1B6HA 3MYUA 2P3VA 2WEFA 2WBDA 4I3EA 3EPKA 4R74A 1SBPA 3U8QA 4IO2A 2HZKA 1LSTA 2DVZA 4GKJE 2PT1A 1P1UA 1SI0A 2DLKA 2UVHA 4POXA 4PBQA 4FIMA 4UA8A 1ZBQA 1A8FA 4GD5A 1NNKA 4KPTA 1XC1A 2LTRA 5IT9C 1Q9DA 4ZE9A 3KOSA 4ONYA 1UTBA 3LR1A 2QSXA 2QFLA 4NN3A 1PBQA 3C4BA 4G8HA 1SW4A 4BBYA 3T9UA 4ZE8A 2EQ1A 4Q8RA 2DDKA 5A6BD 3K0VA 4AS4A 3OELA 1GVCA 1X5WA 2D9HA 3MVZA 3S9MC 4N13A 4DV3E 3HHGA 1DBZA 4H0WA 2Q2CA 1FBEA 1MH4A 4R6YA 1IQ7A 2QRYA 2QJEA 4WSPA 4DR1E 2V3QA 4NWCA 4Q30B 1JW1A 3D1RA 4OERA 2KLFA 5KL3A 5JTYA 3IFCA 3VXBA 4G68A 2Q2AA 2EMXA 2VRDA 4OHNA 5FHMA 1B4ZA 1B3HA 4X9JA 4GRKA 1ZR9A 5IM2A 4H5GA 5EQAA 1EZPA 4DR4E 2H9BA 2ENHA 1A1HA 2F36A 2NOOA 1BB8A 5I57A 1RKMA 2F6PA 4NF0A 2ONRA 3EPJA 3B50A 1Y1ZA 5IZ1A 3IX1A 4G8MA 5BWJA 3IOTA 4ZZAA 1G2FC 3FD3A 1OQGA 2A5TB 2Z23A 2V3UA 4DV4E 1NV1A 2DB2A 3EF7A 1WDNA 3CFXA 1NV7A 1GR2A 2Q8UA 2V25A 3FVGA 1BIYA 4R2SA 4XXUA 3IOUA 3FBPA 2EPNA 1X49A 3HPSA 1R9LA 4G61A 1B40A 2NWJA 4DV6E 3PMWA 1X6HA 1T4LB 2ONKE 2DWHA 1Y3NA 1MXYA 4OVRA 2JYAA 2EN2A 4OENA 4HEIA 1SW1A 3DP6A 1NH7A 4ELQA 4ZEBA 3FXUA 2EMYA 2MC5A 1P99A 3QUJA 4OVSA 3FXQA 3KN3A 4R9FA 2EM4A 2IHR1 2D5WA 4LUBA 3G3FA 4EQBA 2XD3A 2WYKA 2O84X 2I0CA 5L9SA 4M0VA 3PMXA 3S4UA 2RF1A 4Q5TA 2RS6A 1UIVA 3QG5C 1RC7A 1FPEA 4BC7A 4BDNA 4FJPA 1EZOA 4F9BB 4Z0IA 2PX1A 1OVBA 4PAKA 5CBSA 2F78A 3CG3A 3TTMA 5AA3A 2NXOA 3BFTA 3RTWB 2LUQA 2LVHA 3IOWA 4F18A 4F9AB 4B3SE 3RT6B 4NF8B 1B3GA 4P9KA 4JI2E 3MUQA 2Q8MA 4PAIA 1MY1A 3C4TA 5H8HA 3TYHA 5AA4B 2YTIA 1HNZE 1JEVA 3K02A 4GWYA 3Q26A 4RA1A 4RJZA 3C31A 4X1DA 4DCYA 2EPAA 3A09A 4P11A 1QVSA 3QAXA 3UN6A 3PUVE 2JOBA 1FTMA 2VP1A 4GL0A 4F2OA 1POY1 4P7DA 2H98A 2I3WA 1QUKA 3T93B 4IY6A 3KWRA 3C4MA 1KJKA 2CZIA 3UGWA 5DVJA 3FJ7A 1MRPA 1IMDA 4YY3E 1IIWA 4O3AA 4F54A 4JVCA 2EN3A 3G3KA 4GBWA 1N0TA 3CR9A 2UXAA 3LSXA 3ZSFA 4IO5A 3VXCA 1YZ0A 2PMSA 4P47A 2ELZA 4XKNA 4QFOA 1Z7ME 2Z22A 2K7IA 4NTLA 3O97A 5A6BA 1BKAA 2EM9A 1UTBB 4O3CA 4PE3A 3SERA 1FPJA 5ICQA 1URGA 1A1IA 3W9WA 1USYE 4JI7E 4LVQA 5FTHA 4PTKA 3Q29A 2QS1A 4C0RA 5ADZA 3OO6A 2OX3A 3PUYE 2I3VA 2X26A 1R9QA 3J7AG 2Y5KA 4RK2A 1YYZA 4IO3A 3IWBA 1M5CA 2YRKA 4PGPA 1IXHA 4QHQA 1WRJA 3EQ1A 1MDQA 4BC9A 4YKJA 4LP2B 2LT7A 1A1GA 3G3IA 3O2AA 1MQDA 4PGNA 2HPGA 2ZNSA 1T4OA 2F97A 4O5GA 1LBVA 1A40A 4M30A 2YTDA 4BS9A 1DTZA 4OVQA 5JTYB 5I58A 4HE2A 1MPDA 4U21A 2M8CA 4NG7A 4NF4A 4OXVA 3Q27A 4X64E 1ZKBA 4IJDA 1LCFA 2N3GA 3S2VA 3IR1A 2NUEA 2YSOA 4OWDA 3MBPA 5I57B 3H6WA 2WBTA 1NV0A 2O1LA 2O51A 3CVGA 1ZU1A 2QS3A 3UA8A 4L17A 2X7QA 1MXVA 5CFFE 4OFLA 1IQSA 4L5NC 2Y7KA 1XNRE 1DPEA 3MSTA 4MFIA 3K00A 1NUWA 1H43A 4EDPA 3KN7A 1D9VA 1GZ6A 3HPZA 3FVNA 1JEUA 2XXKA 1A8EA 4IS1C 4XFEA 1SW2A 2JVAA 5ELVA 4KCCA 3JAMC 3TTKA 3H06B 5LMNE 1MM6A 1GQEA 1PB9A 5HBCA 4HTGA 2CZKA 1KWHA 3K6UA 4PFYA 4GWSA 4N17A 4O4KA 4PBHA 5F3WA 1S9TA 4QRZA 4R8OA 1QUJA 2ZYKA 4WEPA 1WJPA 1NNTA 4WX9A 4NZVA 4WFTA 4PFTA 1QU6A 2JJKA 1FKAE 2AL4A 4MCOA 5KL6A 4PCDA 1FJ6A 4GVOA 4WXJA 4N6PA 1OIBA 3OO8A 2ENCA 2FIEA 1B5JA 2EM5A 3HFUA 3MZ1A 2V3TA 4XKPA 4R03A 2EOSA 2F7AA 1LBWA 2LCEA 2L2MA 1QKAA 2LAOA 1MEYC 3WAEA 2HXWA 1QGXA 1A54A 1SW5A 1FPLA 3VLVA 3K6XA 2XXXA 4DUZE 3QYTA 1UHZA 1N36E 2BJJX 3IWCA 1ELJA 5CI5A 1STUA 1UQWA 4DE8A 1B9JA 1YAEA 2PBWA 2JWOA 4YB6A 1KA1A 1X6FA 4RPNA 5F1QA 1RDXA 4F9CB 1LGBC 1T39A 1NKXA 2O6AA 3H09A 4OESA 1TFDA 4GFRA 5H8HB 5TU0A 4AQYE 4PDDA 4GLIA 4I9DA 5L9MA 3FV2A 5FHOA 4O43A 4R2PA 4JV5E 2R1FA 4R75A 2YJPA 4DIGA 4LF4E 3CSBA 3U92A 4RXLA 4KD5A 5TPAB 1P1WA 1IXGA 1T38A 1B4HA 3MWBA 2Q89A 3ONMA 3MC2A 2WZOA 3MPLA 3G3GA 1Z7NE 4L8NA 2UUAE 2NABA 2F3DA 3FGSA 5AE3A 4KYDA 1NUZA 4KI0E 4JI1E 1YYOA 4KQPA 1JVXA 3I6VA 3TUSA 4R9GA 2W7YA 4WKMA 4F31B 1BP5A 4U1OA 5AASA 2VPOA 3KSJA 4YKKA 1OLCA 2YU8A 1YTVA 2EPUA 1NMUA 1B05A 4GXSB 1LBXA 3TODA 4H67A 2MKZA 3ADJA 5KZTA 5FHNA 3S9NC 3B6TA 1DQ3A 3TAJA 3V8XB 2DE2A 2EL6A 1ZJLA 2M9AA 3KJ7A 4Z7EA 4F1VA 1Q35A 4DR5E 4N8YA 2OK2A 2EN6A 4Q0CA 5EHSA 5IZ3A 5I5PA 1IZ1A 4OYVA 1RQ0A 2Y7RA 4DR2E 1K9YA 4JVDA 1SQYA 1KZ8A 4DV1E 4DR6E 2HHHE 4N4UA 5A2QC 4F6MA 4WEDA 1CB6A 4H8JA 1R1NA 1TWYA 2EPPA 2Z8FA 3TCGA 2EMAA 2F8DA 5TP9B 4PP0A 1TF3A 1IMCA 5KCJA 4N15A 4H5FA 2EOFA 4EF2A 1INPA 1NV3A 3KZGA 4GZNC 4B3ME 3IO4A 3B8BA 1BLFA 4JWOA 4NF6B 5I58B 3K1NA 2EL4A 4WXDA 4IGRA 2NUFA 3V89B 3N5LA 5ET7A 2EOXA 2DVCA 5LTCA 4YMBA 5BUUA 1QW0A 4I62A 1DI2A 1FRPA 2CZLA 4J8ZA 2FVZA 2YTNA 3TTRA 4NX1A 1ZLQA 4N6KA 3SEYA 4H65A 2ZMBA 1EH3A 1FBPA 1B0HA 2I0BA 1XMQE 4XF5A 3C32A 4NWDA 5IGAA 4ECFA 1Z1BA 2K4VA 4OX9E 1P47A 4MNIA 4IGTA 1A1KA 3DLNA 1HSJA 3QXMA 4FECA 5IKBA 4GOTA 3FXBA 4E0XA 2KR0A 3M3KA 3MQ9A 2REGA 2MKDA 2VD2A 2ZYOA 4PC9A 4LF8E 1IMBA 1ATGA 3T1HE 3V83A 2F4VE 2RPCA 3OEMA 4HW8A 5FBPA 2Z8EA 2FIXA 1XNQE 3BGHA 2DMIA 1TFAA 1EU8A 4IO6A 2ADRA 1BTJA 4O7MA 2I49A 3LSLA 1FBGA 5A5XA 1OQHA 3EKIA 2H5YA 2EPRA 4ELRA 1I69A 2O7IA 3GLBA 2DIXA 4YKPA 5EQ9A 2V8QB 3JV9A 2UXBE 2L6MA 1SI1A 3OSQA 4GIZA 4DR7E 3LUZA 1JQFA 1XI6A 3T9VA 3EPLA 4YHHE 1FQFA 2EZ6A 2Q9TA 1KA0A 4GWXA 3RQTA 3PPOA 2MC6A 4OANA 3F6HA 2EPOA 2YTJA 4AB5A 5IAIA 5EYGA 1B0LA 5EQ8A 4X8WA 4ZYDA 3HHFA 5I56A 3DF6A 4GF8A 2DE3A 1UTHA 1II5A 3RPLA 1TF6A 1B7ZA 2UYFA 2D21A 5LOMA 1ANFA 3R26A 2JXPA 3DJWA 1HNXE 5I2NA 1EH7A 1B69A 5DVIA 4JI6E 3PPRA 2L92A 4OFJA 5H8FA 1I94E 1NV4A 4NF5A 3TEPA 4BDRA 1MXZA 1BBGA 5CRYA 3V5AA 1PKPA 2XXPA 2G7HA 3FIRA 2DMYA 3OENA 2HGHA 4RY1A 1QJMA 3CHGA 3ZOQB 3L6GA 3L6HA 5ISUA 3EHTA 2LV2A 5I2KA 2UU9E 2B4LA 4JB7A 2DWAA 2YU5A 2YT4A 5T6JA 3VDFA 5AA2B 2PFYA 3IL1B 4AQ4A 2R71A 3IB2A 3U1OA 1MM7A 5AE1A 2R6GE 3JZJA 4X8RA 3HTXA 1NUYA 1P1NA 3U93A 2DQVA 4X9TA 2VD3A 4KZSA 2D3IA 3HO7A 3E78A 3E4RA 4YAHX 2XX9A 2LRSA 4KHPE 4IO4A 2R76A 4DV0E 2EQ3A 1PDAA 3CFLA 3OEKA 4OOGC 3FXRA 4YMAA 4MNCA 3FIGA 2Q74A 3T1YE 2V89A 5DEXA 5BR8E 3R7XA 1A7LA 1NEIA 3MPKA 1AH5A 4OTEA 1SR9A 2QS4A 2I6EA 1AWBA 2EMGA 3RNNA 5IZ3B 4MMPA 3VYXA 4AS5A 1VSOA 4P8BA 2VT5A 1SPIA 4KCDA 2DXRA 3MZ9A 2DS9A 4DV7E 4P3LA 3QK6A 2EN8A 4JI4E 1G0HA 4H45A 4N4RB 1N04A 1DPPA 2H99A 2HCAA 2EOQA 4F3SA 3FASA 4MH5A 2RQLA 3H7MA 2LUPB 2EOYA 4FBPA 1MXXA 2B65A 4OEVA 4JI5E 1MQIA 4NHRA 4GBVA 5JK4A 3EN3A 1IBKE 3W9VA 2UUCE 4R2RA 5F24A 3HSTA 2I48A 5IWAE 1IMFA 1N32E 3OMBA 4H6DA 2JY9A 1O63A 4EXKA 3C6MA 3J7Yp 5M2VA 2EPMX 2WBSA 5AE2A 5A6JA 1JP4A 2XD2A 3W15C 3O9PA 4Q28A 4DV2E 1LFIA 3CG1A 4FAJA 3UORA 2XXQA 3DM0A 4TLLB 2F5XA 4R6KA 1PC3A 3PD9A 1FPFA 3KC0A 3RLFE 4N6DA 3UK4A 2G93A 4WSGA 4H46A 1CNQA 4P78A 3THNA 1YZ9A 1FQBA 2ELYA 4MLVA 4K0KE 2GQ1A 3T22A 4DV5E 2EPLX 2DYXA 3FZVA 1B7HA 4BCAA 1QKBA 1QUIA 1B46A 1RYXA 2XX7A 4LFBE 4I8OA 3IB1A 2VF1A 2HAVA 3IJOB 3E13X 3ILTB 1FQDA 1KYQA 3K1PA 3U65A 2VQFE 2H4IA 4JI0E 2DE4A 4U23A 1MPCA 1O64A 2CEYA 3PPQA 3K1MA 2OCUA 1A99A 1NI9A 3ROJA 1A1FA 1OLAA 3SZPA 3BIGA 3LV0A 4UABA 2Q8JA 1Y3QA 4WPYA 3TTNA 2EOHA 3MVWA 5AC5A 2EL5A 4O3BA 4HCWA 4PDHA 2UUBE 1LLSA 2EORA 3T0JA 4RYAA 2CPNA 2ZM6E 1XMOE 5AC4A 4X66E 5AE4A 4YKIA 2ZZWA 4HS7A 5J1DA 1WXRA 4TUIA 1N76A 2BBGA 2RCBA 4DXUA 1VDWA 1UTHB 4XKRA 2F34A 3FJGA 3RPLB 2ZZVA 1FBDA 4F39A 3VK6A 4LZ5A 5H8NA 2E72A 1ZMGA 2XWOA 2F3BA 1AL3A 5I2NB 3ADIA 4MX6A 2P1SA 2EPCA 4DR3E 1O0WA 4G68B 1DOTA 2LO3A 5H8QA 5H8FB 2H36X 3PTYA 3KEIA 2EOOA 2GHFA 2E1MA 4U2RA 2EM8A 3N94A 3ADGA 4ZEFA 2YTOA 1S50A 4IO7A 1N3XA 2CZHA 3SEXA 4GWOA 3QIMA 3B6QA 5DVFA 4YB7A 3M99B 3DP4A 2L8TA 5I2KB 1D9YA 3RY3A 3IAZA 1IXIA 2L5VA 3SEWA 4H1XA 1NL5A 4DI4B 1OMPA 3QSLA 1N3GA 4OEUA 3KJTA 4LF5E 3USDA 1FPIA 1B5HA 1QNTA 2RCAA 2KONA 4P1LA 1MQHA 3GBBA 2A5SA 1FTLA 5DTBA 1DTGA 4ND9A 3UK3C 2EOIA 1MG1A 1VFDA 1XVYA 4B3TE 3BF2A 2E5LE 3C6KA 3BIHA 3M3FA 3NOHA 1IUDA 4YB5A 4N07A 2EOZA 3FUZA 2HJJA 4MF3A 1XOCA 4OETA 2MDRA 4R2QA 1RDYA 2ZNTA 1M5BA 3MP8A 4OVTA 3M3LA 3H03A 2ALUA 3IJXB 3BBGA 1N33E 1Y1MA 4ZYGA 5LMUE 3G7WA 5IXMB 2YTEA 3HCQA 2XX8A 1MXUA 4ZS9A 3HPIA 1LBYA 3MAMA 1LAFE 3EPEA 4LF7E 1K9ZA 2XXUA 4LU9A 1PEBA 4ESWA 4QSEA 4RHBB 4NGUA 3GZGA 4LATA 3KBRA 4P0IA 1FPGA 1N7WA 4OVJA 1HSEA 2GLIA 5EYHA 3DP8A 2HC5A 3HN0A 3MW0A 2V88A 3GBAA 2GH9A 2JP9A 4OA4A 1IBME 1MH3A 3M8UA 1Y3PA 2H25A 1XT8A 3RPWA 2UVIA 3THOB 2QVRA 2LJUA 1IMAA 2RC7A 4XKQA 1X47A 2Y7WA 2PCRA 2XWIA 4I40A 4MJOA 4RK9A 2CEXA 2EE8A 2VHAA 4NQ8A 3K6VA 2F7CA 5J16A 4Q35B 3OD7A 1N3WA 3FVKA 4X04A 1XVXA 1L5TA 3VV5A 3GYYA 5I3SA 2A5TA 3O6HA 2Y5LA 2HFBA 3VE1B 3ZKLA 1ZIUA 4O94A 4XIGQ 1D9QA 4EQ9A 4DKKA 1IMEA 3PUXE 1B58A 2JPAA 1AMFA 2MKNA 2XWKA 1B7UA 1FW0A 1UBDC 1FJ9A 1A1JA 1H45A 5AA1A 3ILUB 3MSWA 3J80C 4NEDA 3U94A 2HHMA 2WYPA 4GKKE 3O29A 1A55A 2YRMA 5IV8B 1RDZA 1VE4A 1NNFA 1NFTA 5IZZA 3RGYA 4BDLA 1B2HA 2RSMA 3FJMA 2Y7IA 3A29A 1EZ9A 2Y7PA 3TQMA 4F3BA 4BMJA 3MZBA 4LZ8A 1N34E 1SYHA 1X3CA 1USYH 3LSWA 3IWDA 4ZEKA 4F1YA 4F6NA 4ZYEA 1SFEA 2EP3A 2L2KB 1MDP1 2ESNA 4POWA 2KOUA 3EHSA 2AIXA 5H8NB 4KXPA 2JR1A 3OTOE 2YTFA 2DOJA 3T9HB 3VFJA 2DXYA 1HR0E 2EM3A 2EMHA 3KN8A 1EH8A 5B70A 2IEEA 5DNYA 2QPQA 2G29A 2UVGA 2B9DA 4NAPA 4NF4B 1TT1A 2FBPA 4RNSA 2V85A 5KDTA 4B3RE 4NE4A 2EN7A 1YFHA 3N26A 4NHBA 2NA2A 3KG2A 4NF8A 2YWQA 4U22A 3MHHC 1JW4A 5A69A 4TUGA 4IB2A 3VVEA 4R2DA 4R6HA 3G3JA 5L9OA 2HQ0A 3S9LC 4JSOA 4ZEIA 2UXDE 1H76A 5I59A 4RH8A 1MY3A 4JYAE 1Y4CA 2EMKA 4MIJA 1MXWA 4X65E 2PT2A 3PD8A 1QULA
chains in the Genus database with same CATH topology
1GGGA 1VFEA 2FNCA 2YLNA 2YPNA 3H6TA 2REJA 1IEJA 3MVYA 3B7DA 4JWYA 3PPPA 2GFEA 2Z8DA 1H3DA 3T9XB 4LA9A 1URSA 1HSLA 3T96B 1GTKA 4LQ2A 5HPQA 4F29A 3SETA 3C36A 3TDJA 1LFHA 1R6ZA 5B7DA 4U1ZA 4KFQA 1NH8A 1B32A 2P0SA 3VLUA 3C34A 2ZYNA 4ZZEA 3VVDA 2I4CA 1B52A 3FV1A 4X48A 3TQWA 2WKYA 3PUWE 1B1XA 2I58A 1I6QA 3LUYA 2F6GA 1IITA 4EUOA 1P1OA 5I84A 2FA7A 5ITOA 3TCHA 5DYHA 4C1UA 1XS5A 3E9XA 4PFWA 3CRBA 2OWTA 1J1NA 3RUMA 2O1MA 1M5FA 2GRVA 3TZAA 3LSFB 3TTLA 5L8DA 4THIA 4ZEDA 4DXBA 4QFKA 3HV1A 3CIJA 1Y4TA 2QMXA 4MLQA 1OVTA 4P0GA 3IB0A 3JYRA 2NUVA 3B6WA 3O66A 3K2DA 1I6BA 3RTFB 4H8IA 4M1VA 2OBGA 3UIFA 4QSDA 2OJTA 1VR5A 2RKMA 1FQAA 4U4SA 5CBRA 3AXFA 4LQ5A 4ESXA 5EHMA 1LB9A 4BDOA 2XXIA 2B3FA 3PGFA 4JSDA 5CMMA 3N6TA 3OO9A 1SDXA 3KFMA 4IY5A 4R73A 1DMBA 2RC9A 3O6GA 4K3FA 1B3LA 3BFUA 3E3KA 3BKIB 5KCJB 2XXVA 2HZLA 2Y84A 1LAGE 1AOVA 3FATA 3MP1A 2O7UA 4PE5B 4KR5A 1AIVA 4FEDA 3QUFA 1T0KA 4TOZA 5KDTB 3PUZE 3A3CA 3TCFA 1B3EA 4YICA 4PQJA 4E0WA 3IORA 4M4GA 4OFOA 2AL5A 4KYSA 4DXCA 2VGQA 3CI8A 4QFPA 4GXAA 5CMCA 1PB7A 3O28A 5I59B 1IXCA 3SEUA 2FYIA 3D4CA 4G77A 1FTKA 5TPAA 3TPAA 4BLAA 2CMOA 4DCXA 1SVXB 3MVXA 2ONSA 4PFUA 1US4A 4I8CA 2X7PA 4GL8A 2ZNUA 5A5XB 1B1HA 5AA2D 1WODA 2ZYMA 4C1TA 1Y9UA 2RC8A 3THIA 3VLWA 2V84A 3ODBA 4ELOA 3MP6A 4QFLA 3H6VA 1MPBA 2O68A 5F7VA 1FQEA 4MBPA 5I56B 1MY2A 2ABHA 4YU0A 4RPOA 1GV8A 3RN8A 4EQ7A 2V93A 3TQLA 4AB6A 1FCKA 3P7IA 1LBCA 1P1QA 1US5A 4QFNA 2NVUB 5CMKA 3F11A 2QMWA 3IO6A 4ELPA 4NF5B 5TP9A 2ANJA 4HCYA 3OXNA 1JETA 1POTA 3GXAA 3VVFA 4F2QA 3ZS6A 2F7BA 4NF6A 2E0SA 4DDDA 3RT8A 4QF9A 2Q88A 3IOVA 1JNFA 3TKDA 1N84A 1Y20A 4R2BA 1MY4A 1B5IA 2P2AA 2OZZA 3TMGA 4F3GA 3KSXA 2DSFA 2OWSA 2RINA 1D3KA 1M5EA 5HM4B 3K01A 4FE8A 5H8SA 3WAFA 1N7XA 1JW5A 2DWJA 3BBRA 5EYFA 1I6AA 5K2XA 1TXFA 2PVUA 2XXHA 5DEXB 1MQGA 3H4ZA 4JDFA 3IK6B 4JBZA 3OOAA 1URDA 1SYIA 3T66A 3I5OA 4JXIA 3SEVA 1YPNA 4I1DA 1DSNA 4UACA 2QL3A 1M5DA 2VOZA 3LBSA 4EF1A 3K4UA 4OQOA 1FTJA 2B3BA 1LAHE 3D4GA 1LAXA 3TELA 1H44A 3SKPA 2AYSA 4DZ1A 1PB8A 2XXTA 5CM6A 4TLMB 3H6UA 3ZKKA 3O6IA 2THIA 3ECRA 3LC8A 2E1SA 3H3GA 1ZTYA 3A3UA 2QS2A 1XHYA 1FQCA 4FEBA 2DP8A 2ZXTA 4YZZA 4X1BA 4EXLA 3DELB 2OLBA 3EHUA 1MS7A 4ZECA 1LCTA 1WVJA 2F35A 3C9HA 1B51A 4F22A 4G68C 1LFGA 3SDFA 5AA2A 1NNPA 2XHDA 5K2YA 1UIUA 3KGCA 4PETA 3SESA 4BDQA 3CSGA 4BDMA 1MQJA 3TFLA 5ICTA 2GHBA 5FTIA 4KYEA 4ISUA 4JWXA 1ZBMA 2GHAA 3PMVA 4F1UA 1CE2A 3MJNA 4F3PA 4NMYA 1F9BA 1YCJA 4OMBA 3PU5A 4GQOA 3UP9A 3Q28A 3OSRA 5CC2A 3OO7A 2O69A 4DLDA 1ZU0A 1Q1KA 4U4XA 4KHZE 5JEIA 4QSCA 3I3VA 3N6UA 4ZDMA 4FORA 1JVYA 2PYYA 2XXRA 4LONB 5ITPA 1RYOA 4FATA 4R2FA 4G4PA 3C35A 5H8QB 1MY0A 4TQUQ 3KOTA 4G8NA 2DWIA 4XTCQ 5DT6A 3PV0E 1D4NA 5CMBA 3CFZA 2HAUA 1SD3A 2UYEA 3K6WA 5AA4A 1LB8A 2IA4A 3Q25A 3S9EA 2R9JA 1B3FA 3FVOA 1PBPA 3G3HA 2I4BA 4LZ7A 1FTOA 4F19A 3R6UA 2HEUA 2XXWA 2UVJA 3PPNA 4G2ZA 4OZ9A 3U72A 1LBBA 1O7TA 4R72A 2XXYA 3C33A 1S7YA 1B6HA 4R74A 1SBPA 3U8QA 4IO2A 1LSTA 2DVZA 2HZKA 2PT1A 1P1UA 1SI0A 2UVHA 4POXA 4FIMA 4UA8A 1A8FA 4GD5A 1NNKA 4KPTA 1XC1A 4ZE9A 3KOSA 4ONYA 1UTBA 3LR1A 2QSXA 1PBQA 4G8HA 1SW4A 3T9UA 4ZE8A 4Q8RA 3K0VA 3OELA 1GVCA 3MVZA 3S9MC 4N13A 3HHGA 4H0WA 2Q2CA 1MH4A 4R6YA 1IQ7A 2QRYA 2QJEA 2V3QA 4NWCA 4Q30B 1JW1A 4OERA 2KLFA 5JTYA 3VXBA 4G68A 2Q2AA 4OHNA 5FHMA 1B4ZA 1B3HA 4GRKA 4H5GA 1EZPA 2H9BA 2F36A 2NOOA 5I57A 1RKMA 2F6PA 2ONRA 1Y1ZA 3IX1A 4G8MA 5BWJA 3IOTA 4ZZAA 3FD3A 1OQGA 2A5TB 2Z23A 2V3UA 3EF7A 1WDNA 3CFXA 1GR2A 2V25A 3FVGA 1BIYA 4XXUA 3IOUA 1R9LA 1B40A 2NWJA 3PMWA 2ONKE 2DWHA 1Y3NA 1MXYA 4OENA 1SW1A 3DP6A 1NH7A 4ELQA 4ZEBA 3FXUA 1P99A 3QUJA 3FXQA 3KN3A 4R9FA 2D5WA 4LUBA 3G3FA 4EQBA 2XD3A 2O84X 2I0CA 5L9SA 3PMXA 3S4UA 2RF1A 4Q5TA 1UIVA 4BDNA 4FJPA 1EZOA 4Z0IA 2PX1A 1OVBA 5CBSA 2F78A 3CG3A 5AA3A 3TTMA 2NXOA 3BFTA 3RTWB 4F18A 3IOWA 3RT6B 4NF8B 1B3GA 3MUQA 1MY1A 5H8HA 3TYHA 5AA4B 1JEVA 3K02A 3Q26A 4RA1A 4RJZA 3C31A 4X1DA 4DCYA 3A09A 4P11A 1QVSA 3QAXA 3UN6A 3PUVE 1FTMA 2VP1A 4GL0A 4F2OA 1POY1 2H98A 2I3WA 1QUKA 3T93B 4IY6A 3C4MA 3UGWA 5DVJA 3FJ7A 1MRPA 1IIWA 4O3AA 3G3KA 1N0TA 3CR9A 2UXAA 3LSXA 3ZSFA 4IO5A 3VXCA 2PMSA 4XKNA 4QFOA 1Z7ME 2Z22A 4NTLA 3O97A 1BKAA 1UTBB 4O3CA 3SERA 5ICQA 1URGA 3W9WA 1USYE 4LVQA 5FTHA 3Q29A 2QS1A 4C0RA 3OO6A 3PUYE 2I3VA 2X26A 1R9QA 4RK2A 4IO3A 1M5CA 1IXHA 4QHQA 3EQ1A 1MDQA 4YKJA 4LP2B 3G3IA 3O2AA 1MQDA 2ZNSA 2F97A 1A40A 1DTZA 5JTYB 5I58A 1MPDA 4U21A 2M8CA 4NF4A 4OXVA 3Q27A 1ZKBA 1LCFA 3S2VA 3IR1A 4OWDA 3MBPA 5I57B 3H6WA 2O1LA 2O51A 3CVGA 2QS3A 3UA8A 4L17A 2X7QA 1MXVA 4OFLA 2Y7KA 1DPEA 4MFIA 3K00A 4EDPA 1H43A 3KN7A 1D9VA 3FVNA 1JEUA 1A8EA 1SW2A 5ELVA 4KCCA 3TTKA 3H06B 1MM6A 1PB9A 5HBCA 4HTGA 1KWHA 3K6UA 4PFYA 1S9TA 4QRZA 1QUJA 2ZYKA 4WEPA 1NNTA 4PFTA 2AL4A 4GVOA 4WXJA 4N6PA 1OIBA 3OO8A 1B5JA 3MZ1A 2V3TA 4XKPA 2F7AA 2LAOA 1QKAA 3WAEA 2HXWA 1A54A 1SW5A 3VLVA 3K6XA 2XXXA 3QYTA 2BJJX 1ELJA 5CI5A 1UQWA 4DE8A 1B9JA 1YAEA 2PBWA 4YB6A 4RPNA 5F1QA 1LGBC 1NKXA 2O6AA 4OESA 1TFDA 4GFRA 5H8HB 5TU0A 4GLIA 4I9DA 5L9MA 3FV2A 5FHOA 4DIGA 4R75A 2YJPA 3CSBA 3U92A 4RXLA 5TPAB 4KD5A 1P1WA 1IXGA 3MWBA 1B4HA 2Q89A 3ONMA 3MC2A 3MPLA 3G3GA 1Z7NE 3FGSA 4KYDA 4KI0E 4KQPA 1JVXA 3I6VA 3TUSA 4R9GA 2W7YA 4WKMA 4F31B 1BP5A 4U1OA 4YKKA 3KSJA 1OLCA 1YTVA 1NMUA 1B05A 4GXSB 3TODA 4H67A 5KZTA 5FHNA 3S9NC 3B6TA 3TAJA 3V8XB 2DE2A 1ZJLA 3KJ7A 4Z7EA 4F1VA 1Q35A 2OK2A 4Q0CA 5EHSA 1IZ1A 4OYVA 2Y7RA 1SQYA 4WEDA 1CB6A 4H8JA 1R1NA 1TWYA 2Z8FA 3TCGA 2F8DA 5TP9B 4PP0A 5KCJA 4H5FA 4EF2A 3KZGA 3IO4A 4JWOA 1BLFA 4NF6B 5I58B 3K1NA 4IGRA 3V89B 3N5LA 2DVCA 4YMBA 5BUUA 1QW0A 4I62A 2CZLA 3TTRA 1ZLQA 3SEYA 4H65A 2ZMBA 1EH3A 1B0HA 2I0BA 3C32A 4NWDA 4ECFA 4IGTA 3DLNA 1HSJA 3QXMA 4FECA 5IKBA 4GOTA 4E0XA 3M3KA 3MQ9A 2REGA 2VD2A 2ZYOA 1ATGA 3V83A 3OEMA 4HW8A 2Z8EA 1TFAA 1EU8A 4IO6A 1BTJA 2I49A 3LSLA 5A5XA 1OQHA 2H5YA 4ELRA 1I69A 2O7IA 3GLBA 4YKPA 3JV9A 1SI1A 3OSQA 4GIZA 1JQFA 3T9VA 1FQFA 2Q9TA 3RQTA 3PPOA 4AB5A 5IAIA 1B0LA 3HHFA 5I56A 4GF8A 2DE3A 1UTHA 1II5A 1B7ZA 2UYFA 2D21A 5LOMA 1ANFA 3R26A 5I2NA 5DVIA 3PPRA 4OFJA 5H8FA 4NF5A 3TEPA 4BDRA 1MXZA 5CRYA 3V5AA 2XXPA 3FIRA 3OENA 4RY1A 1QJMA 3L6GA 3L6HA 5ISUA 3EHTA 5I2KA 4JB7A 2DWAA 3VDFA 5AA2B 3IL1B 4AQ4A 2R71A 3IB2A 3U1OA 1MM7A 2R6GE 3JZJA 1P1NA 3U93A 2DQVA 4X9TA 2VD3A 2D3IA 3HO7A 3E4RA 4YAHX 2XX9A 4IO4A 1PDAA 3CFLA 3OEKA 3FXRA 4YMAA 5DEXA 3R7XA 1A7LA 3MPKA 1AH5A 4OTEA 2QS4A 2I6EA 3RNNA 1VSOA 4KCDA 2DXRA 3MZ9A 2DS9A 3QK6A 1N04A 1DPPA 2H99A 2HCAA 4F3SA 3FASA 4MH5A 3H7MA 1MXXA 2B65A 4OEVA 1MQIA 5JK4A 3EN3A 3W9VA 3HSTA 2I48A 4H6DA 3OMBA 1O63A 4EXKA 5M2VA 2XD2A 3W15C 3O9PA 1LFIA 3CG1A 4FAJA 3UORA 2XXQA 3DM0A 4TLLB 2F5XA 4R6KA 1PC3A 3PD9A 3RLFE 3UK4A 2G93A 1FQBA 4MLVA 3T22A 2DYXA 3FZVA 1B7HA 1QKBA 1QUIA 1B46A 1RYXA 2XX7A 3IB1A 2HAVA 3IJOB 3ILTB 3E13X 1FQDA 3K1PA 2H4IA 2DE4A 4U23A 1MPCA 1O64A 3PPQA 3K1MA 2OCUA 1A99A 1OLAA 2Q8JA 1Y3QA 3TTNA 3MVWA 4O3BA 4HCWA 1LLSA 4RYAA 5AE4A 4YKIA 4HS7A 5J1DA 1N76A 2RCBA 4DXUA 1UTHB 4XKRA 2F34A 3FJGA 4F39A 4LZ5A 5H8NA 1ZMGA 1AL3A 5I2NB 2P1SA 4G68B 1DOTA 5H8QA 5H8FB 3KEIA 4U2RA 3N94A 4ZEFA 1S50A 4IO7A 1N3XA 3SEXA 4GWOA 3QIMA 3B6QA 5DVFA 4YB7A 3DP4A 5I2KB 1D9YA 3RY3A 3IAZA 1IXIA 3SEWA 4H1XA 1NL5A 1OMPA 3QSLA 4OEUA 3KJTA 3USDA 1B5HA 2RCAA 1MQHA 3GBBA 2A5SA 1FTLA 5DTBA 1DTGA 4ND9A 1MG1A 1VFDA 1XVYA 3M3FA 1IUDA 4YB5A 4N07A 3FUZA 4MF3A 1XOCA 4OETA 2ZNTA 1M5BA 3MP8A 3M3LA 3H03A 2ALUA 3IJXB 1Y1MA 3G7WA 3HCQA 2XX8A 1MXUA 4ZS9A 3HPIA 3MAMA 1LAFE 3EPEA 2XXUA 1PEBA 4ESWA 4QSEA 3GZGA 4LATA 3KBRA 4P0IA 1N7WA 4OVJA 1HSEA 3DP8A 3HN0A 3MW0A 3GBAA 2GH9A 1MH3A 3M8UA 1Y3PA 2H25A 1XT8A 3RPWA 2UVIA 4XKQA 2RC7A 2Y7WA 4RK9A 2VHAA 3K6VA 2F7CA 3OD7A 1N3WA 3FVKA 1XVXA 1L5TA 3VV5A 2A5TA 3O6HA 2HFBA 3VE1B 3ZKLA 1ZIUA 4XIGQ 4EQ9A 3PUXE 1B58A 1AMFA 1B7UA 1FW0A 1H45A 5AA1A 3ILUB 4NEDA 3U94A 3O29A 1A55A 1VE4A 1NNFA 1NFTA 3RGYA 4BDLA 1B2HA 3FJMA 2Y7IA 1EZ9A 2Y7PA 4F3BA 3MZBA 4LZ8A 1SYHA 1USYH 3LSWA 4ZEKA 4F1YA 1MDP1 2ESNA 4POWA 3EHSA 2AIXA 5H8NB 2DOJA 3T9HB 3VFJA 2DXYA 3KN8A 5B70A 2IEEA 2QPQA 2G29A 2UVGA 4NF4B 1TT1A 4RNSA 5KDTA 4NE4A 3N26A 3KG2A 4NF8A 4U22A 1JW4A 4IB2A 3VVEA 4R6HA 3G3JA 5L9OA 2HQ0A 3S9LC 4JSOA 4ZEIA 1H76A 5I59A 1MY3A 1Y4CA 1MXWA 2PT2A 3PD8A 1QULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGG A;  1VFE A;  2FNC A;  2YLN A;  2YPN A;  3H6T A;  2REJ A;  1IEJ A;  3MVY A;  3B7D A;  4JWY A;  3PPP A;  2GFE A;  2Z8D A;  1H3D A;  3T9X B;  4LA9 A;  1URS A;  1HSL A;  3T96 B;  1GTK A;  4LQ2 A;  5HPQ A;  4F29 A;  3SET A;  3C36 A;  3TDJ A;  1LFH A;  1R6Z A;  5B7D A;  4U1Z A;  4KFQ A;  1NH8 A;  1B32 A;  2P0S A;  3VLU A;  3C34 A;  2ZYN A;  4ZZE A;  3VVD A;  2I4C A;  1B52 A;  3FV1 A;  4X48 A;  3TQW A;  2WKY A;  3PUW E;  1B1X A;  2I58 A;  1I6Q A;  3LUY A;  2F6G A;  1IIT A;  4EUO A;  1P1O A;  5I84 A;  2FA7 A;  5ITO A;  3TCH A;  5DYH A;  4C1U A;  1XS5 A;  3E9X A;  4PFW A;  3CRB A;  2OWT A;  1J1N A;  3RUM A;  2O1M A;  1M5F A;  2GRV A;  3TZA A;  3LSF B;  3TTL A;  5L8D A;  4THI A;  4ZED A;  4DXB A;  4QFK A;  3HV1 A;  3CIJ A;  1Y4T A;  2QMX A;  4MLQ A;  1OVT A;  4P0G A;  3IB0 A;  3JYR A;  2NUV A;  3B6W A;  3O66 A;  3K2D A;  1I6B A;  3RTF B;  4H8I A;  4M1V A;  2OBG A;  3UIF A;  4QSD A;  2OJT A;  1VR5 A;  2RKM A;  1FQA A;  4U4S A;  5CBR A;  3AXF A;  4LQ5 A;  4ESX A;  5EHM A;  1LB9 A;  4BDO A;  2XXI A;  2B3F A;  3PGF A;  4JSD A;  5CMM A;  3N6T A;  3OO9 A;  1SDX A;  3KFM A;  4IY5 A;  4R73 A;  1DMB A;  2RC9 A;  3O6G A;  4K3F A;  1B3L A;  3BFU A;  3E3K A;  3BKI B;  5KCJ B;  2XXV A;  2HZL A;  2Y84 A;  1LAG E;  1AOV A;  3FAT A;  3MP1 A;  2O7U A;  4PE5 B;  4KR5 A;  1AIV A;  4FED A;  3QUF A;  1T0K A;  4TOZ A;  5KDT B;  3PUZ E;  3A3C A;  3TCF A;  1B3E A;  4YIC A;  4PQJ A;  4E0W A;  3IOR A;  4M4G A;  4OFO A;  2AL5 A;  4KYS A;  4DXC A;  2VGQ A;  3CI8 A;  4QFP A;  4GXA A;  5CMC A;  1PB7 A;  3O28 A;  5I59 B;  1IXC A;  3SEU A;  2FYI A;  3D4C A;  4G77 A;  1FTK A;  5TPA A;  3TPA A;  4BLA A;  2CMO A;  4DCX A;  1SVX B;  3MVX A;  2ONS A;  4PFU A;  1US4 A;  4I8C A;  2X7P A;  4GL8 A;  2ZNU A;  5A5X B;  1B1H A;  5AA2 D;  1WOD A;  2ZYM A;  4C1T A;  1Y9U A;  2RC8 A;  3THI A;  3VLW A;  2V84 A;  3ODB A;  4ELO A;  3MP6 A;  4QFL A;  3H6V A;  1MPB A;  2O68 A;  5F7V A;  1FQE A;  4MBP A;  5I56 B;  1MY2 A;  2ABH A;  4YU0 A;  4RPO A;  1GV8 A;  3RN8 A;  4EQ7 A;  2V93 A;  3TQL A;  4AB6 A;  1FCK A;  3P7I A;  1LBC A;  1P1Q A;  1US5 A;  4QFN A;  2NVU B;  5CMK A;  3F11 A;  2QMW A;  3IO6 A;  4ELP A;  4NF5 B;  5TP9 A;  2ANJ A;  4HCY A;  3OXN A;  1JET A;  1POT A;  3GXA A;  3VVF A;  4F2Q A;  3ZS6 A;  2F7B A;  4NF6 A;  2E0S A;  4DDD A;  3RT8 A;  4QF9 A;  2Q88 A;  3IOV A;  1JNF A;  3TKD A;  1N84 A;  1Y20 A;  4R2B A;  1MY4 A;  1B5I A;  2P2A A;  2OZZ A;  3TMG A;  4F3G A;  3KSX A;  2DSF A;  2OWS A;  2RIN A;  1D3K A;  1M5E A;  5HM4 B;  3K01 A;  4FE8 A;  5H8S A;  3WAF A;  1N7X A;  1JW5 A;  2DWJ A;  3BBR A;  5EYF A;  1I6A A;  5K2X A;  1TXF A;  2PVU A;  2XXH A;  5DEX B;  1MQG A;  3H4Z A;  4JDF A;  3IK6 B;  4JBZ A;  3OOA A;  1URD A;  1SYI A;  3T66 A;  3I5O A;  4JXI A;  3SEV A;  1YPN A;  4I1D A;  1DSN A;  4UAC A;  2QL3 A;  1M5D A;  2VOZ A;  3LBS A;  4EF1 A;  3K4U A;  4OQO A;  1FTJ A;  2B3B A;  1LAH E;  3D4G A;  1LAX A;  3TEL A;  1H44 A;  3SKP A;  2AYS A;  4DZ1 A;  1PB8 A;  2XXT A;  5CM6 A;  4TLM B;  3H6U A;  3ZKK A;  3O6I A;  2THI A;  3ECR A;  3LC8 A;  2E1S A;  3H3G A;  1ZTY A;  3A3U A;  2QS2 A;  1XHY A;  1FQC A;  4FEB A;  2DP8 A;  2ZXT A;  4YZZ A;  4X1B A;  4EXL A;  3DEL B;  2OLB A;  3EHU A;  1MS7 A;  4ZEC A;  1LCT A;  1WVJ A;  2F35 A;  3C9H A;  1B51 A;  4F22 A;  4G68 C;  1LFG A;  3SDF A;  5AA2 A;  1NNP A;  2XHD A;  5K2Y A;  1UIU A;  3KGC A;  4PET A;  3SES A;  4BDQ A;  3CSG A;  4BDM A;  1MQJ A;  3TFL A;  5ICT A;  2GHB A;  5FTI A;  4KYE A;  4ISU A;  4JWX A;  1ZBM A;  2GHA A;  3PMV A;  4F1U A;  1CE2 A;  3MJN A;  4F3P A;  4NMY A;  1F9B A;  1YCJ A;  4OMB A;  3PU5 A;  4GQO A;  3UP9 A;  3Q28 A;  3OSR A;  5CC2 A;  3OO7 A;  2O69 A;  4DLD A;  1ZU0 A;  1Q1K A;  4U4X A;  4KHZ E;  5JEI A;  4QSC A;  3I3V A;  3N6U A;  4ZDM A;  4FOR A;  1JVY A;  2PYY A;  2XXR A;  4LON B;  5ITP A;  1RYO A;  4FAT A;  4R2F A;  4G4P A;  3C35 A;  5H8Q B;  1MY0 A;  4TQU Q;  3KOT A;  4G8N A;  2DWI A;  4XTC Q;  5DT6 A;  3PV0 E;  1D4N A;  5CMB A;  3CFZ A;  2HAU A;  1SD3 A;  2UYE A;  3K6W A;  5AA4 A;  1LB8 A;  2IA4 A;  3Q25 A;  3S9E A;  2R9J A;  1B3F A;  3FVO A;  1PBP A;  3G3H A;  2I4B A;  4LZ7 A;  1FTO A;  4F19 A;  3R6U A;  2HEU A;  2XXW A;  2UVJ A;  3PPN A;  4G2Z A;  4OZ9 A;  3U72 A;  1LBB A;  1O7T A;  4R72 A;  2XXY A;  3C33 A;  1S7Y A;  1B6H A;  4R74 A;  1SBP A;  3U8Q A;  4IO2 A;  1LST A;  2DVZ A;  2HZK A;  2PT1 A;  1P1U A;  1SI0 A;  2UVH A;  4POX A;  4FIM A;  4UA8 A;  1A8F A;  4GD5 A;  1NNK A;  4KPT A;  1XC1 A;  4ZE9 A;  3KOS A;  4ONY A;  1UTB A;  3LR1 A;  2QSX A;  1PBQ A;  4G8H A;  1SW4 A;  3T9U A;  4ZE8 A;  4Q8R A;  3K0V A;  3OEL A;  1GVC A;  3MVZ A;  3S9M C;  4N13 A;  3HHG A;  4H0W A;  2Q2C A;  1MH4 A;  4R6Y A;  1IQ7 A;  2QRY A;  2QJE A;  2V3Q A;  4NWC A;  4Q30 B;  1JW1 A;  4OER A;  2KLF A;  5JTY A;  3VXB A;  4G68 A;  2Q2A A;  4OHN A;  5FHM A;  1B4Z A;  1B3H A;  4GRK A;  4H5G A;  1EZP A;  2H9B A;  2F36 A;  2NOO A;  5I57 A;  1RKM A;  2F6P A;  2ONR A;  1Y1Z A;  3IX1 A;  4G8M A;  5BWJ A;  3IOT A;  4ZZA A;  3FD3 A;  1OQG A;  2A5T B;  2Z23 A;  2V3U A;  3EF7 A;  1WDN A;  3CFX A;  1GR2 A;  2V25 A;  3FVG A;  1BIY A;  4XXU A;  3IOU A;  1R9L A;  1B40 A;  2NWJ A;  3PMW A;  2ONK E;  2DWH A;  1Y3N A;  1MXY A;  4OEN A;  1SW1 A;  3DP6 A;  1NH7 A;  4ELQ A;  4ZEB A;  3FXU A;  1P99 A;  3QUJ A;  3FXQ A;  3KN3 A;  4R9F A;  2D5W A;  4LUB A;  3G3F A;  4EQB A;  2XD3 A;  2O84 X;  2I0C A;  5L9S A;  3PMX A;  3S4U A;  2RF1 A;  4Q5T A;  1UIV A;  4BDN A;  4FJP A;  1EZO A;  4Z0I A;  2PX1 A;  1OVB A;  5CBS A;  2F78 A;  3CG3 A;  5AA3 A;  3TTM A;  2NXO A;  3BFT A;  3RTW B;  4F18 A;  3IOW A;  3RT6 B;  4NF8 B;  1B3G A;  3MUQ A;  1MY1 A;  5H8H A;  3TYH A;  5AA4 B;  1JEV A;  3K02 A;  3Q26 A;  4RA1 A;  4RJZ A;  3C31 A;  4X1D A;  4DCY A;  3A09 A;  4P11 A;  1QVS A;  3QAX A;  3UN6 A;  3PUV E;  1FTM A;  2VP1 A;  4GL0 A;  4F2O A;  1POY 1;  2H98 A;  2I3W A;  1QUK A;  3T93 B;  4IY6 A;  3C4M A;  3UGW A;  5DVJ A;  3FJ7 A;  1MRP A;  1IIW A;  4O3A A;  3G3K A;  1N0T A;  3CR9 A;  2UXA A;  3LSX A;  3ZSF A;  4IO5 A;  3VXC A;  2PMS A;  4XKN A;  4QFO A;  1Z7M E;  2Z22 A;  4NTL A;  3O97 A;  1BKA A;  1UTB B;  4O3C A;  3SER A;  5ICQ A;  1URG A;  3W9W A;  1USY E;  4LVQ A;  5FTH A;  3Q29 A;  2QS1 A;  4C0R A;  3OO6 A;  3PUY E;  2I3V A;  2X26 A;  1R9Q A;  4RK2 A;  4IO3 A;  1M5C A;  1IXH A;  4QHQ A;  3EQ1 A;  1MDQ A;  4YKJ A;  4LP2 B;  3G3I A;  3O2A A;  1MQD A;  2ZNS A;  2F97 A;  1A40 A;  1DTZ A;  5JTY B;  5I58 A;  1MPD A;  4U21 A;  2M8C A;  4NF4 A;  4OXV A;  3Q27 A;  1ZKB A;  1LCF A;  3S2V A;  3IR1 A;  4OWD A;  3MBP A;  5I57 B;  3H6W A;  2O1L A;  2O51 A;  3CVG A;  2QS3 A;  3UA8 A;  4L17 A;  2X7Q A;  1MXV A;  4OFL A;  2Y7K A;  1DPE A;  4MFI A;  3K00 A;  4EDP A;  1H43 A;  3KN7 A;  1D9V A;  3FVN A;  1JEU A;  1A8E A;  1SW2 A;  5ELV A;  4KCC A;  3TTK A;  3H06 B;  1MM6 A;  1PB9 A;  5HBC A;  4HTG A;  1KWH A;  3K6U A;  4PFY A;  1S9T A;  4QRZ A;  1QUJ A;  2ZYK A;  4WEP A;  1NNT A;  4PFT A;  2AL4 A;  4GVO A;  4WXJ A;  4N6P A;  1OIB A;  3OO8 A;  1B5J A;  3MZ1 A;  2V3T A;  4XKP A;  2F7A A;  2LAO A;  1QKA A;  3WAE A;  2HXW A;  1A54 A;  1SW5 A;  3VLV A;  3K6X A;  2XXX A;  3QYT A;  2BJJ X;  1ELJ A;  5CI5 A;  1UQW A;  4DE8 A;  1B9J A;  1YAE A;  2PBW A;  4YB6 A;  4RPN A;  5F1Q A;  1LGB C;  1NKX A;  2O6A A;  4OES A;  1TFD A;  4GFR A;  5H8H B;  5TU0 A;  4GLI A;  4I9D A;  5L9M A;  3FV2 A;  5FHO A;  4DIG A;  4R75 A;  2YJP A;  3CSB A;  3U92 A;  4RXL A;  5TPA B;  4KD5 A;  1P1W A;  1IXG A;  3MWB A;  1B4H A;  2Q89 A;  3ONM A;  3MC2 A;  3MPL A;  3G3G A;  1Z7N E;  3FGS A;  4KYD A;  4KI0 E;  4KQP A;  1JVX A;  3I6V A;  3TUS A;  4R9G A;  2W7Y A;  4WKM A;  4F31 B;  1BP5 A;  4U1O A;  4YKK A;  3KSJ A;  1OLC A;  1YTV A;  1NMU A;  1B05 A;  4GXS B;  3TOD A;  4H67 A;  5KZT A;  5FHN A;  3S9N C;  3B6T A;  3TAJ A;  3V8X B;  2DE2 A;  1ZJL A;  3KJ7 A;  4Z7E A;  4F1V A;  1Q35 A;  2OK2 A;  4Q0C A;  5EHS A;  1IZ1 A;  4OYV A;  2Y7R A;  1SQY A;  4WED A;  1CB6 A;  4H8J A;  1R1N A;  1TWY A;  2Z8F A;  3TCG A;  2F8D A;  5TP9 B;  4PP0 A;  5KCJ A;  4H5F A;  4EF2 A;  3KZG A;  3IO4 A;  4JWO A;  1BLF A;  4NF6 B;  5I58 B;  3K1N A;  4IGR A;  3V89 B;  3N5L A;  2DVC A;  4YMB A;  5BUU A;  1QW0 A;  4I62 A;  2CZL A;  3TTR A;  1ZLQ A;  3SEY A;  4H65 A;  2ZMB A;  1EH3 A;  1B0H A;  2I0B A;  3C32 A;  4NWD A;  4ECF A;  4IGT A;  3DLN A;  1HSJ A;  3QXM A;  4FEC A;  5IKB A;  4GOT A;  4E0X A;  3M3K A;  3MQ9 A;  2REG A;  2VD2 A;  2ZYO A;  1ATG A;  3V83 A;  3OEM A;  4HW8 A;  2Z8E A;  1TFA A;  1EU8 A;  4IO6 A;  1BTJ A;  2I49 A;  3LSL A;  5A5X A;  1OQH A;  2H5Y A;  4ELR A;  1I69 A;  2O7I A;  3GLB A;  4YKP A;  3JV9 A;  1SI1 A;  3OSQ A;  4GIZ A;  1JQF A;  3T9V A;  1FQF A;  2Q9T A;  3RQT A;  3PPO A;  4AB5 A;  5IAI A;  1B0L A;  3HHF A;  5I56 A;  4GF8 A;  2DE3 A;  1UTH A;  1II5 A;  1B7Z A;  2UYF A;  2D21 A;  5LOM A;  1ANF A;  3R26 A;  5I2N A;  5DVI A;  3PPR A;  4OFJ A;  5H8F A;  4NF5 A;  3TEP A;  4BDR A;  1MXZ A;  5CRY A;  3V5A A;  2XXP A;  3FIR A;  3OEN A;  4RY1 A;  1QJM A;  3L6G A;  3L6H A;  5ISU A;  3EHT A;  5I2K A;  4JB7 A;  2DWA A;  3VDF A;  5AA2 B;  3IL1 B;  4AQ4 A;  2R71 A;  3IB2 A;  3U1O A;  1MM7 A;  2R6G E;  3JZJ A;  1P1N A;  3U93 A;  2DQV A;  4X9T A;  2VD3 A;  2D3I A;  3HO7 A;  3E4R A;  4YAH X;  2XX9 A;  4IO4 A;  1PDA A;  3CFL A;  3OEK A;  3FXR A;  4YMA A;  5DEX A;  3R7X A;  1A7L A;  3MPK A;  1AH5 A;  4OTE A;  2QS4 A;  2I6E A;  3RNN A;  1VSO A;  4KCD A;  2DXR A;  3MZ9 A;  2DS9 A;  3QK6 A;  1N04 A;  1DPP A;  2H99 A;  2HCA A;  4F3S A;  3FAS A;  4MH5 A;  3H7M A;  1MXX A;  2B65 A;  4OEV A;  1MQI A;  5JK4 A;  3EN3 A;  3W9V A;  3HST A;  2I48 A;  4H6D A;  3OMB A;  1O63 A;  4EXK A;  5M2V A;  2XD2 A;  3W15 C;  3O9P A;  1LFI A;  3CG1 A;  4FAJ A;  3UOR A;  2XXQ A;  3DM0 A;  4TLL B;  2F5X A;  4R6K A;  1PC3 A;  3PD9 A;  3RLF E;  3UK4 A;  2G93 A;  1FQB A;  4MLV A;  3T22 A;  2DYX A;  3FZV A;  1B7H A;  1QKB A;  1QUI A;  1B46 A;  1RYX A;  2XX7 A;  3IB1 A;  2HAV A;  3IJO B;  3ILT B;  3E13 X;  1FQD A;  3K1P A;  2H4I A;  2DE4 A;  4U23 A;  1MPC A;  1O64 A;  3PPQ A;  3K1M A;  2OCU A;  1A99 A;  1OLA A;  2Q8J A;  1Y3Q A;  3TTN A;  3MVW A;  4O3B A;  4HCW A;  1LLS A;  4RYA A;  5AE4 A;  4YKI A;  4HS7 A;  5J1D A;  1N76 A;  2RCB A;  4DXU A;  1UTH B;  4XKR A;  2F34 A;  3FJG A;  4F39 A;  4LZ5 A;  5H8N A;  1ZMG A;  1AL3 A;  5I2N B;  2P1S A;  4G68 B;  1DOT A;  5H8Q A;  5H8F B;  3KEI A;  4U2R A;  3N94 A;  4ZEF A;  1S50 A;  4IO7 A;  1N3X A;  3SEX A;  4GWO A;  3QIM A;  3B6Q A;  5DVF A;  4YB7 A;  3DP4 A;  5I2K B;  1D9Y A;  3RY3 A;  3IAZ A;  1IXI A;  3SEW A;  4H1X A;  1NL5 A;  1OMP A;  3QSL A;  4OEU A;  3KJT A;  3USD A;  1B5H A;  2RCA A;  1MQH A;  3GBB A;  2A5S A;  1FTL A;  5DTB A;  1DTG A;  4ND9 A;  1MG1 A;  1VFD A;  1XVY A;  3M3F A;  1IUD A;  4YB5 A;  4N07 A;  3FUZ A;  4MF3 A;  1XOC A;  4OET A;  2ZNT A;  1M5B A;  3MP8 A;  3M3L A;  3H03 A;  2ALU A;  3IJX B;  1Y1M A;  3G7W A;  3HCQ A;  2XX8 A;  1MXU A;  4ZS9 A;  3HPI A;  3MAM A;  1LAF E;  3EPE A;  2XXU A;  1PEB A;  4ESW A;  4QSE A;  3GZG A;  4LAT A;  3KBR A;  4P0I A;  1N7W A;  4OVJ A;  1HSE A;  3DP8 A;  3HN0 A;  3MW0 A;  3GBA A;  2GH9 A;  1MH3 A;  3M8U A;  1Y3P A;  2H25 A;  1XT8 A;  3RPW A;  2UVI A;  4XKQ A;  2RC7 A;  2Y7W A;  4RK9 A;  2VHA A;  3K6V A;  2F7C A;  3OD7 A;  1N3W A;  3FVK A;  1XVX A;  1L5T A;  3VV5 A;  2A5T A;  3O6H A;  2HFB A;  3VE1 B;  3ZKL A;  1ZIU A;  4XIG Q;  4EQ9 A;  3PUX E;  1B58 A;  1AMF A;  1B7U A;  1FW0 A;  1H45 A;  5AA1 A;  3ILU B;  4NED A;  3U94 A;  3O29 A;  1A55 A;  1VE4 A;  1NNF A;  1NFT A;  3RGY A;  4BDL A;  1B2H A;  3FJM A;  2Y7I A;  1EZ9 A;  2Y7P A;  4F3B A;  3MZB A;  4LZ8 A;  1SYH A;  1USY H;  3LSW A;  4ZEK A;  4F1Y A;  1MDP 1;  2ESN A;  4POW A;  3EHS A;  2AIX A;  5H8N B;  2DOJ A;  3T9H B;  3VFJ A;  2DXY A;  3KN8 A;  5B70 A;  2IEE A;  2QPQ A;  2G29 A;  2UVG A;  4NF4 B;  1TT1 A;  4RNS A;  5KDT A;  4NE4 A;  3N26 A;  3KG2 A;  4NF8 A;  4U22 A;  1JW4 A;  4IB2 A;  3VVE A;  4R6H A;  3G3J A;  5L9O A;  2HQ0 A;  3S9L C;  4JSO A;  4ZEI A;  1H76 A;  5I59 A;  1MY3 A;  1Y4C A;  1MXW A;  2PT2 A;  3PD8 A;  1QUL A; 
#chains in the Genus database with same CATH topology
 1WHN A;  1GGG A;  1ZAA C;  1VFE A;  2FNC A;  1F2I G;  2YLN A;  2YPN A;  3H6T A;  2REJ A;  1IEJ A;  3MVY A;  3B7D A;  4JWY A;  1G0I A;  3PPP A;  2GFE A;  2Z8D A;  4MNP A;  4JI8 E;  1H3D A;  3T9X B;  2LMZ A;  4LA9 A;  1URS A;  4HE1 A;  3JTZ A;  1HSL A;  3T96 B;  1GTK A;  4PFI A;  4LQ2 A;  4JI3 E;  5HPQ A;  4F29 A;  3SET A;  3C36 A;  3TDJ A;  1YUJ A;  1LFH A;  2V86 A;  1R6Z A;  5B7D A;  4U1Z A;  2FHY A;  4KFQ A;  1YUI A;  2CSH A;  1NH8 A;  1B32 A;  2VQE E;  2EJ4 A;  3KC1 A;  2P0S A;  2RTX A;  2M4I A;  3VLU A;  3C34 A;  2ZYN A;  1FTA A;  4ZZE A;  3VVD A;  2I4C A;  2KHX A;  4P1E A;  2I13 A;  1PJQ A;  1B52 A;  2B7T A;  2ZZX A;  3FV1 A;  4X48 A;  3TQW A;  5KL5 A;  2WKY A;  3PUW E;  4MAG A;  1NV6 A;  1DCU A;  1B1X A;  2I58 A;  1I6Q A;  4GWW A;  3LUY A;  2EMF A;  2EMI A;  2V4C A;  2F6G A;  1IIT A;  4EUO A;  1YXI A;  3P1X A;  1P1O A;  5I84 A;  2FA7 A;  2F8B A;  2YRH A;  5ITO A;  2LTS A;  2L3C A;  3TCH A;  5DYH A;  1BK4 A;  2MDG A;  4C1U A;  3LLH A;  1XS5 A;  3E9X A;  4PFW A;  4GX3 A;  5KL2 A;  3CRB A;  2EM6 A;  2OWT A;  1J1N A;  4DMI A;  3RUM A;  1FBC A;  1LEV A;  2O1M A;  1J26 A;  1DGC A;  1M5F A;  2GRV A;  3TZA A;  3LSF B;  3TTL A;  2EN1 A;  5L8D A;  4THI A;  4ZED A;  4N81 A;  3OML A;  4DXB A;  5LDZ A;  4QFK A;  4IR8 A;  3HV1 A;  3CIJ A;  3BID A;  1Y4T A;  2QMX A;  4XEQ A;  4MLQ A;  2FV4 B;  4WYQ B;  1OVT A;  1UN6 B;  4P0G A;  3IB0 A;  3JYR A;  2NUV A;  3B6W A;  1T4N A;  3O66 A;  3K2D A;  1I6B A;  1LLM C;  1BBO A;  3RTF B;  2N3H A;  4HXV A;  1RMD A;  4H8I A;  5T3J A;  5EQ7 A;  2XWV A;  4M1V A;  3KZZ A;  2OBG A;  3UIF A;  4QSD A;  2OJT A;  1VR5 A;  2RKM A;  1FQA A;  4U4S A;  5CBR A;  1IQO A;  3AXF A;  4ZYH A;  4LQ5 A;  3J81 C;  4ESX A;  2PFZ A;  5EHM A;  1LB9 A;  4BDO A;  2XXI A;  2EPK X;  2B3F A;  3PGF A;  4JSD A;  5CMM A;  3N6T A;  3OO9 A;  4OVP A;  2EPX A;  1SDX A;  3KFM A;  4IY5 A;  4R73 A;  1DMB A;  1FPB A;  2RC9 A;  4M9V C;  3O6G A;  4K3F A;  1MGT A;  2B7V A;  1B3L A;  3BFU A;  2EOJ A;  3BKI B;  3E3K A;  2XXV A;  2OWZ A;  5KCJ B;  2HZL A;  2B4M A;  2Y84 A;  4F2J C;  1LAG E;  4JVI A;  1AOV A;  3FAT A;  4DI3 D;  1EYI A;  3MP1 A;  4M2Z A;  2O7U A;  4PE5 B;  4KR5 A;  1AIV A;  4FED A;  3QUF A;  1T0K A;  5A6A A;  5KL7 A;  4TOZ A;  5KDT B;  3PUZ E;  4MHF A;  3A3C A;  3TCF A;  1B3E A;  4YIC A;  2DGC A;  4PQJ A;  2EM0 A;  4E0W A;  3K6Q A;  2EN4 A;  3IOR A;  4M4G A;  4OFO A;  2AL5 A;  2EMW A;  3IFA A;  4KYS A;  3RYD A;  3E79 A;  1EYK A;  4DXC A;  2VGQ A;  3CI8 A;  4QFP A;  4GXA A;  5CMC A;  1PB7 A;  4R2E A;  3O28 A;  5I59 B;  1IXC A;  3SEU A;  2FYI A;  4GEQ B;  5ET5 A;  4O24 A;  3D4C A;  4G77 A;  2EML A;  1IBL E;  1FTK A;  4PAF A;  4DUY E;  2EQ0 A;  1EKZ A;  5TPA A;  3TPA A;  4N8G A;  4BLA A;  2FGG A;  1NV5 A;  2CMO A;  4DCX A;  1SVX B;  3MVX A;  2EMC A;  2ONS A;  4PFU A;  1US4 A;  4I8C A;  1FPD A;  4X62 E;  2X7P A;  4GL8 A;  2LE2 A;  4PFR A;  2ZNU A;  4LF9 E;  4N91 A;  5ET6 A;  4HE0 A;  5A5X B;  5LL6 R;  1ZBT A;  2GPI A;  1B1H A;  5AA2 D;  1WOD A;  2ZYM A;  3LML A;  1FSA A;  5KL4 A;  3ADL A;  4C1T A;  1Y9U A;  2RC8 A;  3THI A;  3VLW A;  4PF6 A;  2V84 A;  3ODB A;  4LF6 E;  2NUG A;  2UXC E;  3MP6 A;  4QFL A;  3H6V A;  1MPB A;  4ELO A;  2O68 A;  4PFB A;  1TN9 A;  5F7V A;  1FQE A;  4MBP A;  5I56 B;  2EOE A;  1MY2 A;  2M7Q A;  2ABH A;  4YU0 A;  4RPO A;  1GV8 A;  3QMF A;  3L00 A;  2L3J A;  4R2A A;  3RN8 A;  3RMP A;  1DK4 A;  2QVV A;  1YYK A;  4EQ7 A;  2M1S A;  2V93 A;  2I9I A;  4MEV A;  2P3N A;  3TQL A;  4AB6 A;  1FBF A;  1FCK A;  2YSP A;  3P7I A;  1LBC A;  1P1Q A;  1LBZ A;  2DLQ A;  1US5 A;  4QFN A;  2NVU B;  4NXM E;  5CMK A;  3F11 A;  2QMW A;  3IO6 A;  4ELP A;  2CT1 A;  4NF5 B;  5TP9 A;  2ANJ A;  4I3Y A;  4HCY A;  3OXN A;  5LLQ A;  1PJS A;  1JET A;  1POT A;  3GXA A;  3VVF A;  4F2Q A;  3ZS6 A;  2F7B A;  2B3T B;  4NF6 A;  2E0S A;  4DDD A;  3RT8 A;  2VPN A;  4QF9 A;  2Q88 A;  3IOV A;  1JNF A;  3TKD A;  4WXC A;  1N84 A;  1Y20 A;  4R2B A;  1MY4 A;  1B5I A;  2P2A A;  2OZZ A;  3TMG A;  4F3G A;  2LBS B;  1HNW E;  3KSX A;  2DSF A;  2XA5 A;  2R8T A;  2OWS A;  2RIN A;  5A5L A;  1D3K A;  1A1L A;  4LFA E;  1M5E A;  2BB8 A;  5HM4 B;  3K01 A;  4FE8 A;  2LJH A;  1JK1 A;  5H8S A;  3WAF A;  1N7X A;  1JW5 A;  2DWJ A;  3BBR A;  5EYF A;  2N8X A;  1I6A A;  5K2X A;  1TXF A;  1AAY A;  2PVU A;  2XXH A;  5DEX B;  1MQG A;  3H4Z A;  4BHB A;  4JDF A;  3IK6 B;  4JBZ A;  3OOA A;  2A25 A;  1URD A;  1SYI A;  1X48 A;  3T66 A;  3I5O A;  4JXI A;  3SEV A;  2YTQ A;  3JU0 A;  1YPN A;  4I1D A;  2EMB A;  1DSN A;  4UAC A;  2QL3 A;  1M5D A;  2VOZ A;  4QBA A;  5ET8 A;  3LBS A;  4EF1 A;  3K4U A;  4OQO A;  2WBB A;  1FTJ A;  2B3B A;  2HXR A;  1LAH E;  3HXL A;  3D4G A;  1LAX A;  5FLX C;  3TEL A;  3KBZ A;  1H44 A;  3SKP A;  1J5E E;  1JK2 A;  2AYS A;  1FBH A;  4DZ1 A;  4LN5 A;  3AUZ A;  2EM7 A;  3ISP A;  1PB8 A;  4KWY A;  2XXT A;  5CM6 A;  2EPZ A;  5I7I A;  4TLM B;  3H6U A;  3ZKK A;  3O6I A;  1PJT A;  2THI A;  3ECR A;  3LC8 A;  2WCC 3;  2ENA A;  3MHS C;  2ODR D;  2E1S A;  4GX6 A;  3H3G A;  1ZTY A;  3A3U A;  2QS2 A;  1NUX A;  1XHY A;  1FQC A;  4FEB A;  2ODR C;  2YTP A;  2DP8 A;  2ZXT A;  4YZZ A;  4X1B A;  5A6K A;  4EXL A;  3DEL B;  2OLB A;  3EHU A;  1MS7 A;  4ZEC A;  1LCT A;  1WVJ A;  4LFC E;  2CTD A;  2F35 A;  3C9H A;  1B51 A;  4GWZ A;  4QXD A;  2BJI A;  2YZT A;  4F22 A;  4G68 C;  1LFG A;  2L2N A;  3SDF A;  5AA2 A;  1NNP A;  2XHD A;  5K2Y A;  1UIU A;  1EH6 A;  1G2D C;  3KGC A;  4PET A;  4GX4 A;  3SES A;  4BDQ A;  3CSG A;  1FPK A;  4BDM A;  1MQJ A;  3TFL A;  5ICT A;  2GHB A;  4R2C A;  5FTI A;  4KYE A;  5TSE A;  4ISU A;  4JWX A;  1ZBM A;  1IMU A;  2KQZ A;  2GHA A;  3PMV A;  4F1U A;  1CE2 A;  3MJN A;  1FJG E;  1NV2 A;  2J7J A;  4F3P A;  4NMY A;  1F9B A;  1YCJ A;  4BHC A;  4OMB A;  3PU5 A;  2RSI A;  4GQO A;  3F6G A;  3UP9 A;  2RS7 A;  3Q28 A;  3OSR A;  4LTY A;  5CC2 A;  2WX9 A;  1WHQ A;  3OO7 A;  2O69 A;  2V83 A;  4DLD A;  1ZU0 A;  1Q1K A;  4U4X A;  4KHZ E;  5JEI A;  2EM2 A;  2FTX B;  1EYJ A;  2YTG A;  4QSC A;  3I3V A;  3N6U A;  4ZDM A;  4FOR A;  1JVY A;  2PYY A;  2XXR A;  4LON B;  4O8M A;  5ITP A;  1RYO A;  4FAT A;  2WBU A;  4G4P A;  4R2F A;  1YSA C;  3C35 A;  3EPH A;  5H8Q B;  2DRP A;  1MY0 A;  3VHT B;  4TQU Q;  4GWU A;  3KOT A;  2EOM A;  2DWI A;  4G8N A;  4XTC Q;  5DT6 A;  3PV0 E;  1D4N A;  2EMZ A;  5CMB A;  3CFZ A;  2HAU A;  1SD3 A;  2UYE A;  3K6W A;  3T1B A;  2JOX A;  4FK5 C;  5AA4 A;  1LB8 A;  2IA4 A;  3Q25 A;  1X6E A;  3S9E A;  2R9J A;  1NCS A;  1B3F A;  4O7I A;  5DW8 A;  3FVO A;  1YYW A;  1PBP A;  3G3H A;  2I4B A;  4LZ7 A;  4NXN E;  3VYY A;  1FTO A;  4F19 A;  3R6U A;  2HEU A;  4PF8 A;  2QVU A;  2XXW A;  2UVJ A;  3PPN A;  3AV0 A;  4G2Z A;  2PRT A;  3KZY A;  2EWL A;  4OZ9 A;  1UIL A;  2V87 A;  1L4S A;  3HQ1 A;  3U72 A;  1LBB A;  4P56 A;  2L33 A;  2VE7 C;  1O7T A;  4R72 A;  2XXY A;  3C33 A;  5ESY A;  1S7Y A;  2DSY A;  1B6H A;  3MYU A;  2P3V A;  2WEF A;  2WBD A;  4I3E A;  3EPK A;  4R74 A;  1SBP A;  3U8Q A;  4IO2 A;  2HZK A;  1LST A;  2DVZ A;  4GKJ E;  2PT1 A;  1P1U A;  1SI0 A;  2DLK A;  2UVH A;  4POX A;  4PBQ A;  4FIM A;  4UA8 A;  1ZBQ A;  1A8F A;  4GD5 A;  1NNK A;  4KPT A;  1XC1 A;  2LTR A;  5IT9 C;  1Q9D A;  4ZE9 A;  3KOS A;  4ONY A;  1UTB A;  3LR1 A;  2QSX A;  2QFL A;  4NN3 A;  1PBQ A;  3C4B A;  4G8H A;  1SW4 A;  4BBY A;  3T9U A;  4ZE8 A;  2EQ1 A;  4Q8R A;  2DDK A;  5A6B D;  3K0V A;  4AS4 A;  3OEL A;  1GVC A;  1X5W A;  2D9H A;  3MVZ A;  3S9M C;  4N13 A;  4DV3 E;  3HHG A;  1DBZ A;  4H0W A;  2Q2C A;  1FBE A;  1MH4 A;  4R6Y A;  1IQ7 A;  2QRY A;  2QJE A;  4WSP A;  4DR1 E;  2V3Q A;  4NWC A;  4Q30 B;  1JW1 A;  3D1R A;  4OER A;  2KLF A;  5KL3 A;  5JTY A;  3IFC A;  3VXB A;  4G68 A;  2Q2A A;  2EMX A;  2VRD A;  4OHN A;  5FHM A;  1B4Z A;  1B3H A;  4X9J A;  4GRK A;  1ZR9 A;  5IM2 A;  4H5G A;  5EQA A;  1EZP A;  4DR4 E;  2H9B A;  2ENH A;  1A1H A;  2F36 A;  2NOO A;  1BB8 A;  5I57 A;  1RKM A;  2F6P A;  4NF0 A;  2ONR A;  3EPJ A;  3B50 A;  1Y1Z A;  5IZ1 A;  3IX1 A;  4G8M A;  5BWJ A;  3IOT A;  4ZZA A;  1G2F C;  3FD3 A;  1OQG A;  2A5T B;  2Z23 A;  2V3U A;  4DV4 E;  1NV1 A;  2DB2 A;  3EF7 A;  1WDN A;  3CFX A;  1NV7 A;  1GR2 A;  2Q8U A;  2V25 A;  3FVG A;  1BIY A;  4R2S A;  4XXU A;  3IOU A;  3FBP A;  2EPN A;  1X49 A;  3HPS A;  1R9L A;  4G61 A;  1B40 A;  2NWJ A;  4DV6 E;  3PMW A;  1X6H A;  1T4L B;  2ONK E;  2DWH A;  1Y3N A;  1MXY A;  4OVR A;  2JYA A;  2EN2 A;  4OEN A;  4HEI A;  1SW1 A;  3DP6 A;  1NH7 A;  4ELQ A;  4ZEB A;  3FXU A;  2EMY A;  2MC5 A;  1P99 A;  3QUJ A;  4OVS A;  3FXQ A;  3KN3 A;  4R9F A;  2EM4 A;  2IHR 1;  2D5W A;  4LUB A;  3G3F A;  4EQB A;  2XD3 A;  2WYK A;  2O84 X;  2I0C A;  5L9S A;  4M0V A;  3PMX A;  3S4U A;  2RF1 A;  4Q5T A;  2RS6 A;  1UIV A;  3QG5 C;  1RC7 A;  1FPE A;  4BC7 A;  4BDN A;  4FJP A;  1EZO A;  4F9B B;  4Z0I A;  2PX1 A;  1OVB A;  4PAK A;  5CBS A;  2F78 A;  3CG3 A;  3TTM A;  5AA3 A;  2NXO A;  3BFT A;  3RTW B;  2LUQ A;  2LVH A;  3IOW A;  4F18 A;  4F9A B;  4B3S E;  3RT6 B;  4NF8 B;  1B3G A;  4P9K A;  4JI2 E;  3MUQ A;  2Q8M A;  4PAI A;  1MY1 A;  3C4T A;  5H8H A;  3TYH A;  5AA4 B;  2YTI A;  1HNZ E;  1JEV A;  3K02 A;  4GWY A;  3Q26 A;  4RA1 A;  4RJZ A;  3C31 A;  4X1D A;  4DCY A;  2EPA A;  3A09 A;  4P11 A;  1QVS A;  3QAX A;  3UN6 A;  3PUV E;  2JOB A;  1FTM A;  2VP1 A;  4GL0 A;  4F2O A;  1POY 1;  4P7D A;  2H98 A;  2I3W A;  1QUK A;  3T93 B;  4IY6 A;  3KWR A;  3C4M A;  1KJK A;  2CZI A;  3UGW A;  5DVJ A;  3FJ7 A;  1MRP A;  1IMD A;  4YY3 E;  1IIW A;  4O3A A;  4F54 A;  4JVC A;  2EN3 A;  3G3K A;  4GBW A;  1N0T A;  3CR9 A;  2UXA A;  3LSX A;  3ZSF A;  4IO5 A;  3VXC A;  1YZ0 A;  2PMS A;  4P47 A;  2ELZ A;  4XKN A;  4QFO A;  1Z7M E;  2Z22 A;  2K7I A;  4NTL A;  3O97 A;  5A6B A;  1BKA A;  2EM9 A;  1UTB B;  4O3C A;  4PE3 A;  3SER A;  1FPJ A;  5ICQ A;  1URG A;  1A1I A;  3W9W A;  1USY E;  4JI7 E;  4LVQ A;  5FTH A;  4PTK A;  3Q29 A;  2QS1 A;  4C0R A;  5ADZ A;  3OO6 A;  2OX3 A;  3PUY E;  2I3V A;  2X26 A;  1R9Q A;  3J7A G;  2Y5K A;  4RK2 A;  1YYZ A;  4IO3 A;  3IWB A;  1M5C A;  2YRK A;  4PGP A;  1IXH A;  4QHQ A;  1WRJ A;  3EQ1 A;  1MDQ A;  4BC9 A;  4YKJ A;  4LP2 B;  2LT7 A;  1A1G A;  3G3I A;  3O2A A;  1MQD A;  4PGN A;  2HPG A;  2ZNS A;  1T4O A;  2F97 A;  4O5G A;  1LBV A;  1A40 A;  4M30 A;  2YTD A;  4BS9 A;  1DTZ A;  4OVQ A;  5JTY B;  5I58 A;  4HE2 A;  1MPD A;  4U21 A;  2M8C A;  4NG7 A;  4NF4 A;  4OXV A;  3Q27 A;  4X64 E;  1ZKB A;  4IJD A;  1LCF A;  2N3G A;  3S2V A;  3IR1 A;  2NUE A;  2YSO A;  4OWD A;  3MBP A;  5I57 B;  3H6W A;  2WBT A;  1NV0 A;  2O1L A;  2O51 A;  3CVG A;  1ZU1 A;  2QS3 A;  3UA8 A;  4L17 A;  2X7Q A;  1MXV A;  5CFF E;  4OFL A;  1IQS A;  4L5N C;  2Y7K A;  1XNR E;  1DPE A;  3MST A;  4MFI A;  3K00 A;  1NUW A;  1H43 A;  4EDP A;  3KN7 A;  1D9V A;  1GZ6 A;  3HPZ A;  3FVN A;  1JEU A;  2XXK A;  1A8E A;  4IS1 C;  4XFE A;  1SW2 A;  2JVA A;  5ELV A;  4KCC A;  3JAM C;  3TTK A;  3H06 B;  5LMN E;  1MM6 A;  1GQE A;  1PB9 A;  5HBC A;  4HTG A;  2CZK A;  1KWH A;  3K6U A;  4PFY A;  4GWS A;  4N17 A;  4O4K A;  4PBH A;  5F3W A;  1S9T A;  4QRZ A;  4R8O A;  1QUJ A;  2ZYK A;  4WEP A;  1WJP A;  1NNT A;  4WX9 A;  4NZV A;  4WFT A;  4PFT A;  1QU6 A;  2JJK A;  1FKA E;  2AL4 A;  4MCO A;  5KL6 A;  4PCD A;  1FJ6 A;  4GVO A;  4WXJ A;  4N6P A;  1OIB A;  3OO8 A;  2ENC A;  2FIE A;  1B5J A;  2EM5 A;  3HFU A;  3MZ1 A;  2V3T A;  4XKP A;  4R03 A;  2EOS A;  2F7A A;  1LBW A;  2LCE A;  2L2M A;  1QKA A;  2LAO A;  1MEY C;  3WAE A;  2HXW A;  1QGX A;  1A54 A;  1SW5 A;  1FPL A;  3VLV A;  3K6X A;  2XXX A;  4DUZ E;  3QYT A;  1UHZ A;  1N36 E;  2BJJ X;  3IWC A;  1ELJ A;  5CI5 A;  1STU A;  1UQW A;  4DE8 A;  1B9J A;  1YAE A;  2PBW A;  2JWO A;  4YB6 A;  1KA1 A;  1X6F A;  4RPN A;  5F1Q A;  1RDX A;  4F9C B;  1LGB C;  1T39 A;  1NKX A;  2O6A A;  3H09 A;  4OES A;  1TFD A;  4GFR A;  5H8H B;  5TU0 A;  4AQY E;  4PDD A;  4GLI A;  4I9D A;  5L9M A;  3FV2 A;  5FHO A;  4O43 A;  4R2P A;  4JV5 E;  2R1F A;  4R75 A;  2YJP A;  4DIG A;  4LF4 E;  3CSB A;  3U92 A;  4RXL A;  4KD5 A;  5TPA B;  1P1W A;  1IXG A;  1T38 A;  1B4H A;  3MWB A;  2Q89 A;  3ONM A;  3MC2 A;  2WZO A;  3MPL A;  3G3G A;  1Z7N E;  4L8N A;  2UUA E;  2NAB A;  2F3D A;  3FGS A;  5AE3 A;  4KYD A;  1NUZ A;  4KI0 E;  4JI1 E;  1YYO A;  4KQP A;  1JVX A;  3I6V A;  3TUS A;  4R9G A;  2W7Y A;  4WKM A;  4F31 B;  1BP5 A;  4U1O A;  5AAS A;  2VPO A;  3KSJ A;  4YKK A;  1OLC A;  2YU8 A;  1YTV A;  2EPU A;  1NMU A;  1B05 A;  4GXS B;  1LBX A;  3TOD A;  4H67 A;  2MKZ A;  3ADJ A;  5KZT A;  5FHN A;  3S9N C;  3B6T A;  1DQ3 A;  3TAJ A;  3V8X B;  2DE2 A;  2EL6 A;  1ZJL A;  2M9A A;  3KJ7 A;  4Z7E A;  4F1V A;  1Q35 A;  4DR5 E;  4N8Y A;  2OK2 A;  2EN6 A;  4Q0C A;  5EHS A;  5IZ3 A;  5I5P A;  1IZ1 A;  4OYV A;  1RQ0 A;  2Y7R A;  4DR2 E;  1K9Y A;  4JVD A;  1SQY A;  1KZ8 A;  4DV1 E;  4DR6 E;  2HHH E;  4N4U A;  5A2Q C;  4F6M A;  4WED A;  1CB6 A;  4H8J A;  1R1N A;  1TWY A;  2EPP A;  2Z8F A;  3TCG A;  2EMA A;  2F8D A;  5TP9 B;  4PP0 A;  1TF3 A;  1IMC A;  5KCJ A;  4N15 A;  4H5F A;  2EOF A;  4EF2 A;  1INP A;  1NV3 A;  3KZG A;  4GZN C;  4B3M E;  3IO4 A;  3B8B A;  1BLF A;  4JWO A;  4NF6 B;  5I58 B;  3K1N A;  2EL4 A;  4WXD A;  4IGR A;  2NUF A;  3V89 B;  3N5L A;  5ET7 A;  2EOX A;  2DVC A;  5LTC A;  4YMB A;  5BUU A;  1QW0 A;  4I62 A;  1DI2 A;  1FRP A;  2CZL A;  4J8Z A;  2FVZ A;  2YTN A;  3TTR A;  4NX1 A;  1ZLQ A;  4N6K A;  3SEY A;  4H65 A;  2ZMB A;  1EH3 A;  1FBP A;  1B0H A;  2I0B A;  1XMQ E;  4XF5 A;  3C32 A;  4NWD A;  5IGA A;  4ECF A;  1Z1B A;  2K4V A;  4OX9 E;  1P47 A;  4MNI A;  4IGT A;  1A1K A;  3DLN A;  1HSJ A;  3QXM A;  4FEC A;  5IKB A;  4GOT A;  3FXB A;  4E0X A;  2KR0 A;  3M3K A;  3MQ9 A;  2REG A;  2MKD A;  2VD2 A;  2ZYO A;  4PC9 A;  4LF8 E;  1IMB A;  1ATG A;  3T1H E;  3V83 A;  2F4V E;  2RPC A;  3OEM A;  4HW8 A;  5FBP A;  2Z8E A;  2FIX A;  1XNQ E;  3BGH A;  2DMI A;  1TFA A;  1EU8 A;  4IO6 A;  2ADR A;  1BTJ A;  4O7M A;  2I49 A;  3LSL A;  1FBG A;  5A5X A;  1OQH A;  3EKI A;  2H5Y A;  2EPR A;  4ELR A;  1I69 A;  2O7I A;  3GLB A;  2DIX A;  4YKP A;  5EQ9 A;  2V8Q B;  3JV9 A;  2UXB E;  2L6M A;  1SI1 A;  3OSQ A;  4GIZ A;  4DR7 E;  3LUZ A;  1JQF A;  1XI6 A;  3T9V A;  3EPL A;  4YHH E;  1FQF A;  2EZ6 A;  2Q9T A;  1KA0 A;  4GWX A;  3RQT A;  3PPO A;  2MC6 A;  4OAN A;  3F6H A;  2EPO A;  2YTJ A;  4AB5 A;  5IAI A;  5EYG A;  1B0L A;  5EQ8 A;  4X8W A;  4ZYD A;  3HHF A;  5I56 A;  3DF6 A;  4GF8 A;  2DE3 A;  1UTH A;  1II5 A;  3RPL A;  1TF6 A;  1B7Z A;  2UYF A;  2D21 A;  5LOM A;  1ANF A;  3R26 A;  2JXP A;  3DJW A;  1HNX E;  5I2N A;  1EH7 A;  1B69 A;  5DVI A;  4JI6 E;  3PPR A;  2L92 A;  4OFJ A;  5H8F A;  1I94 E;  1NV4 A;  4NF5 A;  3TEP A;  4BDR A;  1MXZ A;  1BBG A;  5CRY A;  3V5A A;  1PKP A;  2XXP A;  2G7H A;  3FIR A;  2DMY A;  3OEN A;  2HGH A;  4RY1 A;  1QJM A;  3CHG A;  3ZOQ B;  3L6G A;  3L6H A;  5ISU A;  3EHT A;  2LV2 A;  5I2K A;  2UU9 E;  2B4L A;  4JB7 A;  2DWA A;  2YU5 A;  2YT4 A;  5T6J A;  3VDF A;  5AA2 B;  2PFY A;  3IL1 B;  4AQ4 A;  2R71 A;  3IB2 A;  3U1O A;  1MM7 A;  5AE1 A;  2R6G E;  3JZJ A;  4X8R A;  3HTX A;  1NUY A;  1P1N A;  3U93 A;  2DQV A;  4X9T A;  2VD3 A;  4KZS A;  2D3I A;  3HO7 A;  3E78 A;  3E4R A;  4YAH X;  2XX9 A;  2LRS A;  4KHP E;  4IO4 A;  2R76 A;  4DV0 E;  2EQ3 A;  1PDA A;  3CFL A;  3OEK A;  4OOG C;  3FXR A;  4YMA A;  4MNC A;  3FIG A;  2Q74 A;  3T1Y E;  2V89 A;  5DEX A;  5BR8 E;  3R7X A;  1A7L A;  1NEI A;  3MPK A;  1AH5 A;  4OTE A;  1SR9 A;  2QS4 A;  2I6E A;  1AWB A;  2EMG A;  3RNN A;  5IZ3 B;  4MMP A;  3VYX A;  4AS5 A;  1VSO A;  4P8B A;  2VT5 A;  1SPI A;  4KCD A;  2DXR A;  3MZ9 A;  2DS9 A;  4DV7 E;  4P3L A;  3QK6 A;  2EN8 A;  4JI4 E;  1G0H A;  4H45 A;  4N4R B;  1N04 A;  1DPP A;  2H99 A;  2HCA A;  2EOQ A;  4F3S A;  3FAS A;  4MH5 A;  2RQL A;  3H7M A;  2LUP B;  2EOY A;  4FBP A;  1MXX A;  2B65 A;  4OEV A;  4JI5 E;  1MQI A;  4NHR A;  4GBV A;  5JK4 A;  3EN3 A;  1IBK E;  3W9V A;  2UUC E;  4R2R A;  5F24 A;  3HST A;  2I48 A;  5IWA E;  1IMF A;  1N32 E;  3OMB A;  4H6D A;  2JY9 A;  1O63 A;  4EXK A;  3C6M A;  3J7Y p;  5M2V A;  2EPM X;  2WBS A;  5AE2 A;  5A6J A;  1JP4 A;  2XD2 A;  3W15 C;  3O9P A;  4Q28 A;  4DV2 E;  1LFI A;  3CG1 A;  4FAJ A;  3UOR A;  2XXQ A;  3DM0 A;  4TLL B;  2F5X A;  4R6K A;  1PC3 A;  3PD9 A;  1FPF A;  3KC0 A;  3RLF E;  4N6D A;  3UK4 A;  2G93 A;  4WSG A;  4H46 A;  1CNQ A;  4P78 A;  3THN A;  1YZ9 A;  1FQB A;  2ELY A;  4MLV A;  4K0K E;  2GQ1 A;  3T22 A;  4DV5 E;  2EPL X;  2DYX A;  3FZV A;  1B7H A;  4BCA A;  1QKB A;  1QUI A;  1B46 A;  1RYX A;  2XX7 A;  4LFB E;  4I8O A;  3IB1 A;  2VF1 A;  2HAV A;  3IJO B;  3E13 X;  3ILT B;  1FQD A;  1KYQ A;  3K1P A;  3U65 A;  2VQF E;  2H4I A;  4JI0 E;  2DE4 A;  4U23 A;  1MPC A;  1O64 A;  2CEY A;  3PPQ A;  3K1M A;  2OCU A;  1A99 A;  1NI9 A;  3ROJ A;  1A1F A;  1OLA A;  3SZP A;  3BIG A;  3LV0 A;  4UAB A;  2Q8J A;  1Y3Q A;  4WPY A;  3TTN A;  2EOH A;  3MVW A;  5AC5 A;  2EL5 A;  4O3B A;  4HCW A;  4PDH A;  2UUB E;  1LLS A;  2EOR A;  3T0J A;  4RYA A;  2CPN A;  2ZM6 E;  1XMO E;  5AC4 A;  4X66 E;  5AE4 A;  4YKI A;  2ZZW A;  4HS7 A;  5J1D A;  1WXR A;  4TUI A;  1N76 A;  2BBG A;  2RCB A;  4DXU A;  1VDW A;  1UTH B;  4XKR A;  2F34 A;  3FJG A;  3RPL B;  2ZZV A;  1FBD A;  4F39 A;  3VK6 A;  4LZ5 A;  5H8N A;  2E72 A;  1ZMG A;  2XWO A;  2F3B A;  1AL3 A;  5I2N B;  3ADI A;  4MX6 A;  2P1S A;  2EPC A;  4DR3 E;  1O0W A;  4G68 B;  1DOT A;  2LO3 A;  5H8Q A;  5H8F B;  2H36 X;  3PTY A;  3KEI A;  2EOO A;  2GHF A;  2E1M A;  4U2R A;  2EM8 A;  3N94 A;  3ADG A;  4ZEF A;  2YTO A;  1S50 A;  4IO7 A;  1N3X A;  2CZH A;  3SEX A;  4GWO A;  3QIM A;  3B6Q A;  5DVF A;  4YB7 A;  3M99 B;  3DP4 A;  2L8T A;  5I2K B;  1D9Y A;  3RY3 A;  3IAZ A;  1IXI A;  2L5V A;  3SEW A;  4H1X A;  1NL5 A;  4DI4 B;  1OMP A;  3QSL A;  1N3G A;  4OEU A;  3KJT A;  4LF5 E;  3USD A;  1FPI A;  1B5H A;  1QNT A;  2RCA A;  2KON A;  4P1L A;  1MQH A;  3GBB A;  2A5S A;  1FTL A;  5DTB A;  1DTG A;  4ND9 A;  3UK3 C;  2EOI A;  1MG1 A;  1VFD A;  1XVY A;  4B3T E;  3BF2 A;  2E5L E;  3C6K A;  3BIH A;  3M3F A;  3NOH A;  1IUD A;  4YB5 A;  4N07 A;  2EOZ A;  3FUZ A;  2HJJ A;  4MF3 A;  1XOC A;  4OET A;  2MDR A;  4R2Q A;  1RDY A;  2ZNT A;  1M5B A;  3MP8 A;  4OVT A;  3M3L A;  3H03 A;  2ALU A;  3IJX B;  3BBG A;  1N33 E;  1Y1M A;  4ZYG A;  5LMU E;  3G7W A;  5IXM B;  2YTE A;  3HCQ A;  2XX8 A;  1MXU A;  4ZS9 A;  3HPI A;  1LBY A;  3MAM A;  1LAF E;  3EPE A;  4LF7 E;  1K9Z A;  2XXU A;  4LU9 A;  1PEB A;  4ESW A;  4QSE A;  4RHB B;  4NGU A;  3GZG A;  4LAT A;  3KBR A;  4P0I A;  1FPG A;  1N7W A;  4OVJ A;  1HSE A;  2GLI A;  5EYH A;  3DP8 A;  2HC5 A;  3HN0 A;  3MW0 A;  2V88 A;  3GBA A;  2GH9 A;  2JP9 A;  4OA4 A;  1IBM E;  1MH3 A;  3M8U A;  1Y3P A;  2H25 A;  1XT8 A;  3RPW A;  2UVI A;  3THO B;  2QVR A;  2LJU A;  1IMA A;  2RC7 A;  4XKQ A;  1X47 A;  2Y7W A;  2PCR A;  2XWI A;  4I40 A;  4MJO A;  4RK9 A;  2CEX A;  2EE8 A;  2VHA A;  4NQ8 A;  3K6V A;  2F7C A;  5J16 A;  4Q35 B;  3OD7 A;  1N3W A;  3FVK A;  4X04 A;  1XVX A;  1L5T A;  3VV5 A;  3GYY A;  5I3S A;  2A5T A;  3O6H A;  2Y5L A;  2HFB A;  3VE1 B;  3ZKL A;  1ZIU A;  4O94 A;  4XIG Q;  1D9Q A;  4EQ9 A;  4DKK A;  1IME A;  3PUX E;  1B58 A;  2JPA A;  1AMF A;  2MKN A;  2XWK A;  1B7U A;  1FW0 A;  1UBD C;  1FJ9 A;  1A1J A;  1H45 A;  5AA1 A;  3ILU B;  3MSW A;  3J80 C;  4NED A;  3U94 A;  2HHM A;  2WYP A;  4GKK E;  3O29 A;  1A55 A;  2YRM A;  5IV8 B;  1RDZ A;  1VE4 A;  1NNF A;  1NFT A;  5IZZ A;  3RGY A;  4BDL A;  1B2H A;  2RSM A;  3FJM A;  2Y7I A;  3A29 A;  1EZ9 A;  2Y7P A;  3TQM A;  4F3B A;  4BMJ A;  3MZB A;  4LZ8 A;  1N34 E;  1SYH A;  1X3C A;  1USY H;  3LSW A;  3IWD A;  4ZEK A;  4F1Y A;  4F6N A;  4ZYE A;  1SFE A;  2EP3 A;  2L2K B;  1MDP 1;  2ESN A;  4POW A;  2KOU A;  3EHS A;  2AIX A;  5H8N B;  4KXP A;  2JR1 A;  3OTO E;  2YTF A;  2DOJ A;  3T9H B;  3VFJ A;  2DXY A;  1HR0 E;  2EM3 A;  2EMH A;  3KN8 A;  1EH8 A;  5B70 A;  2IEE A;  5DNY A;  2QPQ A;  2G29 A;  2UVG A;  2B9D A;  4NAP A;  4NF4 B;  1TT1 A;  2FBP A;  4RNS A;  2V85 A;  5KDT A;  4B3R E;  4NE4 A;  2EN7 A;  1YFH A;  3N26 A;  4NHB A;  2NA2 A;  3KG2 A;  4NF8 A;  2YWQ A;  4U22 A;  3MHH C;  1JW4 A;  5A69 A;  4TUG A;  4IB2 A;  3VVE A;  4R2D A;  4R6H A;  3G3J A;  5L9O A;  2HQ0 A;  3S9L C;  4JSO A;  4ZEI A;  2UXD E;  1H76 A;  5I59 A;  4RH8 A;  1MY3 A;  4JYA E;  1Y4C A;  2EMK A;  4MIJ A;  1MXW A;  4X65 E;  2PT2 A;  3PD8 A;  1QUL A; 
#chains in the Genus database with same CATH homology
 1GGG A;  1VFE A;  2FNC A;  2YLN A;  2YPN A;  3H6T A;  2REJ A;  1IEJ A;  3MVY A;  3B7D A;  4JWY A;  3PPP A;  2GFE A;  2Z8D A;  1H3D A;  3T9X B;  4LA9 A;  1URS A;  1HSL A;  3T96 B;  1GTK A;  4LQ2 A;  5HPQ A;  4F29 A;  3SET A;  3C36 A;  3TDJ A;  1LFH A;  1R6Z A;  5B7D A;  4U1Z A;  4KFQ A;  1NH8 A;  1B32 A;  2P0S A;  3VLU A;  3C34 A;  2ZYN A;  4ZZE A;  3VVD A;  2I4C A;  1B52 A;  3FV1 A;  4X48 A;  3TQW A;  2WKY A;  3PUW E;  1B1X A;  2I58 A;  1I6Q A;  3LUY A;  2F6G A;  1IIT A;  4EUO A;  1P1O A;  5I84 A;  2FA7 A;  5ITO A;  3TCH A;  5DYH A;  4C1U A;  1XS5 A;  3E9X A;  4PFW A;  3CRB A;  2OWT A;  1J1N A;  3RUM A;  2O1M A;  1M5F A;  2GRV A;  3TZA A;  3LSF B;  3TTL A;  5L8D A;  4THI A;  4ZED A;  4DXB A;  4QFK A;  3HV1 A;  3CIJ A;  1Y4T A;  2QMX A;  4MLQ A;  1OVT A;  4P0G A;  3IB0 A;  3JYR A;  2NUV A;  3B6W A;  3O66 A;  3K2D A;  1I6B A;  3RTF B;  4H8I A;  4M1V A;  2OBG A;  3UIF A;  4QSD A;  2OJT A;  1VR5 A;  2RKM A;  1FQA A;  4U4S A;  5CBR A;  3AXF A;  4LQ5 A;  4ESX A;  5EHM A;  1LB9 A;  4BDO A;  2XXI A;  2B3F A;  3PGF A;  4JSD A;  5CMM A;  3N6T A;  3OO9 A;  1SDX A;  3KFM A;  4IY5 A;  4R73 A;  1DMB A;  2RC9 A;  3O6G A;  4K3F A;  1B3L A;  3BFU A;  3E3K A;  3BKI B;  5KCJ B;  2XXV A;  2HZL A;  2Y84 A;  1LAG E;  1AOV A;  3FAT A;  3MP1 A;  2O7U A;  4PE5 B;  4KR5 A;  1AIV A;  4FED A;  3QUF A;  1T0K A;  4TOZ A;  5KDT B;  3PUZ E;  3A3C A;  3TCF A;  1B3E A;  4YIC A;  4PQJ A;  4E0W A;  3IOR A;  4M4G A;  4OFO A;  2AL5 A;  4KYS A;  4DXC A;  2VGQ A;  3CI8 A;  4QFP A;  4GXA A;  5CMC A;  1PB7 A;  3O28 A;  5I59 B;  1IXC A;  3SEU A;  2FYI A;  3D4C A;  4G77 A;  1FTK A;  5TPA A;  3TPA A;  4BLA A;  2CMO A;  4DCX A;  1SVX B;  3MVX A;  2ONS A;  4PFU A;  1US4 A;  4I8C A;  2X7P A;  4GL8 A;  2ZNU A;  5A5X B;  1B1H A;  5AA2 D;  1WOD A;  2ZYM A;  4C1T A;  1Y9U A;  2RC8 A;  3THI A;  3VLW A;  2V84 A;  3ODB A;  4ELO A;  3MP6 A;  4QFL A;  3H6V A;  1MPB A;  2O68 A;  5F7V A;  1FQE A;  4MBP A;  5I56 B;  1MY2 A;  2ABH A;  4YU0 A;  4RPO A;  1GV8 A;  3RN8 A;  4EQ7 A;  2V93 A;  3TQL A;  4AB6 A;  1FCK A;  3P7I A;  1LBC A;  1P1Q A;  1US5 A;  4QFN A;  2NVU B;  5CMK A;  3F11 A;  2QMW A;  3IO6 A;  4ELP A;  4NF5 B;  5TP9 A;  2ANJ A;  4HCY A;  3OXN A;  1JET A;  1POT A;  3GXA A;  3VVF A;  4F2Q A;  3ZS6 A;  2F7B A;  4NF6 A;  2E0S A;  4DDD A;  3RT8 A;  4QF9 A;  2Q88 A;  3IOV A;  1JNF A;  3TKD A;  1N84 A;  1Y20 A;  4R2B A;  1MY4 A;  1B5I A;  2P2A A;  2OZZ A;  3TMG A;  4F3G A;  3KSX A;  2DSF A;  2OWS A;  2RIN A;  1D3K A;  1M5E A;  5HM4 B;  3K01 A;  4FE8 A;  5H8S A;  3WAF A;  1N7X A;  1JW5 A;  2DWJ A;  3BBR A;  5EYF A;  1I6A A;  5K2X A;  1TXF A;  2PVU A;  2XXH A;  5DEX B;  1MQG A;  3H4Z A;  4JDF A;  3IK6 B;  4JBZ A;  3OOA A;  1URD A;  1SYI A;  3T66 A;  3I5O A;  4JXI A;  3SEV A;  1YPN A;  4I1D A;  1DSN A;  4UAC A;  2QL3 A;  1M5D A;  2VOZ A;  3LBS A;  4EF1 A;  3K4U A;  4OQO A;  1FTJ A;  2B3B A;  1LAH E;  3D4G A;  1LAX A;  3TEL A;  1H44 A;  3SKP A;  2AYS A;  4DZ1 A;  1PB8 A;  2XXT A;  5CM6 A;  4TLM B;  3H6U A;  3ZKK A;  3O6I A;  2THI A;  3ECR A;  3LC8 A;  2E1S A;  3H3G A;  1ZTY A;  3A3U A;  2QS2 A;  1XHY A;  1FQC A;  4FEB A;  2DP8 A;  2ZXT A;  4YZZ A;  4X1B A;  4EXL A;  3DEL B;  2OLB A;  3EHU A;  1MS7 A;  4ZEC A;  1LCT A;  1WVJ A;  2F35 A;  3C9H A;  1B51 A;  4F22 A;  4G68 C;  1LFG A;  3SDF A;  5AA2 A;  1NNP A;  2XHD A;  5K2Y A;  1UIU A;  3KGC A;  4PET A;  3SES A;  4BDQ A;  3CSG A;  4BDM A;  1MQJ A;  3TFL A;  5ICT A;  2GHB A;  5FTI A;  4KYE A;  4ISU A;  4JWX A;  1ZBM A;  2GHA A;  3PMV A;  4F1U A;  1CE2 A;  3MJN A;  4F3P A;  4NMY A;  1F9B A;  1YCJ A;  4OMB A;  3PU5 A;  4GQO A;  3UP9 A;  3Q28 A;  3OSR A;  5CC2 A;  3OO7 A;  2O69 A;  4DLD A;  1ZU0 A;  1Q1K A;  4U4X A;  4KHZ E;  5JEI A;  4QSC A;  3I3V A;  3N6U A;  4ZDM A;  4FOR A;  1JVY A;  2PYY A;  2XXR A;  4LON B;  5ITP A;  1RYO A;  4FAT A;  4R2F A;  4G4P A;  3C35 A;  5H8Q B;  1MY0 A;  4TQU Q;  3KOT A;  4G8N A;  2DWI A;  4XTC Q;  5DT6 A;  3PV0 E;  1D4N A;  5CMB A;  3CFZ A;  2HAU A;  1SD3 A;  2UYE A;  3K6W A;  5AA4 A;  1LB8 A;  2IA4 A;  3Q25 A;  3S9E A;  2R9J A;  1B3F A;  3FVO A;  1PBP A;  3G3H A;  2I4B A;  4LZ7 A;  1FTO A;  4F19 A;  3R6U A;  2HEU A;  2XXW A;  2UVJ A;  3PPN A;  4G2Z A;  4OZ9 A;  3U72 A;  1LBB A;  1O7T A;  4R72 A;  2XXY A;  3C33 A;  1S7Y A;  1B6H A;  4R74 A;  1SBP A;  3U8Q A;  4IO2 A;  1LST A;  2DVZ A;  2HZK A;  2PT1 A;  1P1U A;  1SI0 A;  2UVH A;  4POX A;  4FIM A;  4UA8 A;  1A8F A;  4GD5 A;  1NNK A;  4KPT A;  1XC1 A;  4ZE9 A;  3KOS A;  4ONY A;  1UTB A;  3LR1 A;  2QSX A;  1PBQ A;  4G8H A;  1SW4 A;  3T9U A;  4ZE8 A;  4Q8R A;  3K0V A;  3OEL A;  1GVC A;  3MVZ A;  3S9M C;  4N13 A;  3HHG A;  4H0W A;  2Q2C A;  1MH4 A;  4R6Y A;  1IQ7 A;  2QRY A;  2QJE A;  2V3Q A;  4NWC A;  4Q30 B;  1JW1 A;  4OER A;  2KLF A;  5JTY A;  3VXB A;  4G68 A;  2Q2A A;  4OHN A;  5FHM A;  1B4Z A;  1B3H A;  4GRK A;  4H5G A;  1EZP A;  2H9B A;  2F36 A;  2NOO A;  5I57 A;  1RKM A;  2F6P A;  2ONR A;  1Y1Z A;  3IX1 A;  4G8M A;  5BWJ A;  3IOT A;  4ZZA A;  3FD3 A;  1OQG A;  2A5T B;  2Z23 A;  2V3U A;  3EF7 A;  1WDN A;  3CFX A;  1GR2 A;  2V25 A;  3FVG A;  1BIY A;  4XXU A;  3IOU A;  1R9L A;  1B40 A;  2NWJ A;  3PMW A;  2ONK E;  2DWH A;  1Y3N A;  1MXY A;  4OEN A;  1SW1 A;  3DP6 A;  1NH7 A;  4ELQ A;  4ZEB A;  3FXU A;  1P99 A;  3QUJ A;  3FXQ A;  3KN3 A;  4R9F A;  2D5W A;  4LUB A;  3G3F A;  4EQB A;  2XD3 A;  2O84 X;  2I0C A;  5L9S A;  3PMX A;  3S4U A;  2RF1 A;  4Q5T A;  1UIV A;  4BDN A;  4FJP A;  1EZO A;  4Z0I A;  2PX1 A;  1OVB A;  5CBS A;  2F78 A;  3CG3 A;  5AA3 A;  3TTM A;  2NXO A;  3BFT A;  3RTW B;  4F18 A;  3IOW A;  3RT6 B;  4NF8 B;  1B3G A;  3MUQ A;  1MY1 A;  5H8H A;  3TYH A;  5AA4 B;  1JEV A;  3K02 A;  3Q26 A;  4RA1 A;  4RJZ A;  3C31 A;  4X1D A;  4DCY A;  3A09 A;  4P11 A;  1QVS A;  3QAX A;  3UN6 A;  3PUV E;  1FTM A;  2VP1 A;  4GL0 A;  4F2O A;  1POY 1;  2H98 A;  2I3W A;  1QUK A;  3T93 B;  4IY6 A;  3C4M A;  3UGW A;  5DVJ A;  3FJ7 A;  1MRP A;  1IIW A;  4O3A A;  3G3K A;  1N0T A;  3CR9 A;  2UXA A;  3LSX A;  3ZSF A;  4IO5 A;  3VXC A;  2PMS A;  4XKN A;  4QFO A;  1Z7M E;  2Z22 A;  4NTL A;  3O97 A;  1BKA A;  1UTB B;  4O3C A;  3SER A;  5ICQ A;  1URG A;  3W9W A;  1USY E;  4LVQ A;  5FTH A;  3Q29 A;  2QS1 A;  4C0R A;  3OO6 A;  3PUY E;  2I3V A;  2X26 A;  1R9Q A;  4RK2 A;  4IO3 A;  1M5C A;  1IXH A;  4QHQ A;  3EQ1 A;  1MDQ A;  4YKJ A;  4LP2 B;  3G3I A;  3O2A A;  1MQD A;  2ZNS A;  2F97 A;  1A40 A;  1DTZ A;  5JTY B;  5I58 A;  1MPD A;  4U21 A;  2M8C A;  4NF4 A;  4OXV A;  3Q27 A;  1ZKB A;  1LCF A;  3S2V A;  3IR1 A;  4OWD A;  3MBP A;  5I57 B;  3H6W A;  2O1L A;  2O51 A;  3CVG A;  2QS3 A;  3UA8 A;  4L17 A;  2X7Q A;  1MXV A;  4OFL A;  2Y7K A;  1DPE A;  4MFI A;  3K00 A;  4EDP A;  1H43 A;  3KN7 A;  1D9V A;  3FVN A;  1JEU A;  1A8E A;  1SW2 A;  5ELV A;  4KCC A;  3TTK A;  3H06 B;  1MM6 A;  1PB9 A;  5HBC A;  4HTG A;  1KWH A;  3K6U A;  4PFY A;  1S9T A;  4QRZ A;  1QUJ A;  2ZYK A;  4WEP A;  1NNT A;  4PFT A;  2AL4 A;  4GVO A;  4WXJ A;  4N6P A;  1OIB A;  3OO8 A;  1B5J A;  3MZ1 A;  2V3T A;  4XKP A;  2F7A A;  2LAO A;  1QKA A;  3WAE A;  2HXW A;  1A54 A;  1SW5 A;  3VLV A;  3K6X A;  2XXX A;  3QYT A;  2BJJ X;  1ELJ A;  5CI5 A;  1UQW A;  4DE8 A;  1B9J A;  1YAE A;  2PBW A;  4YB6 A;  4RPN A;  5F1Q A;  1LGB C;  1NKX A;  2O6A A;  4OES A;  1TFD A;  4GFR A;  5H8H B;  5TU0 A;  4GLI A;  4I9D A;  5L9M A;  3FV2 A;  5FHO A;  4DIG A;  4R75 A;  2YJP A;  3CSB A;  3U92 A;  4RXL A;  5TPA B;  4KD5 A;  1P1W A;  1IXG A;  3MWB A;  1B4H A;  2Q89 A;  3ONM A;  3MC2 A;  3MPL A;  3G3G A;  1Z7N E;  3FGS A;  4KYD A;  4KI0 E;  4KQP A;  1JVX A;  3I6V A;  3TUS A;  4R9G A;  2W7Y A;  4WKM A;  4F31 B;  1BP5 A;  4U1O A;  4YKK A;  3KSJ A;  1OLC A;  1YTV A;  1NMU A;  1B05 A;  4GXS B;  3TOD A;  4H67 A;  5KZT A;  5FHN A;  3S9N C;  3B6T A;  3TAJ A;  3V8X B;  2DE2 A;  1ZJL A;  3KJ7 A;  4Z7E A;  4F1V A;  1Q35 A;  2OK2 A;  4Q0C A;  5EHS A;  1IZ1 A;  4OYV A;  2Y7R A;  1SQY A;  4WED A;  1CB6 A;  4H8J A;  1R1N A;  1TWY A;  2Z8F A;  3TCG A;  2F8D A;  5TP9 B;  4PP0 A;  5KCJ A;  4H5F A;  4EF2 A;  3KZG A;  3IO4 A;  4JWO A;  1BLF A;  4NF6 B;  5I58 B;  3K1N A;  4IGR A;  3V89 B;  3N5L A;  2DVC A;  4YMB A;  5BUU A;  1QW0 A;  4I62 A;  2CZL A;  3TTR A;  1ZLQ A;  3SEY A;  4H65 A;  2ZMB A;  1EH3 A;  1B0H A;  2I0B A;  3C32 A;  4NWD A;  4ECF A;  4IGT A;  3DLN A;  1HSJ A;  3QXM A;  4FEC A;  5IKB A;  4GOT A;  4E0X A;  3M3K A;  3MQ9 A;  2REG A;  2VD2 A;  2ZYO A;  1ATG A;  3V83 A;  3OEM A;  4HW8 A;  2Z8E A;  1TFA A;  1EU8 A;  4IO6 A;  1BTJ A;  2I49 A;  3LSL A;  5A5X A;  1OQH A;  2H5Y A;  4ELR A;  1I69 A;  2O7I A;  3GLB A;  4YKP A;  3JV9 A;  1SI1 A;  3OSQ A;  4GIZ A;  1JQF A;  3T9V A;  1FQF A;  2Q9T A;  3RQT A;  3PPO A;  4AB5 A;  5IAI A;  1B0L A;  3HHF A;  5I56 A;  4GF8 A;  2DE3 A;  1UTH A;  1II5 A;  1B7Z A;  2UYF A;  2D21 A;  5LOM A;  1ANF A;  3R26 A;  5I2N A;  5DVI A;  3PPR A;  4OFJ A;  5H8F A;  4NF5 A;  3TEP A;  4BDR A;  1MXZ A;  5CRY A;  3V5A A;  2XXP A;  3FIR A;  3OEN A;  4RY1 A;  1QJM A;  3L6G A;  3L6H A;  5ISU A;  3EHT A;  5I2K A;  4JB7 A;  2DWA A;  3VDF A;  5AA2 B;  3IL1 B;  4AQ4 A;  2R71 A;  3IB2 A;  3U1O A;  1MM7 A;  2R6G E;  3JZJ A;  1P1N A;  3U93 A;  2DQV A;  4X9T A;  2VD3 A;  2D3I A;  3HO7 A;  3E4R A;  4YAH X;  2XX9 A;  4IO4 A;  1PDA A;  3CFL A;  3OEK A;  3FXR A;  4YMA A;  5DEX A;  3R7X A;  1A7L A;  3MPK A;  1AH5 A;  4OTE A;  2QS4 A;  2I6E A;  3RNN A;  1VSO A;  4KCD A;  2DXR A;  3MZ9 A;  2DS9 A;  3QK6 A;  1N04 A;  1DPP A;  2H99 A;  2HCA A;  4F3S A;  3FAS A;  4MH5 A;  3H7M A;  1MXX A;  2B65 A;  4OEV A;  1MQI A;  5JK4 A;  3EN3 A;  3W9V A;  3HST A;  2I48 A;  4H6D A;  3OMB A;  1O63 A;  4EXK A;  5M2V A;  2XD2 A;  3W15 C;  3O9P A;  1LFI A;  3CG1 A;  4FAJ A;  3UOR A;  2XXQ A;  3DM0 A;  4TLL B;  2F5X A;  4R6K A;  1PC3 A;  3PD9 A;  3RLF E;  3UK4 A;  2G93 A;  1FQB A;  4MLV A;  3T22 A;  2DYX A;  3FZV A;  1B7H A;  1QKB A;  1QUI A;  1B46 A;  1RYX A;  2XX7 A;  3IB1 A;  2HAV A;  3IJO B;  3ILT B;  3E13 X;  1FQD A;  3K1P A;  2H4I A;  2DE4 A;  4U23 A;  1MPC A;  1O64 A;  3PPQ A;  3K1M A;  2OCU A;  1A99 A;  1OLA A;  2Q8J A;  1Y3Q A;  3TTN A;  3MVW A;  4O3B A;  4HCW A;  1LLS A;  4RYA A;  5AE4 A;  4YKI A;  4HS7 A;  5J1D A;  1N76 A;  2RCB A;  4DXU A;  1UTH B;  4XKR A;  2F34 A;  3FJG A;  4F39 A;  4LZ5 A;  5H8N A;  1ZMG A;  1AL3 A;  5I2N B;  2P1S A;  4G68 B;  1DOT A;  5H8Q A;  5H8F B;  3KEI A;  4U2R A;  3N94 A;  4ZEF A;  1S50 A;  4IO7 A;  1N3X A;  3SEX A;  4GWO A;  3QIM A;  3B6Q A;  5DVF A;  4YB7 A;  3DP4 A;  5I2K B;  1D9Y A;  3RY3 A;  3IAZ A;  1IXI A;  3SEW A;  4H1X A;  1NL5 A;  1OMP A;  3QSL A;  4OEU A;  3KJT A;  3USD A;  1B5H A;  2RCA A;  1MQH A;  3GBB A;  2A5S A;  1FTL A;  5DTB A;  1DTG A;  4ND9 A;  1MG1 A;  1VFD A;  1XVY A;  3M3F A;  1IUD A;  4YB5 A;  4N07 A;  3FUZ A;  4MF3 A;  1XOC A;  4OET A;  2ZNT A;  1M5B A;  3MP8 A;  3M3L A;  3H03 A;  2ALU A;  3IJX B;  1Y1M A;  3G7W A;  3HCQ A;  2XX8 A;  1MXU A;  4ZS9 A;  3HPI A;  3MAM A;  1LAF E;  3EPE A;  2XXU A;  1PEB A;  4ESW A;  4QSE A;  3GZG A;  4LAT A;  3KBR A;  4P0I A;  1N7W A;  4OVJ A;  1HSE A;  3DP8 A;  3HN0 A;  3MW0 A;  3GBA A;  2GH9 A;  1MH3 A;  3M8U A;  1Y3P A;  2H25 A;  1XT8 A;  3RPW A;  2UVI A;  4XKQ A;  2RC7 A;  2Y7W A;  4RK9 A;  2VHA A;  3K6V A;  2F7C A;  3OD7 A;  1N3W A;  3FVK A;  1XVX A;  1L5T A;  3VV5 A;  2A5T A;  3O6H A;  2HFB A;  3VE1 B;  3ZKL A;  1ZIU A;  4XIG Q;  4EQ9 A;  3PUX E;  1B58 A;  1AMF A;  1B7U A;  1FW0 A;  1H45 A;  5AA1 A;  3ILU B;  4NED A;  3U94 A;  3O29 A;  1A55 A;  1VE4 A;  1NNF A;  1NFT A;  3RGY A;  4BDL A;  1B2H A;  3FJM A;  2Y7I A;  1EZ9 A;  2Y7P A;  4F3B A;  3MZB A;  4LZ8 A;  1SYH A;  1USY H;  3LSW A;  4ZEK A;  4F1Y A;  1MDP 1;  2ESN A;  4POW A;  3EHS A;  2AIX A;  5H8N B;  2DOJ A;  3T9H B;  3VFJ A;  2DXY A;  3KN8 A;  5B70 A;  2IEE A;  2QPQ A;  2G29 A;  2UVG A;  4NF4 B;  1TT1 A;  4RNS A;  5KDT A;  4NE4 A;  3N26 A;  3KG2 A;  4NF8 A;  4U22 A;  1JW4 A;  4IB2 A;  3VVE A;  4R6H A;  3G3J A;  5L9O A;  2HQ0 A;  3S9L C;  4JSO A;  4ZEI A;  1H76 A;  5I59 A;  1MY3 A;  1Y4C A;  1MXW A;  2PT2 A;  3PD8 A;  1QUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...