3EQ1A

The crystal structure of human porphobilinogen deaminase at 2.8a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
338
structure length
312
Chain Sequence
RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIQGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPQHEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human porphobilinogen deaminase at 2.8 A: the molecular basis of acute intermittent porphyria
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 96
structure length 312
sequence length 338
chains with identical sequence B
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 3eq1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3eq1A02
1OQHA 3ONMA 3Q26A 1MRPA 4R6KA 3I6VA 1RYOA 4PE5B 4LUBA 5CRYA 2XXRA 3WAFA 1NNFA 5EHMA 3OELA 4O3AA 2F8DA 4Q30B 4QFLA 1JVXA 4ZEBA 2DWIA 1J1NA 1RKMA 4FAJA 2O7IA 1ZMGA 3DP8A 1JEVA 2Z8EA 1JETA 3O6HA 1R9LA 4MFIA 4BDMA 2X26A 1YPNA 1FTMA 4I62A 3HPIA 5AA2D 1A8FA 1D4NA 2UVHA 1N04A 1S7YA 3KJ7A 4U2RA 1BLFA 2VHAA 4U23A 3PPOA 1EZPA 3FXUA 3OO9A 1B7HA 1Z7NE 3RUMA 4YKKA 3B7DA 4H1XA 5BUUA 1I6AA 1N7XA 3CR9A 4BDNA 3MP6A 1II5A 3MW0A 5ISUA 3HV1A 1TT1A 2E1SA 3H6UA 5FTHA 3E9XA 1LAHE 1LAFE 4KCDA 3FJGA 2WKYA 2XXVA 2XXXA 3RNNA 5JTYA 3TELA 1NNTA 4QSCA 2A5SA 2Z23A 2O1MA 1DMBA 1B0HA 1VFDA 3FVNA 3PUWE 1P1UA 5CI5A 3MAMA 2F6PA 3DP4A 4QF9A 4E0WA 1Y3NA 4F39A 3PV0E 3KFMA 2UVGA 4DXBA 4NF6B 4JWYA 2DE3A 1EZOA 1B7ZA 1NFTA 1Y9UA 3G3FA 4R73A 5DTBA 5I2KA 1MQJA 3KN3A 2IA4A 3MVZA 4GOTA 2Q2CA 4OETA 1JW4A 2DWAA 2XHDA 5AA1A 1EH3A 4JB7A 1QUIA 4G2ZA 2XXQA 4RK9A 1HSLA 3T66A 3RT6B 1A8EA 3V5AA 3T96B 4XTCQ 3USDA 2DOJA 2PVUA 3C33A 3FIRA 4LATA 3RPWA 4XXUA 2VD2A 2NWJA 5H8FA 3IK6B 3IOWA 4N13A 2AYSA 4QFNA 3G3IA 2Y7PA 2UYFA 1P1QA 3LSXA 3ECRA 3PU5A 4H67A 4IY6A 3RY3A 2O51A 2VP1A 1B4HA 1B7UA 3ZSFA 5KCJA 1P1OA 2O7UA 3K00A 4DDDA 3N6TA 1MPDA 3EHUA 4ZE8A 3CRBA 1T0KA 1IUDA 3OO6A 2X7QA 4GIZA 5F7VA 4HTGA 4M1VA 3KGCA 3F11A 4MBPA 4F1YA 4IB2A 4OXVA 3BKIB 3Q28A 2B65A 2FA7A 3HSTA 4IO6A 4JXIA 4OYVA 3IX1A 2XXWA 3IO6A 4PETA 2I3VA 3DELB 2F6GA 4H5FA 1DTZA 2ANJA 2HXWA 2RC7A 2ZYMA 4H8IA 3CVGA 3FGSA 4TOZA 3V89B 4KYSA 2Y7IA 3IB2A 3GBAA 3TTNA 1ATGA 2RCBA 5CM6A 2DSFA 4IO3A 4LQ2A 4PFWA 5HM4B 1LB9A 1MQHA 5H8SA 2CZLA 2QMWA 4R9GA 4WEPA 2PBWA 3TCFA 4NF4A 3DP6A 1B4ZA 1IXHA 4NF8A 5A5XB 4FEDA 2DXRA 4JBZA 3MJNA 4XIGQ 3QK6A 1GTKA 3C35A 1M5DA 1B3LA 4GF8A 4Z7EA 2DE2A 4C0RA 4ESXA 1NH8A 4ZDMA 3VV5A 3S2VA 1A55A 1FQFA 4HCYA 3PUVE 4G68C 4NWCA 1MM7A 3EPEA 1SW4A 2I49A 3GXAA 3TZAA 1URSA 1LAGE 3S9EA 4N6PA 2Z8DA 2Z22A 4DCXA 3G3HA 1FCKA 4IGTA 2P2AA 1FQBA 1MXUA 1PB7A 2G29A 1QULA 2OK2A 3FXRA 4H6DA 4KYDA 4LVQA 2Q89A 3VLVA 4Q0CA 2ZYOA 3K6UA 3MQ9A 1P1NA 3TQLA 1IXIA 3FXQA 3H6VA 4FECA 3CFZA 3TODA 1I6BA 3W15C 5L9SA 2QSXA 4GD5A 4LZ7A 4U4SA 2X7PA 3VFJA 2XXHA 3Q27A 1UTBA 1GGGA 2H5YA 3BFTA 3KSJA 3C34A 3K01A 3EHTA 2DWHA 2GH9A 4R2BA 1LCTA 2HQ0A 1O64A 3TYHA 5AA2A 4I9DA 5FHOA 1DPPA 3EQ1A 5I56A 2ZXTA 1B3HA 1SD3A 3FATA 3IAZA 4R9FA 5AA4A 1N84A 1MPCA 4EF1A 1A54A 5FHMA 3V83A 3V8XB 4F18A 3JYRA 1B3FA 3O6IA 1HSJA 1ZLQA 4HCWA 1US5A 4Q8RA 4U21A 4G77A 3MZ1A 4KHZE 3SEYA 3S9NC 2A5TA 2THIA 1N3WA 4UACA 3MWBA 3IR1A 4Z0IA 3UORA 2F7CA 4IO4A 4OHNA 1SYIA 1ZTYA 5L9MA 2Q8JA 2DVZA 4GXAA 3VLWA 1POTA 3PUZE 4POWA 5B7DA 1MY1A 2ONKE 2I48A 3FD3A 3CG1A 4RYAA 4NMYA 4GL8A 1PB8A 3U8QA 3H06B 2G93A 4K3FA 4LZ5A 4NF8B 2I58A 4TLMB 3KBRA 1B1XA 1LAXA 5ELVA 1N3XA 2B3BA 3A3CA 4ZZEA 3RLFE 3SEVA 3N94A 1JQFA 4X48A 4E0XA 4FORA 1JW5A 3R6UA 4GLIA 3OEMA 1B0LA 3LC8A 4JSOA 1NNPA 5J1DA 5FTIA 1IQ7A 1LBCA 5JTYB 3TQWA 3UP9A 3TTRA 2XXIA 2QS2A 3MP8A 4MF3A 2UXAA 1IITA 4DXUA 4YZZA 1AOVA 1MY0A 4HS7A 4MLQA 1JW1A 1MQIA 3VLUA 5KCJB 4LA9A 3EF7A 3MC2A 3K02A 3KN8A 3VXBA 3O29A 3A3UA 3PUYE 1NL5A 2REGA 5HBCA 1R9QA 3TTMA 3U94A 3KJTA 3B6QA 3QYTA 3H03A 3K4UA 3VVDA 2HZLA 3H7MA 1JVYA 1MY4A 3O2AA 2AIXA 5I58B 1TFAA 2PX1A 1SI1A 1SYHA 3K2DA 3VE1B 1AIVA 2Q2AA 3THIA 3FV2A 3QIMA 3TMGA 2VOZA 4C1TA 2ZNSA 1IEJA 4DXCA 5AA2B 5H8HA 1Y4CA 2QMXA 1Y3PA 2P1SA 2O1LA 4YKPA 5H8FB 4BDOA 4RK2A 4ELOA 3IJXB 2H98A 1XVXA 4O3CA 5AA4B 4F19A 2V25A 3KN7A 3HHGA 4R72A 1B05A 1LLSA 1VSOA 4YB7A 3OO7A 4ZECA 3T93B 1B6HA 3QSLA 1O63A 1YAEA 2RF1A 4KI0E 5KDTB 5KZTA 2DP8A 5I2NB 3TEPA 1I69A 2A5TB 4X9TA 1NNKA 2F5XA 2D5WA 2W7YA 4FIMA 4ZZAA 4HW8A 4KPTA 1PDAA 4YAHX 3PD8A 3PMXA 2OJTA 4DCYA 2IEEA 4FE8A 4PP0A 5CMKA 1LFGA 2YPNA 1SDXA 4OFJA 4WEDA 1GV8A 4AQ4A 1IZ1A 1MQDA 4EQ7A 3SKPA 3G3KA 5L9OA 4ELPA 5HPQA 2ONSA 5TU0A 3TKDA 2Y7RA 3G3GA 3ODBA 3UA8A 4AB5A 5LOMA 3PMWA 2I4CA 2AL4A 2ZYKA 1QUJA 5EHSA 2Z8FA 2GFEA 3VVEA 4OERA 1Z7ME 1NH7A 3FJMA 4NF6A 4LZ8A 4ELRA 2GHBA 4KR5A 3PMVA 4R2FA 4U22A 1AL3A 4IGRA 3Q25A 3OENA 4NWDA 1HSEA 3S4UA 2VD3A 4O3BA 4G8NA 4JWXA 3KSXA 3U1OA 1LFIA 4F3PA 1LCFA 4GRKA 4JDFA 3KZGA 2F35A 1NKXA 4R6HA 5CBSA 2ABHA 3E13X 4RJZA 1WODA 1YCJA 2HEUA 1OVTA 3QUFA 2HZKA 4R75A 1QW0A 2O84X 2F36A 4ZS9A 1QUKA 1VE4A 3G7WA 5CMCA 1US4A 3VXCA 2XD2A 1MS7A 3KG2A 4IO5A 4OEVA 2QJEA 4ND9A 3TDJA 4PQJA 3OEKA 5DEXB 1GVCA 2E0SA 4OFLA 1B5JA 4H65A 3TPAA 5H8HB 4YB6A 3FVKA 5EYFA 3TTLA 1FTLA 1LSTA 1D3KA 1R6ZA 3LBSA 3MUQA 4QFOA 3TAJA 5ICQA 3MVYA 3QXMA 3WAEA 1QKBA 3M3LA 2RC9A 4GFRA 4QFPA 3FVGA 3FZVA 1R1NA 2F97A 3GLBA 3OSQA 2ALUA 3CFXA 3KOTA 4XKNA 4X1BA 3GBBA 3ZS6A 3OXNA 5H8NB 1XHYA 4ONYA 2XXTA 4IO2A 1A40A 1M5BA 1MY2A 4N07A 1OIBA 1LB8A 1PEBA 1B32A 1B52A 1UIUA 4RPOA 4I8CA 3LR1A 3OMBA 5K2XA 3FV1A 1QKAA 1B58A 2QPQA 4LONB 4LP2B 4F1UA 4F2QA 5I59A 3UK4A 1FTJA 2I3WA 3M8UA 3OO8A 4NF5B 4KQPA 4RNSA 5A5XA 1LGBC 5BWJA 3GZGA 1USYH 3OSRA 5DYHA 3SDFA 2AL5A 5AA3A 4JSDA 1N7WA 3T9UA 1MPBA 4FATA 3KEIA 1QJMA 4MH5A 2DQVA 3OOAA 3A09A 5H8QB 4KFQA 3IOUA 1FQDA 1JEUA 2HAVA 3FJ7A 1A7LA 4G4PA 4QRZA 1IXCA 3CSGA 4XKPA 1EU8A 1URGA 2QL3A 2UYEA 4I1DA 1MXZA 1S9TA 2FNCA 2HCAA 1MDP1 1FTOA 1XVYA 1CB6A 3C31A 1S50A 3CSBA 4M4GA 3ZKKA 3K6WA 2RKMA 4EDPA 4TQUQ 2HAUA 1OLAA 1L5TA 3IJOB 3CIJA 1FQEA 5F1QA 4DLDA 1B40A 2XX8A 1UTHB 1MXWA 2V93A 4PFUA 1Y20A 2KLFA 4FEBA 4P0GA 4RA1A 5IKBA 1LFHA 1SI0A 3TFLA 4JWOA 2QS1A 4IY5A 2PT1A 1UTBB 1ELJA 3C4MA 2LAOA 2F34A 3G3JA 3HHFA 4DIGA 4EF2A 4DZ1A 3EHSA 5CBRA 4WXJA 2Y7WA 1CE2A 4RXLA 1Y1ZA 5DEXA 1Q35A 2OCUA 3D4CA 3FUZA 4OEUA 4R6YA 3I3VA 4UA8A 4POXA 2YLNA 1M5CA 3LSWA 3LUYA 4PFYA 3PPQA 4QFKA 1SW1A 1URDA 1TXFA 2HFBA 1MDQA 3UIFA 3BFUA 3MPKA 4ELQA 1MXYA 2M8CA 5IAIA 1H3DA 2RCAA 4F22A 2O69A 1DOTA 1LBBA 3MZBA 2F7BA 1B9JA 2O6AA 2ZYNA 3H4ZA 2F7AA 3B6WA 3EN3A 4FJPA 3N6UA 3MVWA 4ZEDA 5B70A 3M3FA 3MP1A 2GHAA 4BDQA 4DE8A 1RYXA 1P1WA 5I57A 3IO4A 3E4RA 2DXYA 2OWTA 3H6WA 1BTJA 1PB9A 3IOTA 3L6HA 3N26A 4H0WA 1B1HA 4IO7A 3TCHA 3VDFA 1XC1A 2OWSA 1MY3A 1GR2A 2ESNA 3W9WA 5TP9B 1B3GA 1JNFA 2PT2A 2DVCA 3DM0A 3I5OA 3PPRA 4OFOA 3R7XA 4PFTA 3RQTA 2NUVA 4NF5A 3RT8A 1IIWA 4EQBA 1B3EA 3S9LC 4C1UA 3SERA 3IOVA 4YMBA 5DVIA 1MM6A 5TPAA 4GXSB 3UN6A 2H4IA 3BBRA 5CMBA 3MZ9A 3TCGA 4ZE9A 2B3FA 4BDLA 2FYIA 2Y84A 1H43A 2H99A 2V3TA 3Q29A 5I2KB 3VVFA 3O28A 3O97A 2XD3A 1POY1 4EQ9A 2V3QA 1M5EA 4G68B 4OWDA 2OLBA 3K0VA 3T22A 2D3IA 3PGFA 1SQYA 4YKJA 3SESA 3C32A 3K1PA 5I84A 2XXUA 4NTLA 4OQOA 1H44A 2I4BA 2NOOA 5CC2A 3T9HB 3SEWA 3HN0A 4BLAA 1DPEA 2V84A 1UTHA 2ZMBA 3PUXE 3ILUB 4H8JA 1DTGA 3B6TA 4QSDA 4TLLB 2GRVA 5I58A 3K1NA 4F29A 1OMPA 3U72A 1AH5A 3CI8A 3OD7A 2XX9A 1D9VA 2ZNUA 2VGQA 4XKQA 4OTEA 1Q1KA 5AE4A 3SEXA 1B46A 1ZJLA 3ILTB 1B5HA 1TWYA 2H25A 4GVOA 2Q88A 1FW0A 2REJA 4YMAA 4EXLA 2I6EA 2PMSA 3HO7A 1F9BA 1MQGA 3CG3A 3L6GA 1EZ9A 4ISUA 2DE4A 4KCCA 1KWHA 3FVOA 4F3BA 5I2NA 4G8MA 1FQCA 3ZKLA 5KDTA 4U1ZA 1UIVA 2OBGA 5I57B 3W9VA 1N0TA 3S9MC 3U93A 2DWJA 4U4XA 2BJJX 2F78A 4ECFA 1DSNA 4QSEA 4OESA 4U1OA 3T9VA 1O7TA 2RC8A 3DLNA 1H45A 2UVJA 2QS3A 1FTKA 3PPNA 5H8NA 4NE4A 3PD9A 2PYYA 3MVXA 5ITOA 1B2HA 5JK4A 3SETA 5K2YA 3K6XA 2NVUB 1OVBA 1B5IA 3LSLA 3IB1A 1NMUA 1VR5A 2NXOA 3KOSA 3RN8A 1BP5A 1ANFA 2V3UA 3M3KA 4F3SA 5I59B 3H3GA 5DVFA 5M2VA 3TUSA 3UGWA 4EUOA 4ZEIA 1WVJA 4G68A 1I6QA 2XXYA 3H6TA 4L17A 4KYEA 4X1DA 1UQWA 1XOCA 4GQOA 5ITPA 3FASA 1OQGA 5H8QA 5DT6A 4YU0A 4GWOA 2DS9A 1SW2A 4AB6A 1A99A 4H5GA 2CMOA 1ZBMA 4QHQA 3IB0A 4OMBA 3C9HA 1SBPA 1BIYA 4G8HA 4ZEFA 3R26A 4ESWA 4F2OA 2YJPA 3K1MA 4F31B 2QS4A 4RPNA 4P0IA 5I56B 3E3KA 2ZNTA 4YICA 3O66A 3U92A 1YTVA 1D9YA 1MXXA 2DYXA 2P0SA 2I0BA 5ICTA 4YKIA 3AXFA 4NEDA 4F1VA 3JV9A 1MG1A 3MPLA 4OZ9A 4R74A 3TTKA 3N5LA 1Y3QA 2D21A 1USYE 2RINA 3P7IA 4KD5A 3O9PA 4YB5A 2UVIA 3C36A 2ONRA 3SEUA 1TFDA 3LSFB 3PPPA 1ZIUA 4F3GA 1M5FA 1MH4A 2I0CA 2XXPA 1ZU0A 4GL0A 1QVSA 3CFLA 2H9BA 1IXGA 2QRYA 3IL1B 3T9XB 1BKAA 4WKMA 4EXKA 1XS5A 3IORA 4RY1A 3RTFB 1WDNA 5L8DA 1FQAA 1MXVA 3QAXA 4BDRA 2R9JA 1AMFA 1PBPA 1VFEA 2R6GE 3JZJA 1PBQA 1PC3A 4XKRA 3K6VA 3QUJA 3D4GA 5DVJA 1N76A 5TP9A 2XX7A 4MLVA 2R71A 2OZZA 4OENA 5CMMA 1Y1MA 4NF4B 3RTWB 2O68A 4OVJA 4Q5TA 3RGYA 1SW5A 1MH3A 3MBPA 5TPAB 4P11A 1ZKBA 3O6GA 4ZEKA 3HCQA 2Q9TA 1P99A 1OLCA 1SVXB 1H76A 5FHNA 1B51A 1Y4TA 4THIA 2Y7KA 1XT8A 4LQ5A 5JEIA
chains in the Genus database with same CATH superfamily
1MRPA 3I6VA 1RYOA 4R2CA 4XFEA 1FJ6A 4Q30B 1JVXA 4FAJA 2O7IA 3DP8A 2Z8EA 2LTRA 4GZNC 1R9LA 3HPSA 2KOUA 1KA1A 4U23A 3FXUA 4GWWA 1I6AA 4BDNA 3MP6A 1II5A 3MW0A 2M7QA 4LFAE 3E9XA 4KCDA 2XXXA 5JTYA 2EOSA 2WBBA 1NNTA 4QSCA 2EM4A 2LTSA 3M99B 5CI5A 3MAMA 1YZ9A 3DP4A 4DXBA 2IHR1 2DE3A 5DW8A 4PAIA 2VRDA 3RMPA 3MVZA 2JY9A 4OETA 1JW4A 2DWAA 2ZM6E 1TN9A 1EH3A 1QUIA 3T66A 1EYJA 1A8EA 4NXNE 3USDA 2PVUA 3C33A 4LATA 3KC0A 1LBXA 4XXUA 3RPWA 2VD2A 4AS5A 5H8FA 3IOWA 4N13A 2AYSA 3G3IA 2YRKA 4IY6A 3RY3A 2YZTA 4YHHE 5A5LA 2K7IA 4BHBA 2DLKA 4DV0E 4OXVA 5A69A 3Q28A 2B65A 4IO6A 4JXIA 2I3VA 3DELB 4H5FA 4G61A 2ANJA 2ZYMA 3FGSA 2LV2A 4KYSA 1ATGA 4LQ2A 4PFWA 2YRMA 4LF7E 1LB9A 1MQHA 5H8SA 2QMWA 4MJOA 4PAFA 2PBWA 4R9GA 4NF4A 2R8TA 3MJNA 1FBPA 4WXDA 3C35A 3B50A 4L5NC 4P56A 1B3LA 4DV4E 4LN5A 2PFYA 4PGNA 1A55A 1FQFA 3PUVE 2J7JA 4NWCA 4N15A 1SW4A 3TZAA 1JK1A 4U21A 2P2AA 4GBVA 4H6DA 3VLVA 2ZYOA 4KWYA 3TQLA 1IXIA 3H6VA 3CFZA 1I6BA 5ET5A 5L9SA 2M4IA 3VYXA 2EN8A 2EMGA 2H5YA 2M9AA 3K01A 2DWHA 4I9DA 4PAKA 1SD3A 3IAZA 2EORA 4R9FA 5AA4A 4EF1A 2EMCA 1US5A 2EOJA 4KHZE 3SEYA 2ODRD 3MWBA 4OHNA 4MAGA 1RMDA 1MY1A 3FD3A 4X66E 3UK3C 1BBGA 1GZ6A 4NF8B 4BCAA 4TLMB 2YU8A 4FORA 1JW5A 4N81A 1B0LA 2BB8A 2EPOA 1YUIA 2XXIA 2E5LE 4MF3A 1IMAA 2UXAA 4DXUA 1NV5A 4HS7A 1JW1A 1MQIA 3RPLB 4LA9A 3VXBA 4OANA 3A3UA 2EPRA 3U94A 3KJTA 3B6QA 3QYTA 1FJ9A 4M0VA 3H03A 4GWSA 2HZLA 1JVYA 1MY4A 5I58B 1GQEA 1IBKE 3VE1B 4PFRA 2Q2AA 1QNTA 3TMGA 4ZYHA 3QG5C 5AA2B 2EOFA 1QU6A 2P1SA 4H45A 4RK2A 4ELOA 2EPCA 2H98A 2V25A 1EH7A 4N91A 2EMLA 1B05A 1LLSA 3OO7A 3QSLA 4MNCA 1PJSA 1A1IA 2A5TB 2FV4B 2F5XA 1PDAA 1Z1BA 2IEEA 4FE8A 4PP0A 2YPNA 1X48A 5L9OA 2Y7RA 3PMWA 3VVEA 2EN7A 4OERA 4ELRA 4NF6A 2HGHA 1NUXA 3MSTA 4OVQA 2VD3A 4O3BA 4PC9A 1LFIA 4F3PA 1LCFA 4JDFA 2F35A 2CEYA 3E13X 1YCJA 1OVTA 3QUFA 1YXIA 3A29A 1QW0A 2F36A 2YSOA 2XD2A 4JI7E 3KG2A 4ND9A 1YFHA 3TPAA 4YB6A 5EYFA 2EN3A 3TAJA 1HNXE 4LFCE 3P1XA 1NV2A 4QFPA 2EMKA 3GLBA 3OSQA 4X1BA 3K6QA 5H8NB 1XHYA 2XXTA 1PJQA 3D1RA 1UILA 1LB8A 4O24A 5A6BD 1B52A 2V89A 4RPOA 1LLMC 3OMBA 1QKAA 1B58A 4LONB 4LP2B 2EPLX 4AS4A 4RNSA 1BK4A 3T0JA 1LBYA 3OSRA 5DYHA 1B69A 1XNQE 2EM3A 4N4RB 1N7WA 3T9UA 4FATA 2DQVA 4KFQA 1A7LA 1EU8A 2HCAA 1XVYA 4M4GA 1S50A 3CSBA 2HAUA 3IJOB 3CIJA 4DLDA 2PFZA 1UTHB 2KLFA 1SI0A 4IY5A 4MMPA 2MKZA 2LAOA 2F34A 4EF2A 2EOEA 5CBRA 2UXDE 5DEXA 4JVDA 3FUZA 4BC7A 2HFBA 1MDQA 2M8CA 4IJDA 4PFBA 4P9KA 2O69A 3MZBA 1T4OA 2F7AA 4FJPA 5IZ1A 5AASA 1P1WA 5I57A 4F2JC 3IOTA 1BTJA 1PB9A 4F31B 2OWSA 5TP9B 1JNFA 2DVCA 4PFTA 2NUVA 1IIWA 4EQBA 4C1UA 4YMBA 5DVIA 2UUBE 2DMIA 4GXSB 2H4IA 1HR0E 2Y84A 2H99A 5I2KB 4Q28A 3O97A 4HXVA 4EQ9A 3T22A 5LMUE 1ZBQA 1SQYA 3C32A 1IQOA 1LBWA 3VK6A 3SEWA 4BLAA 1PJTA 1DTGA 2EPZA 3B6TA 2EPUA 1KA0A 3OD7A 5I5PA 2L92A 5EQ8A 1Q1KA 1ZJLA 1B5HA 5FLXC 2H25A 1X6HA 2Q88A 4EXLA 3HO7A 3L6GA 4P47A 4G8MA 1FQCA 4PBHA 3ZKLA 2YTFA 3S9MC 2Q74A 2L2NA 2FTXB 2DWJA 2BJJX 4QSEA 4U1OA 4OESA 4PF6A 2ENHA 1RC7A 2XWOA 3PPNA 2ZZXA 2EQ0A 5JK4A 4X04A 2NVUB 1OVBA 2EOZA 3RN8A 2H36X 3M3KA 5I59B 4O7MA 5M2VA 1HNWE 4BBYA 3UGWA 4ZEIA 3B8BA 4WSPA 4NHRA 4BC9A 2XXYA 4X1DA 4KYEA 3BIGA 5F24A 5H8QA 4AB6A 1SW2A 3IWDA 2EOHA 4JI6E 2CMOA 3IB0A 2LBSB 1KZ8A 4ESWA 4F2OA 2B9DA 3HTXA 2QVRA 3U92A 2DYXA 4YKIA 1MGTA 4R74A 3N5LA 3P7IA 3O9PA 2RS7A 3PPPA 2I0CA 3J7AG 1ZU0A 4GL0A 3DJWA 2V4CA 5EQAA 3IL1B 5BR8E 1SFEA 2QVVA 5LLQA 4EXKA 1XS5A 2V85A 3HFUA 2R9JA 4DR2E 2RSIA 3D4GA 5DVJA 4WXCA 2UUAE 2OZZA 5CMMA 2HC5A 5AC5A 1ZKBA 2MKDA 1SVXB 1H76A 1Y4TA 1XT8A 3ONMA 1FBCA 4PE5B 1NV3A 1T4NA 2XXRA 3DF6A 3OELA 4O3AA 2F8DA 4QFLA 3MSWA 3MHSC 1JEVA 1JETA 4MFIA 5KL6A 3HPIA 4U2RA 1EZPA 1EKZA 2VHAA 3OO9A 1B7HA 4H1XA 3CR9A 3KZYA 1TT1A 1LAHE 1LAFE 3FJGA 2WKYA 3MHHC 2YSPA 1IQSA 1N32E 2O1MA 1B0HA 3FVNA 3IWCA 2F6PA 1PKPA 4F39A 2EM6A 2ELYA 3SZPA 2MC6A 1MQJA 2CZKA 4I40A 3KN3A 1K9ZA 4JB7A 4G2ZA 4RK9A 3RT6B 4F6NA 3V5AA 4XTCQ 2L33A 2DOJA 3PU5A 4GWXA 1B7UA 5KCJA 5EYHA 2O7UA 3N6TA 3EHUA 2VE7C 4ZE8A 2EL4A 2Y5KA 2WZOA 4MBPA 3F11A 4IB2A 3HSTA 4OA4A 3IX1A 2XXWA 2EOYA 3IO6A 1LBZA 2B3TB 2RC7A 4QBAA 3V89B 3VHTB 4MEVA 1EH6A 3EPKA 3GBAA 3TTNA 4IO3A 5HM4B 2WEFA 2JYAA 2CZLA 3TCFA 4L8NA 1T4LB 3C4BA 1IXHA 5A5XB 2DXRA 2P3VA 4JBZA 3F6HA 2CTDA 4PCDA 3C6KA 4ESXA 4ZDMA 3S2VA 4N8GA 3EPEA 1AAYA 1LAGE 3PTYA 4R2EA 4IGTA 1FQBA 1MXUA 5IXMB 1PB7A 1QULA 4KYDA 4LVQA 5IZ3B 3K6UA 3MQ9A 1HNZE 3TODA 3W15C 2GQ1A 2QSXA 4LZ7A 2X7PA 3VLWA 1UTBA 3BFTA 3KSJA 2YTOA 2P3NA 3EHTA 2GH9A 4NX1A 2DGCA 5I56A 1MPCA 2HJJA 1A54A 2EOMA 4IS1C 1B3FA 5ET6A 1ZLQA 4R2SA 3MZ1A 2EOIA 4O43A 4UACA 5L9MA 1SYIA 1ZTYA 2Q8JA 1POTA 3PUZE 4DR5E 2KONA 4POWA 2ONKE 2LO3A 4R2DA 2JOXA 1ZAAC 3CG1A 4NMYA 5KL4A 3H06B 4K3FA 2EM7A 2I58A 3KBRA 1LAXA 5ELVA 2B3BA 3RLFE 5A6AA 2WYPA 4GLIA 3LC8A 4JSOA 1NNPA 3UP9A 1CNQA 4YZZA 1AOVA 2VQFE 1MY0A 2EMAA 1IBME 5KCJB 3EF7A 3MC2A 3OTOE 2B7TA 2MC5A 3PUYE 5HBCA 3GYYA 3K4UA 4P3LA 4JVCA 3H7MA 3VVDA 2GHFA 2AIXA 2PX1A 2JPAA 1SYHA 3FXBA 3K2DA 1AIVA 3BIDA 2WBSA 3FV2A 3THIA 3QIMA 1KJKA 4HE0A 2QMXA 2JWOA 5AA4B 1XVXA 4YB7A 4ZECA 1B6HA 3T1YE 1IMEA 1O63A 1NUWA 5KDTB 1ZBTA 1N33E 1NNKA 4JV5E 1FPBA 1YYZA 4KPTA 3PMXA 4DR6E 3E78A 4OFJA 4B3ME 3SKPA 3G3KA 4ELPA 3TKDA 2EMIA 1QUJA 4X8RA 2Z8FA 4GKJE 1Z7ME 4LZ8A 5EQ9A 4R2FA 4UABA 4U22A 4IGRA 4HE2A 5A6BA 1YSAC 4DV7E 4G8NA 4JWXA 3KSXA 5AE2A 1A1JA 3RPLA 1NKXA 4P78A 2ABHA 1WODA 4DV1E 4OVPA 2WBTA 1YYWA 2O84X 2DSYA 4HEIA 1QUKA 1VE4A 3VXCA 1MS7A 3OEKA 1GVCA 2E0SA 2V86A 4QFOA 3QXMA 2EPNA 3WAEA 3M3LA 4MNPA 2ALUA 3KOTA 5AE3A 1M5BA 4IO2A 4N07A 4DMIA 1FJGE 3JTZA 3FV1A 3ZOQB 4F2QA 3OO8A 3GZGA 1USYH 5AA3A 2EWLA 2FGGA 3IOUA 1FQDA 1JEUA 2HAVA 4QRZA 4XKPA 1URGA 1FPJA 3FBPA 1MXZA 1S9TA 2FNCA 1FTOA 2WYKA 3C31A 4EDPA 3JAMC 1FSAA 4R2PA 1ZU1A 1FQEA 1B40A 1IMUA 2JVAA 4FEBA 5IKBA 1TF3A 4GX4A 4LU9A 2PT1A 1ELJA 4DR7E 3EHSA 4YY3E 2Y7WA 1Q35A 2OCUA 3D4CA 4POXA 2BJIA 3LUYA 2YU5A 4ELQA 1MXYA 1T38A 2RSMA 2RCAA 1LBBA 2DRPA 2F7BA 1B9JA 5CC2A 3B6WA 3EN3A 5B70A 4DI3D 3MP1A 4DE8A 2GHAA 1EH8A 2B7VA 3L6HA 1MY3A 4MNIA 4XF5A 3PPRA 1WJPA 2KHXA 4PGPA 1MM6A 1FPKA 5TPAA 3UN6A 2LRSA 4ZE9A 2FYIA 2Y5LA 3O28A 1POY1 5I84A 2EQ3A 4OQOA 4NTLA 5IT9C 1H44A 2R1FA 3T9HB 3ADJA 4N17A 2YTPA 1UTHA 3ILUB 5I58A 1J5EE 4QSDA 2GRVA 2EM9A 1OMPA 3IWBA 3CI8A 4XKQA 3SEXA 3ILTB 2ODRC 4GVOA 1N36E 1X47A 2V87A 4DR3E 3S9EA 4KCCA 3CG3A 2DE4A 1IBLE 1UIVA 1BBOA 4TUGA 5I57B 3U93A 4X64E 3ADIA 4MCOA 4ECFA 1MEYC 2OWZA 1FPEA 2QS3A 2PYYA 3MVXA 5T3JA 2YTGA 3J7Yp 3K6XA 1VR5A 1ANFA 1X6FA 5DVFA 4O7IA 3KWRA 3H6TA 2EPKX 4GQOA 5ITPA 2FIXA 4JYAE 1ZBMA 4TUIA 4KHPE 1BIYA 4ZEFA 4OVTA 3HQ1A 2EOXA 2FHYA 5KL5A 1YTVA 1MXXA 1NCSA 5EQ7A 2P0SA 5ICTA 4NEDA 3JV9A 1MG1A 4OZ9A 3SEUA 3C36A 4F3GA 1MH4A 3C4TA 1IXGA 1SPIA 1FPFA 5J16A 4WKMA 4RY1A 5IWAE 5L8DA 3JZJA 1PC3A 3ADLA 2WBDA 2XX7A 4OENA 1Y1MA 4R2QA 4OVJA 2UXCE 1MH3A 2YTJA 3EPJA 2NUEA 2Q9TA 3BF2A 1B51A 2B4MA 2Y7KA 5JEIA 3Q26A 2JJKA 4WSGA 4B3SE 5EHMA 4ZEBA 4F9BB 2DWIA 1RKMA 3O6HA 4N4UA 2HHHE 1YPNA 4F9CB 2VPOA 3TTRA 1A1GA 1DCUA 2UVHA 1BLFA 3RUMA 1Z7NE 2DDKA 4YKKA 3B7DA 5BUUA 2E1SA 3TELA 2A5SA 2Z23A 3PUWE 1P1UA 2UXBE 5IGAA 2R76A 1Y3NA 3PV0E 3KFMA 2UVGA 5ET8A 4JWYA 1EZOA 1FBEA 4X65E 1B7ZA 1NFTA 1Y9UA 1WHNA 3G3FA 4R73A 5I2KA 2IA4A 4GOTA 2Q2CA 3RYDA 5AA1A 3MYUA 2XXQA 3KBZA 1HSLA 3FIRA 2YTIA 2NWJA 4N6DA 2LJUA 4QFNA 4H67A 2UYFA 1P1QA 3ECRA 2O51A 2VP1A 3ZSFA 5I3SA 1P1OA 2MDGA 3K00A 4DDDA 1MPDA 3THNA 5EYGA 5F3WA 3CRBA 3OO6A 2X7QA 4HTGA 3KGCA 4NQ8A 5IV8B 4WX9A 3BKIB 2FA7A 3J81C 2F6GA 3CVGA 4M9VC 2MKNA 4P8BA 2F8BA 2V88A 2JR1A 1B4ZA 4FEDA 4XIGQ 1FBFA 1GTKA 2I13A 1M5DA 4Z7EA 2DE2A 4C0RA 1X5WA 3VV5A 5LDZA 3H09A 2I49A 3GXAA 4N6PA 2Z8DA 1FCKA 2G29A 2Q89A 1G2DC 4Q0CA 2NA2A 2L3CA 3FXQA 2XXHA 3Q27A 1GGGA 3C34A 4PTKA 3KZZA 4DR1E 1LCTA 2HQ0A 1DPPA 3EQ1A 3LV0A 2ZXTA 1B3HA 1FKAE 2N3HA 2CPNA 3JYRA 1HSJA 4Q8RA 2EPMX 3S9NC 5AE1A 4KZSA 1FBDA 2THIA 4Z0IA 3UORA 4PFIA 4F54A 4IO4A 3EKIA 4NZVA 1PB8A 2E1MA 3U8QA 2G93A 3L00A 4E0XA 3SEVA 3N94A 1JQFA 2HXRA 3R6UA 1RDYA 3U65A 3OEMA 5J1DA 5JTYB 1LBCA 1UN6B 2G7HA 2QS2A 2LE2A 4GWZA 2EMBA 4MLQA 4JI3E 3K02A 3KN8A 3O29A 2REGA 3TTMA 1R9QA 3IFAA 3O2AA 1TFAA 4C1TA 2UUCE 2VOZA 4O94A 2ZNSA 4DXCA 2F3DA 5H8HA 1Y4CA 5KZTA 1RQ0A 1RDXA 2O1LA 5H8FB 4BDOA 4NN3A 3KN7A 4R72A 2EN2A 3HPZA 2DP8A 5I2NB 3TEPA 1I69A 4FIMA 4YAHX 3PD8A 5CMKA 4WEDA 1IZ1A 4PBQA 2LT7A 4BS9A 5LOMA 4AB5A 3ODBA 2I4CA 2ZYKA 4DR4E 3T1HE 2GFEA 1N34E 4LF9E 3PMVA 1AL3A 3Q25A 3OENA 1HSEA 3S4UA 2XWVA 3LMLA 1IMCA 3U1OA 2WX9A 4GRKA 4R6HA 3KZGA 4RJZA 5IZZA 4K0KE 2HEUA 2YRHA 4WYQB 4R75A 4IO5A 1AWBA 2QJEA 3TDJA 4P7DA 1O0WA 4ZYGA 4OFLA 5KL7A 4H65A 1FPIA 3FVKA 4X8WA 4O8MA 4R2AA 3TTLA 1LSTA 1D3KA 1R6ZA 3LBSA 3MUQA 5ICQA 2E72A 3BIHA 3VYYA 3FVGA 4DUYE 3ZS6A 3OXNA 3ADGA 4FBPA 1OIBA 4I8CA 3LR1A 5K2XA 2QPQA 4F1UA 5I59A 2I3WA 3M8UA 4NF5B 4KQPA 5A5XA 2BBGA 1LGBC 5BWJA 1IMBA 2PRTA 3SDFA 3KEIA 1Q9DA 1QJMA 4MH5A 5H8QB 3A09A 4RH8A 3FJ7A 4G4PA 3CSGA 2M1SA 3S9LC 5EHSA 1MDP1 1QGXA 4GX3A 5I7IA 5F1QA 2K4VA 4JI0E 1MXWA 4PFUA 1Y20A 4RA1A 4JWOA 2QS1A 4DIGA 1UTBB 1VDWA 1CE2A 4RXLA 1Y1ZA 4OEUA 4R6YA 2YLNA 1KYQA 3PPQA 4QFKA 1SW1A 1TXFA 5IAIA 2CEXA 3MPKA 4F22A 4KXPA 5FHOA 2ZYNA 2EM0A 3MVWA 4ZEDA 3M3FA 2OWTA 3H6WA 3VDFA 1B1HA 4IO7A 3W9WA 1XC1A 1J26A 2FBPA 1B3GA 2PT2A 3RQTA 4OFOA 3OMLA 4N6KA 1B3EA 2L5VA 2CZHA 4IR8A 3SERA 3NOHA 1WHQA 2YTNA 2LUQA 3BBRA 1N3GA 5CMBA 2L6MA 3MZ9A 4NXME 2B3FA 4BDLA 2V3TA 2XD3A 4X9JA 2XA5A 1M5EA 4G68B 4OWDA 2OLBA 3PGFA 3SESA 3K1PA 1X49A 2NUGA 2NOOA 3HN0A 2XWIA 2V84A 4XEQA 4B3RE 4H46A 2JP9A 3K1NA 2DIXA 2LMZA 1XMQE 4F29A 3U72A 1AH5A 1D9VA 2VGQA 4OTEA 2YWQA 3EPLA 2EL6A 1TWYA 1X3CA 1FW0A 4YMAA 4LFBE 3HXLA 4ISUA 5KDTA 1KWHA 4F3BA 2EMZA 1N0TA 4U4XA 1DSNA 3T9VA 1O7TA 2RC8A 4OX9E 1H45A 2UVJA 5H8NA 2GLIA 3SETA 5K2YA 3LSLA 3IB1A 1FRPA 5TSEA 4F6MA 3AV0A 1X6EA 2VT5A 1T39A 4EUOA 4P1LA 2EM2A 5T6JA 1I6QA 5A6KA 2HPGA 4L17A 1UQWA 2UU9E 2VQEE 3FASA 1WRJA 4YU0A 2DS9A 1A99A 4P1EA 4H5GA 4QHQA 4OMBA 3FIGA 1SBPA 4G8HA 3R26A 1XI6A 2YJPA 4RPNA 3E3KA 2ZNTA 5A6JA 3AXFA 3MPLA 4F1YA 1Y3QA 2D21A 2RINA 4KD5A 3T93B 1YYKA 2EP3A 2I9IA 5LL6R 3LSFB 1M5FA 2RQLA 1EYIA 2VF1A 1QVSA 3CFLA 5A2QC 1DGCA 4LF6E 1BKAA 2EN4A 2V8QB 1FQAA 1MXVA 2RTXA 1AMFA 1PBPA 1VFEA 2R6GE 5IZ3A 3EPHA 5TP9A 2L2MA 2RPCA 4MLVA 4N8YA 4DUZE 2OX3A 4NF0A 3RGYA 4M30A 2PCRA 3BGHA 4P11A 1LEVA 3O6GA 4BHCA 1K9YA 4ZEKA 4BMJA 3HCQA 5FHNA 4THIA 1NUZA 4LQ5A 1OQHA 4R6KA 5CRYA 2JXPA 4R8OA 4LUBA 3WAFA 1NNFA 2GPIA 1J1NA 2V83A 1ZMGA 2EN6A 4BDMA 2X26A 1FTMA 4I62A 1NV4A 5AA2D 1A8FA 1D4NA 3KJ7A 1N04A 1S7YA 1FPGA 4OVSA 3PPOA 1F2IG 1N7XA 3IFCA 2CSHA 5ISUA 3HV1A 3H6UA 5FTHA 2XXVA 3RNNA 1IMFA 1DMBA 1VFDA 4PDDA 2Q8MA 1DI2A 2CT1A 4QF9A 4E0WA 2EE8A 4NF6B 1TF6A 3QMFA 5DTBA 5DNYA 2XHDA 3T1BA 4JI2E 3T96B 4DV3E 1YYOA 4MIJA 4NHBA 2MDRA 3IK6B 1JP4A 2Y7PA 2QFLA 3LSXA 2KQZA 1B4HA 2EL5A 3LUZA 1G0IA 1T0KA 1P47A 1IUDA 4GIZA 5F7VA 4M1VA 2FIEA 4ZYDA 2N8XA 2DLQA 4OYVA 4PETA 1DTZA 2NUFA 2HXWA 4H8IA 4I3EA 4TOZA 2XXKA 2Y7IA 2ENCA 2A25A 3JU0A 3IB2A 2RCBA 5CM6A 2DSFA 4WEPA 2B4LA 3DP6A 4NF8A 2EZ6A 2ENAA 3QK6A 1G0HA 4LTYA 4JI1E 4DV5E 1DBZA 4GF8A 5IM2A 1NH8A 4OVRA 2LCEA 2EMWA 4HCYA 4G68C 1MM7A 1URSA 2Z22A 2EMHA 1A1LA 3G3HA 2OK2A 4AQYE 3FXRA 1P1NA 4FECA 4LF8E 4GD5A 4U4SA 3VFJA 4JI8E 4R2BA 3TYHA 1O64A 1FTAA 5AA2A 3FATA 1UHZA 1N84A 4GEQB 5FHMA 3V83A 3V8XB 4F18A 3O6IA 1JK2A 4HCWA 4LF5E 4G77A 2VPNA 2A5TA 1N3WA 4PF8A 3IR1A 2F7CA 5LMNE 4DV6E 2DVZA 4GXAA 5B7DA 5CFFE 4MX6A 5KL2A 1I94E 2I48A 4RYAA 2F4VE 4GL8A 4LZ5A 1B1XA 1N3XA 3A3CA 4F9AB 5ADZA 4ZZEA 4X48A 5FTIA 1IQ7A 3TQWA 3AUZA 3MP8A 1IITA 4QXDA 2EPXA 3VLUA 1NUYA 3LLHA 4M2ZA 1NL5A 4GKKE 4GBWA 1SI1A 2EPAA 4ZYEA 4JI5E 1NV6A 1IEJA 1Y3PA 4YKPA 1NI9A 2LVHA 3IJXB 4O3CA 2QVUA 4F19A 3HHGA 4NG7A 1VSOA 2Q8UA 2DB2A 2LUPB 2KR0A 1YAEA 2RF1A 4KI0E 1SR9A 4X9TA 4ZZAA 2D5WA 4I8OA 2W7YA 2XWKA 4MHFA 4HW8A 4DCYA 2OJTA 1A1HA 1LFGA 1SDXA 4AQ4A 1GV8A 1MQDA 5HPQA 2LJHA 3BBGA 2ONSA 2FVZA 5TU0A 3G3GA 3UA8A 4LF4E 2AL4A 2DMYA 1NH7A 3FJMA 2GHBA 4KR5A 2CZIA 3THOB 4NWDA 4NGUA 5CBSA 2EN1A 2HZKA 4ZS9A 3G7WA 4JI4E 5CMCA 1US4A 1NV0A 4OEVA 4PQJA 1A1FA 5DEXB 4JVIA 1B5JA 5H8HB 1RDZA 4DV2E 1NV1A 1FTLA 3MVYA 4HE1A 1UBDC 1QKBA 2YT4A 2RC9A 4GFRA 3FZVA 1XNRE 1R1NA 2F97A 4XKNA 2EMYA 3CFXA 3GBBA 4ONYA 3TUSA 1A40A 1MY2A 1PEBA 1B32A 1UIUA 3UK4A 1FTJA 4DI4B 2AL5A 4JSDA 1MPBA 3OOAA 1IXCA 4FK5C 4O4KA 2UYEA 2QL3A 4I1DA 4F3SA 1CB6A 3ZKKA 3K6WA 2RKMA 4TQUQ 1OLAA 4DKKA 1L5TA 2D9HA 2XX8A 2V93A 4P0GA 1LFHA 2ELZA 3TFLA 3C4MA 3G3JA 3HHFA 4J8ZA 4GWUA 4DZ1A 4WXJA 4EQ7A 4UA8A 4PDHA 3I3VA 1NV7A 1M5CA 3LSWA 4PFYA 4WPYA 3E79A 5FBPA 1URDA 3UIFA 2NABA 3BFUA 1H3DA 1DOTA 3TTKA 2YTEA 4RHBB 2O6AA 3H4ZA 1EYKA 3N6UA 4BDQA 4R03A 1RYXA 3IO4A 3E4RA 2DXYA 4H0WA 4DCXA 3N26A 3TCHA 2YTQA 1GR2A 2ESNA 1FBHA 3I5OA 3DM0A 3R7XA 3ROJA 3RT8A 4NF5A 2EMFA 2EM8A 3IOVA 3TQMA 1NEIA 2F3BA 1IMDA 3TCGA 1H43A 3Q29A 3VVFA 2L3JA 2V3QA 3K0VA 2EPPA 2D3IA 4YKJA 2ADRA 2XXUA 2I4BA 2HHMA 1DPEA 2RS6A 2ZMBA 3ISPA 3PUXE 2EJ4A 4H8JA 4TLLB 4X62E 2XX9A 2ZNUA 5AE4A 4PE3A 1B46A 5KL3A 4O5GA 2REJA 1A1KA 2I6EA 2PMSA 1F9BA 1MQGA 1EZ9A 3FVOA 5I2NA 4U1ZA 2OBGA 3CHGA 3W9VA 2F78A 4R2RA 4I3YA 5ET7A 1FPDA 3DLNA 1INPA 1FTKA 4NE4A 3PD9A 5ITOA 4B3TE 1B2HA 1B5IA 1NMUA 2NXOA 3KOSA 1BP5A 4OOGC 2V3UA 3H3GA 4Q35B 3F6GA 1YUJA 1G2FC 3C6MA 1WVJA 4NAPA 4G68A 2YTDA 2EOQA 2WBUA 1XOCA 4GWYA 1OQGA 5DT6A 4GWOA 2EQ1A 1FBGA 3C9HA 2L2KB 1XMOE 3K1MA 2ZZVA 2QS4A 1FPLA 4P0IA 4WFTA 5I56B 4YICA 3O66A 1ZR9A 1D9YA 4GX6A 2I0BA 3J80C 2L8TA 4F1VA 1DQ3A 4YB5A 1USYE 2UVIA 2ONRA 1TFDA 1ZIUA 2XXPA 2EOOA 5AC4A 2H9BA 1YZ0A 1D9QA 2QRYA 2WCC3 3T9XB 2EM5A 3IORA 1STUA 3RTFB 1WDNA 1LBVA 1DK4A 3QAXA 5ESYA 4BDRA 2JOBA 1PBQA 4XKRA 2N3GA 3K6VA 3QUJA 1N76A 2R71A 2EMXA 1BB8A 4NF4B 3RTWB 2O68A 4Q5TA 1L4SA 1SW5A 3MBPA 5TPAB 5LTCA 1WXRA 1P99A 1OLCA 3KC1A 2ZZWA
chains in the Genus database with same CATH topology
1OQHA 3ONMA 3Q26A 1MRPA 4R6KA 3I6VA 1RYOA 4PE5B 4LUBA 5CRYA 2XXRA 3WAFA 1NNFA 5EHMA 3OELA 4O3AA 2F8DA 4Q30B 4QFLA 1JVXA 4ZEBA 2DWIA 1J1NA 1RKMA 4FAJA 2O7IA 1ZMGA 3DP8A 1JEVA 2Z8EA 1JETA 3O6HA 1R9LA 4MFIA 4BDMA 2X26A 1YPNA 1FTMA 4I62A 3HPIA 5AA2D 1A8FA 1D4NA 2UVHA 1N04A 1S7YA 3KJ7A 4U2RA 1BLFA 2VHAA 4U23A 3PPOA 1EZPA 3FXUA 3OO9A 1B7HA 1Z7NE 3RUMA 4YKKA 3B7DA 4H1XA 5BUUA 1I6AA 1N7XA 3CR9A 4BDNA 3MP6A 1II5A 3MW0A 5ISUA 3HV1A 1TT1A 2E1SA 3H6UA 5FTHA 3E9XA 1LAHE 1LAFE 4KCDA 3FJGA 2WKYA 2XXVA 2XXXA 3RNNA 5JTYA 3TELA 1NNTA 4QSCA 2A5SA 2Z23A 2O1MA 1DMBA 1B0HA 1VFDA 3FVNA 3PUWE 1P1UA 5CI5A 3MAMA 2F6PA 3DP4A 4QF9A 4E0WA 1Y3NA 4F39A 3PV0E 3KFMA 2UVGA 4DXBA 4NF6B 4JWYA 2DE3A 1EZOA 1B7ZA 1NFTA 1Y9UA 3G3FA 4R73A 5DTBA 5I2KA 1MQJA 3KN3A 2IA4A 3MVZA 4GOTA 2Q2CA 4OETA 1JW4A 2DWAA 2XHDA 5AA1A 1EH3A 4JB7A 1QUIA 4G2ZA 2XXQA 4RK9A 1HSLA 3T66A 3RT6B 1A8EA 3V5AA 3T96B 4XTCQ 3USDA 2DOJA 2PVUA 3C33A 3FIRA 4LATA 3RPWA 4XXUA 2VD2A 2NWJA 5H8FA 3IK6B 3IOWA 4N13A 2AYSA 4QFNA 3G3IA 2Y7PA 2UYFA 1P1QA 3LSXA 3ECRA 3PU5A 4H67A 4IY6A 3RY3A 2O51A 2VP1A 1B4HA 1B7UA 3ZSFA 5KCJA 1P1OA 2O7UA 3K00A 4DDDA 3N6TA 1MPDA 3EHUA 4ZE8A 3CRBA 1T0KA 1IUDA 3OO6A 2X7QA 4GIZA 5F7VA 4HTGA 4M1VA 3KGCA 3F11A 4MBPA 4F1YA 4IB2A 4OXVA 3BKIB 3Q28A 2B65A 2FA7A 3HSTA 4IO6A 4JXIA 4OYVA 3IX1A 2XXWA 3IO6A 4PETA 2I3VA 3DELB 2F6GA 4H5FA 1DTZA 2ANJA 2HXWA 2RC7A 2ZYMA 4H8IA 3CVGA 3FGSA 4TOZA 3V89B 4KYSA 2Y7IA 3IB2A 3GBAA 3TTNA 1ATGA 2RCBA 5CM6A 2DSFA 4IO3A 4LQ2A 4PFWA 5HM4B 1LB9A 1MQHA 5H8SA 2CZLA 2QMWA 4R9GA 4WEPA 2PBWA 3TCFA 4NF4A 3DP6A 1B4ZA 1IXHA 4NF8A 5A5XB 4FEDA 2DXRA 4JBZA 3MJNA 4XIGQ 3QK6A 1GTKA 3C35A 1M5DA 1B3LA 4GF8A 4Z7EA 2DE2A 4C0RA 4ESXA 1NH8A 4ZDMA 3VV5A 3S2VA 1A55A 1FQFA 4HCYA 3PUVE 4G68C 4NWCA 1MM7A 3EPEA 1SW4A 2I49A 3GXAA 3TZAA 1URSA 1LAGE 3S9EA 4N6PA 2Z8DA 2Z22A 4DCXA 3G3HA 1FCKA 4IGTA 2P2AA 1FQBA 1MXUA 1PB7A 2G29A 1QULA 2OK2A 3FXRA 4H6DA 4KYDA 4LVQA 2Q89A 3VLVA 4Q0CA 2ZYOA 3K6UA 3MQ9A 1P1NA 3TQLA 1IXIA 3FXQA 3H6VA 4FECA 3CFZA 3TODA 1I6BA 3W15C 5L9SA 2QSXA 4GD5A 4LZ7A 4U4SA 2X7PA 3VFJA 2XXHA 3Q27A 1UTBA 1GGGA 2H5YA 3BFTA 3KSJA 3C34A 3K01A 3EHTA 2DWHA 2GH9A 4R2BA 1LCTA 2HQ0A 1O64A 3TYHA 5AA2A 4I9DA 5FHOA 1DPPA 3EQ1A 5I56A 2ZXTA 1B3HA 1SD3A 3FATA 3IAZA 4R9FA 5AA4A 1N84A 1MPCA 4EF1A 1A54A 5FHMA 3V83A 3V8XB 4F18A 3JYRA 1B3FA 3O6IA 1HSJA 1ZLQA 4HCWA 1US5A 4Q8RA 4U21A 4G77A 3MZ1A 4KHZE 3SEYA 3S9NC 2A5TA 2THIA 1N3WA 4UACA 3MWBA 3IR1A 4Z0IA 3UORA 2F7CA 4IO4A 4OHNA 1SYIA 1ZTYA 5L9MA 2Q8JA 2DVZA 4GXAA 3VLWA 1POTA 3PUZE 4POWA 5B7DA 1MY1A 2ONKE 2I48A 3FD3A 3CG1A 4RYAA 4NMYA 4GL8A 1PB8A 3U8QA 3H06B 2G93A 4K3FA 4LZ5A 4NF8B 2I58A 4TLMB 3KBRA 1B1XA 1LAXA 5ELVA 1N3XA 2B3BA 3A3CA 4ZZEA 3RLFE 3SEVA 3N94A 1JQFA 4X48A 4E0XA 4FORA 1JW5A 3R6UA 4GLIA 3OEMA 1B0LA 3LC8A 4JSOA 1NNPA 5J1DA 5FTIA 1IQ7A 1LBCA 5JTYB 3TQWA 3UP9A 3TTRA 2XXIA 2QS2A 3MP8A 4MF3A 2UXAA 1IITA 4DXUA 4YZZA 1AOVA 1MY0A 4HS7A 4MLQA 1JW1A 1MQIA 3VLUA 5KCJB 4LA9A 3EF7A 3MC2A 3K02A 3KN8A 3VXBA 3O29A 3A3UA 3PUYE 1NL5A 2REGA 5HBCA 1R9QA 3TTMA 3U94A 3KJTA 3B6QA 3QYTA 3H03A 3K4UA 3VVDA 2HZLA 3H7MA 1JVYA 1MY4A 3O2AA 2AIXA 5I58B 1TFAA 2PX1A 1SI1A 1SYHA 3K2DA 3VE1B 1AIVA 2Q2AA 3THIA 3FV2A 3QIMA 3TMGA 2VOZA 4C1TA 2ZNSA 1IEJA 4DXCA 5AA2B 5H8HA 1Y4CA 2QMXA 1Y3PA 2P1SA 2O1LA 4YKPA 5H8FB 4BDOA 4RK2A 4ELOA 3IJXB 2H98A 1XVXA 4O3CA 5AA4B 4F19A 2V25A 3KN7A 3HHGA 4R72A 1B05A 1LLSA 1VSOA 4YB7A 3OO7A 4ZECA 3T93B 1B6HA 3QSLA 1O63A 1YAEA 2RF1A 4KI0E 5KDTB 5KZTA 2DP8A 5I2NB 3TEPA 1I69A 2A5TB 4X9TA 1NNKA 2F5XA 2D5WA 2W7YA 4FIMA 4ZZAA 4HW8A 4KPTA 1PDAA 4YAHX 3PD8A 3PMXA 2OJTA 4DCYA 2IEEA 4FE8A 4PP0A 5CMKA 1LFGA 2YPNA 1SDXA 4OFJA 4WEDA 1GV8A 4AQ4A 1IZ1A 1MQDA 4EQ7A 3SKPA 3G3KA 5L9OA 4ELPA 5HPQA 2ONSA 5TU0A 3TKDA 2Y7RA 3G3GA 3ODBA 3UA8A 4AB5A 5LOMA 3PMWA 2I4CA 2AL4A 2ZYKA 1QUJA 5EHSA 2Z8FA 2GFEA 3VVEA 4OERA 1Z7ME 1NH7A 3FJMA 4NF6A 4LZ8A 4ELRA 2GHBA 4KR5A 3PMVA 4R2FA 4U22A 1AL3A 4IGRA 3Q25A 3OENA 4NWDA 1HSEA 3S4UA 2VD3A 4O3BA 4G8NA 4JWXA 3KSXA 3U1OA 1LFIA 4F3PA 1LCFA 4GRKA 4JDFA 3KZGA 2F35A 1NKXA 4R6HA 5CBSA 2ABHA 3E13X 4RJZA 1WODA 1YCJA 2HEUA 1OVTA 3QUFA 2HZKA 4R75A 1QW0A 2O84X 2F36A 4ZS9A 1QUKA 1VE4A 3G7WA 5CMCA 1US4A 3VXCA 2XD2A 1MS7A 3KG2A 4IO5A 4OEVA 2QJEA 4ND9A 3TDJA 4PQJA 3OEKA 5DEXB 1GVCA 2E0SA 4OFLA 1B5JA 4H65A 3TPAA 5H8HB 4YB6A 3FVKA 5EYFA 3TTLA 1FTLA 1LSTA 1D3KA 1R6ZA 3LBSA 3MUQA 4QFOA 3TAJA 5ICQA 3MVYA 3QXMA 3WAEA 1QKBA 3M3LA 2RC9A 4GFRA 4QFPA 3FVGA 3FZVA 1R1NA 2F97A 3GLBA 3OSQA 2ALUA 3CFXA 3KOTA 4XKNA 4X1BA 3GBBA 3ZS6A 3OXNA 5H8NB 1XHYA 4ONYA 2XXTA 4IO2A 1A40A 1M5BA 1MY2A 4N07A 1OIBA 1LB8A 1PEBA 1B32A 1B52A 1UIUA 4RPOA 4I8CA 3LR1A 3OMBA 5K2XA 3FV1A 1QKAA 1B58A 2QPQA 4LONB 4LP2B 4F1UA 4F2QA 5I59A 3UK4A 1FTJA 2I3WA 3M8UA 3OO8A 4NF5B 4KQPA 4RNSA 5A5XA 1LGBC 5BWJA 3GZGA 1USYH 3OSRA 5DYHA 3SDFA 2AL5A 5AA3A 4JSDA 1N7WA 3T9UA 1MPBA 4FATA 3KEIA 1QJMA 4MH5A 2DQVA 3OOAA 3A09A 5H8QB 4KFQA 3IOUA 1FQDA 1JEUA 2HAVA 3FJ7A 1A7LA 4G4PA 4QRZA 1IXCA 3CSGA 4XKPA 1EU8A 1URGA 2QL3A 2UYEA 4I1DA 1MXZA 1S9TA 2FNCA 2HCAA 1MDP1 1FTOA 1XVYA 1CB6A 3C31A 1S50A 3CSBA 4M4GA 3ZKKA 3K6WA 2RKMA 4EDPA 4TQUQ 2HAUA 1OLAA 1L5TA 3IJOB 3CIJA 1FQEA 5F1QA 4DLDA 1B40A 2XX8A 1UTHB 1MXWA 2V93A 4PFUA 1Y20A 2KLFA 4FEBA 4P0GA 4RA1A 5IKBA 1LFHA 1SI0A 3TFLA 4JWOA 2QS1A 4IY5A 2PT1A 1UTBB 1ELJA 3C4MA 2LAOA 2F34A 3G3JA 3HHFA 4DIGA 4EF2A 4DZ1A 3EHSA 5CBRA 4WXJA 2Y7WA 1CE2A 4RXLA 1Y1ZA 5DEXA 1Q35A 2OCUA 3D4CA 3FUZA 4OEUA 4R6YA 3I3VA 4UA8A 4POXA 2YLNA 1M5CA 3LSWA 3LUYA 4PFYA 3PPQA 4QFKA 1SW1A 1URDA 1TXFA 2HFBA 1MDQA 3UIFA 3BFUA 3MPKA 4ELQA 1MXYA 2M8CA 5IAIA 1H3DA 2RCAA 4F22A 2O69A 1DOTA 1LBBA 3MZBA 2F7BA 1B9JA 2O6AA 2ZYNA 3H4ZA 2F7AA 3B6WA 3EN3A 4FJPA 3N6UA 3MVWA 4ZEDA 5B70A 3M3FA 3MP1A 2GHAA 4BDQA 4DE8A 1RYXA 1P1WA 5I57A 3IO4A 3E4RA 2DXYA 2OWTA 3H6WA 1BTJA 1PB9A 3IOTA 3L6HA 3N26A 4H0WA 1B1HA 4IO7A 3TCHA 3VDFA 1XC1A 2OWSA 1MY3A 1GR2A 2ESNA 3W9WA 5TP9B 1B3GA 1JNFA 2PT2A 2DVCA 3DM0A 3I5OA 3PPRA 4OFOA 3R7XA 4PFTA 3RQTA 2NUVA 4NF5A 3RT8A 1IIWA 4EQBA 1B3EA 3S9LC 4C1UA 3SERA 3IOVA 4YMBA 5DVIA 1MM6A 5TPAA 4GXSB 3UN6A 2H4IA 3BBRA 5CMBA 3MZ9A 3TCGA 4ZE9A 2B3FA 4BDLA 2FYIA 2Y84A 1H43A 2H99A 2V3TA 3Q29A 5I2KB 3VVFA 3O28A 3O97A 2XD3A 1POY1 4EQ9A 2V3QA 1M5EA 4G68B 4OWDA 2OLBA 3K0VA 3T22A 2D3IA 3PGFA 1SQYA 4YKJA 3SESA 3C32A 3K1PA 5I84A 2XXUA 4NTLA 4OQOA 1H44A 2I4BA 2NOOA 5CC2A 3T9HB 3SEWA 3HN0A 4BLAA 1DPEA 2V84A 1UTHA 2ZMBA 3PUXE 3ILUB 4H8JA 1DTGA 3B6TA 4QSDA 4TLLB 2GRVA 5I58A 3K1NA 4F29A 1OMPA 3U72A 1AH5A 3CI8A 3OD7A 2XX9A 1D9VA 2ZNUA 2VGQA 4XKQA 4OTEA 1Q1KA 5AE4A 3SEXA 1B46A 1ZJLA 3ILTB 1B5HA 1TWYA 2H25A 4GVOA 2Q88A 1FW0A 2REJA 4YMAA 4EXLA 2I6EA 2PMSA 3HO7A 1F9BA 1MQGA 3CG3A 3L6GA 1EZ9A 4ISUA 2DE4A 4KCCA 1KWHA 3FVOA 4F3BA 5I2NA 4G8MA 1FQCA 3ZKLA 5KDTA 4U1ZA 1UIVA 2OBGA 5I57B 3W9VA 1N0TA 3S9MC 3U93A 2DWJA 4U4XA 2BJJX 2F78A 4ECFA 1DSNA 4QSEA 4OESA 4U1OA 3T9VA 1O7TA 2RC8A 3DLNA 1H45A 2UVJA 2QS3A 1FTKA 3PPNA 5H8NA 4NE4A 3PD9A 2PYYA 3MVXA 5ITOA 1B2HA 5JK4A 3SETA 5K2YA 3K6XA 2NVUB 1OVBA 1B5IA 3LSLA 3IB1A 1NMUA 1VR5A 2NXOA 3KOSA 3RN8A 1BP5A 1ANFA 2V3UA 3M3KA 4F3SA 5I59B 3H3GA 5DVFA 5M2VA 3TUSA 3UGWA 4EUOA 4ZEIA 1WVJA 4G68A 1I6QA 2XXYA 3H6TA 4L17A 4KYEA 4X1DA 1UQWA 1XOCA 4GQOA 5ITPA 3FASA 1OQGA 5H8QA 5DT6A 4YU0A 4GWOA 2DS9A 1SW2A 4AB6A 1A99A 4H5GA 2CMOA 1ZBMA 4QHQA 3IB0A 4OMBA 3C9HA 1SBPA 1BIYA 4G8HA 4ZEFA 3R26A 4ESWA 4F2OA 2YJPA 3K1MA 4F31B 2QS4A 4RPNA 4P0IA 5I56B 3E3KA 2ZNTA 4YICA 3O66A 3U92A 1YTVA 1D9YA 1MXXA 2DYXA 2P0SA 2I0BA 5ICTA 4YKIA 3AXFA 4NEDA 4F1VA 3JV9A 1MG1A 3MPLA 4OZ9A 4R74A 3TTKA 3N5LA 1Y3QA 2D21A 1USYE 2RINA 3P7IA 4KD5A 3O9PA 4YB5A 2UVIA 3C36A 2ONRA 3SEUA 1TFDA 3LSFB 3PPPA 1ZIUA 4F3GA 1M5FA 1MH4A 2I0CA 2XXPA 1ZU0A 4GL0A 1QVSA 3CFLA 2H9BA 1IXGA 2QRYA 3IL1B 3T9XB 1BKAA 4WKMA 4EXKA 1XS5A 3IORA 4RY1A 3RTFB 1WDNA 5L8DA 1FQAA 1MXVA 3QAXA 4BDRA 2R9JA 1AMFA 1PBPA 1VFEA 2R6GE 3JZJA 1PBQA 1PC3A 4XKRA 3K6VA 3QUJA 3D4GA 5DVJA 1N76A 5TP9A 2XX7A 4MLVA 2R71A 2OZZA 4OENA 5CMMA 1Y1MA 4NF4B 3RTWB 2O68A 4OVJA 4Q5TA 3RGYA 1SW5A 1MH3A 3MBPA 5TPAB 4P11A 1ZKBA 3O6GA 4ZEKA 3HCQA 2Q9TA 1P99A 1OLCA 1SVXB 1H76A 5FHNA 1B51A 1Y4TA 4THIA 2Y7KA 1XT8A 4LQ5A 5JEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQH A;  3ONM A;  3Q26 A;  1MRP A;  4R6K A;  3I6V A;  1RYO A;  4PE5 B;  4LUB A;  5CRY A;  2XXR A;  3WAF A;  1NNF A;  5EHM A;  3OEL A;  4O3A A;  2F8D A;  4Q30 B;  4QFL A;  1JVX A;  4ZEB A;  2DWI A;  1J1N A;  1RKM A;  4FAJ A;  2O7I A;  1ZMG A;  3DP8 A;  1JEV A;  2Z8E A;  1JET A;  3O6H A;  1R9L A;  4MFI A;  4BDM A;  2X26 A;  1YPN A;  1FTM A;  4I62 A;  3HPI A;  5AA2 D;  1A8F A;  1D4N A;  2UVH A;  1N04 A;  1S7Y A;  3KJ7 A;  4U2R A;  1BLF A;  2VHA A;  4U23 A;  3PPO A;  1EZP A;  3FXU A;  3OO9 A;  1B7H A;  1Z7N E;  3RUM A;  4YKK A;  3B7D A;  4H1X A;  5BUU A;  1I6A A;  1N7X A;  3CR9 A;  4BDN A;  3MP6 A;  1II5 A;  3MW0 A;  5ISU A;  3HV1 A;  1TT1 A;  2E1S A;  3H6U A;  5FTH A;  3E9X A;  1LAH E;  1LAF E;  4KCD A;  3FJG A;  2WKY A;  2XXV A;  2XXX A;  3RNN A;  5JTY A;  3TEL A;  1NNT A;  4QSC A;  2A5S A;  2Z23 A;  2O1M A;  1DMB A;  1B0H A;  1VFD A;  3FVN A;  3PUW E;  1P1U A;  5CI5 A;  3MAM A;  2F6P A;  3DP4 A;  4QF9 A;  4E0W A;  1Y3N A;  4F39 A;  3PV0 E;  3KFM A;  2UVG A;  4DXB A;  4NF6 B;  4JWY A;  2DE3 A;  1EZO A;  1B7Z A;  1NFT A;  1Y9U A;  3G3F A;  4R73 A;  5DTB A;  5I2K A;  1MQJ A;  3KN3 A;  2IA4 A;  3MVZ A;  4GOT A;  2Q2C A;  4OET A;  1JW4 A;  2DWA A;  2XHD A;  5AA1 A;  1EH3 A;  4JB7 A;  1QUI A;  4G2Z A;  2XXQ A;  4RK9 A;  1HSL A;  3T66 A;  3RT6 B;  1A8E A;  3V5A A;  3T96 B;  4XTC Q;  3USD A;  2DOJ A;  2PVU A;  3C33 A;  3FIR A;  4LAT A;  3RPW A;  4XXU A;  2VD2 A;  2NWJ A;  5H8F A;  3IK6 B;  3IOW A;  4N13 A;  2AYS A;  4QFN A;  3G3I A;  2Y7P A;  2UYF A;  1P1Q A;  3LSX A;  3ECR A;  3PU5 A;  4H67 A;  4IY6 A;  3RY3 A;  2O51 A;  2VP1 A;  1B4H A;  1B7U A;  3ZSF A;  5KCJ A;  1P1O A;  2O7U A;  3K00 A;  4DDD A;  3N6T A;  1MPD A;  3EHU A;  4ZE8 A;  3CRB A;  1T0K A;  1IUD A;  3OO6 A;  2X7Q A;  4GIZ A;  5F7V A;  4HTG A;  4M1V A;  3KGC A;  3F11 A;  4MBP A;  4F1Y A;  4IB2 A;  4OXV A;  3BKI B;  3Q28 A;  2B65 A;  2FA7 A;  3HST A;  4IO6 A;  4JXI A;  4OYV A;  3IX1 A;  2XXW A;  3IO6 A;  4PET A;  2I3V A;  3DEL B;  2F6G A;  4H5F A;  1DTZ A;  2ANJ A;  2HXW A;  2RC7 A;  2ZYM A;  4H8I A;  3CVG A;  3FGS A;  4TOZ A;  3V89 B;  4KYS A;  2Y7I A;  3IB2 A;  3GBA A;  3TTN A;  1ATG A;  2RCB A;  5CM6 A;  2DSF A;  4IO3 A;  4LQ2 A;  4PFW A;  5HM4 B;  1LB9 A;  1MQH A;  5H8S A;  2CZL A;  2QMW A;  4R9G A;  4WEP A;  2PBW A;  3TCF A;  4NF4 A;  3DP6 A;  1B4Z A;  1IXH A;  4NF8 A;  5A5X B;  4FED A;  2DXR A;  4JBZ A;  3MJN A;  4XIG Q;  3QK6 A;  1GTK A;  3C35 A;  1M5D A;  1B3L A;  4GF8 A;  4Z7E A;  2DE2 A;  4C0R A;  4ESX A;  1NH8 A;  4ZDM A;  3VV5 A;  3S2V A;  1A55 A;  1FQF A;  4HCY A;  3PUV E;  4G68 C;  4NWC A;  1MM7 A;  3EPE A;  1SW4 A;  2I49 A;  3GXA A;  3TZA A;  1URS A;  1LAG E;  3S9E A;  4N6P A;  2Z8D A;  2Z22 A;  4DCX A;  3G3H A;  1FCK A;  4IGT A;  2P2A A;  1FQB A;  1MXU A;  1PB7 A;  2G29 A;  1QUL A;  2OK2 A;  3FXR A;  4H6D A;  4KYD A;  4LVQ A;  2Q89 A;  3VLV A;  4Q0C A;  2ZYO A;  3K6U A;  3MQ9 A;  1P1N A;  3TQL A;  1IXI A;  3FXQ A;  3H6V A;  4FEC A;  3CFZ A;  3TOD A;  1I6B A;  3W15 C;  5L9S A;  2QSX A;  4GD5 A;  4LZ7 A;  4U4S A;  2X7P A;  3VFJ A;  2XXH A;  3Q27 A;  1UTB A;  1GGG A;  2H5Y A;  3BFT A;  3KSJ A;  3C34 A;  3K01 A;  3EHT A;  2DWH A;  2GH9 A;  4R2B A;  1LCT A;  2HQ0 A;  1O64 A;  3TYH A;  5AA2 A;  4I9D A;  5FHO A;  1DPP A;  3EQ1 A;  5I56 A;  2ZXT A;  1B3H A;  1SD3 A;  3FAT A;  3IAZ A;  4R9F A;  5AA4 A;  1N84 A;  1MPC A;  4EF1 A;  1A54 A;  5FHM A;  3V83 A;  3V8X B;  4F18 A;  3JYR A;  1B3F A;  3O6I A;  1HSJ A;  1ZLQ A;  4HCW A;  1US5 A;  4Q8R A;  4U21 A;  4G77 A;  3MZ1 A;  4KHZ E;  3SEY A;  3S9N C;  2A5T A;  2THI A;  1N3W A;  4UAC A;  3MWB A;  3IR1 A;  4Z0I A;  3UOR A;  2F7C A;  4IO4 A;  4OHN A;  1SYI A;  1ZTY A;  5L9M A;  2Q8J A;  2DVZ A;  4GXA A;  3VLW A;  1POT A;  3PUZ E;  4POW A;  5B7D A;  1MY1 A;  2ONK E;  2I48 A;  3FD3 A;  3CG1 A;  4RYA A;  4NMY A;  4GL8 A;  1PB8 A;  3U8Q A;  3H06 B;  2G93 A;  4K3F A;  4LZ5 A;  4NF8 B;  2I58 A;  4TLM B;  3KBR A;  1B1X A;  1LAX A;  5ELV A;  1N3X A;  2B3B A;  3A3C A;  4ZZE A;  3RLF E;  3SEV A;  3N94 A;  1JQF A;  4X48 A;  4E0X A;  4FOR A;  1JW5 A;  3R6U A;  4GLI A;  3OEM A;  1B0L A;  3LC8 A;  4JSO A;  1NNP A;  5J1D A;  5FTI A;  1IQ7 A;  1LBC A;  5JTY B;  3TQW A;  3UP9 A;  3TTR A;  2XXI A;  2QS2 A;  3MP8 A;  4MF3 A;  2UXA A;  1IIT A;  4DXU A;  4YZZ A;  1AOV A;  1MY0 A;  4HS7 A;  4MLQ A;  1JW1 A;  1MQI A;  3VLU A;  5KCJ B;  4LA9 A;  3EF7 A;  3MC2 A;  3K02 A;  3KN8 A;  3VXB A;  3O29 A;  3A3U A;  3PUY E;  1NL5 A;  2REG A;  5HBC A;  1R9Q A;  3TTM A;  3U94 A;  3KJT A;  3B6Q A;  3QYT A;  3H03 A;  3K4U A;  3VVD A;  2HZL A;  3H7M A;  1JVY A;  1MY4 A;  3O2A A;  2AIX A;  5I58 B;  1TFA A;  2PX1 A;  1SI1 A;  1SYH A;  3K2D A;  3VE1 B;  1AIV A;  2Q2A A;  3THI A;  3FV2 A;  3QIM A;  3TMG A;  2VOZ A;  4C1T A;  2ZNS A;  1IEJ A;  4DXC A;  5AA2 B;  5H8H A;  1Y4C A;  2QMX A;  1Y3P A;  2P1S A;  2O1L A;  4YKP A;  5H8F B;  4BDO A;  4RK2 A;  4ELO A;  3IJX B;  2H98 A;  1XVX A;  4O3C A;  5AA4 B;  4F19 A;  2V25 A;  3KN7 A;  3HHG A;  4R72 A;  1B05 A;  1LLS A;  1VSO A;  4YB7 A;  3OO7 A;  4ZEC A;  3T93 B;  1B6H A;  3QSL A;  1O63 A;  1YAE A;  2RF1 A;  4KI0 E;  5KDT B;  5KZT A;  2DP8 A;  5I2N B;  3TEP A;  1I69 A;  2A5T B;  4X9T A;  1NNK A;  2F5X A;  2D5W A;  2W7Y A;  4FIM A;  4ZZA A;  4HW8 A;  4KPT A;  1PDA A;  4YAH X;  3PD8 A;  3PMX A;  2OJT A;  4DCY A;  2IEE A;  4FE8 A;  4PP0 A;  5CMK A;  1LFG A;  2YPN A;  1SDX A;  4OFJ A;  4WED A;  1GV8 A;  4AQ4 A;  1IZ1 A;  1MQD A;  4EQ7 A;  3SKP A;  3G3K A;  5L9O A;  4ELP A;  5HPQ A;  2ONS A;  5TU0 A;  3TKD A;  2Y7R A;  3G3G A;  3ODB A;  3UA8 A;  4AB5 A;  5LOM A;  3PMW A;  2I4C A;  2AL4 A;  2ZYK A;  1QUJ A;  5EHS A;  2Z8F A;  2GFE A;  3VVE A;  4OER A;  1Z7M E;  1NH7 A;  3FJM A;  4NF6 A;  4LZ8 A;  4ELR A;  2GHB A;  4KR5 A;  3PMV A;  4R2F A;  4U22 A;  1AL3 A;  4IGR A;  3Q25 A;  3OEN A;  4NWD A;  1HSE A;  3S4U A;  2VD3 A;  4O3B A;  4G8N A;  4JWX A;  3KSX A;  3U1O A;  1LFI A;  4F3P A;  1LCF A;  4GRK A;  4JDF A;  3KZG A;  2F35 A;  1NKX A;  4R6H A;  5CBS A;  2ABH A;  3E13 X;  4RJZ A;  1WOD A;  1YCJ A;  2HEU A;  1OVT A;  3QUF A;  2HZK A;  4R75 A;  1QW0 A;  2O84 X;  2F36 A;  4ZS9 A;  1QUK A;  1VE4 A;  3G7W A;  5CMC A;  1US4 A;  3VXC A;  2XD2 A;  1MS7 A;  3KG2 A;  4IO5 A;  4OEV A;  2QJE A;  4ND9 A;  3TDJ A;  4PQJ A;  3OEK A;  5DEX B;  1GVC A;  2E0S A;  4OFL A;  1B5J A;  4H65 A;  3TPA A;  5H8H B;  4YB6 A;  3FVK A;  5EYF A;  3TTL A;  1FTL A;  1LST A;  1D3K A;  1R6Z A;  3LBS A;  3MUQ A;  4QFO A;  3TAJ A;  5ICQ A;  3MVY A;  3QXM A;  3WAE A;  1QKB A;  3M3L A;  2RC9 A;  4GFR A;  4QFP A;  3FVG A;  3FZV A;  1R1N A;  2F97 A;  3GLB A;  3OSQ A;  2ALU A;  3CFX A;  3KOT A;  4XKN A;  4X1B A;  3GBB A;  3ZS6 A;  3OXN A;  5H8N B;  1XHY A;  4ONY A;  2XXT A;  4IO2 A;  1A40 A;  1M5B A;  1MY2 A;  4N07 A;  1OIB A;  1LB8 A;  1PEB A;  1B32 A;  1B52 A;  1UIU A;  4RPO A;  4I8C A;  3LR1 A;  3OMB A;  5K2X A;  3FV1 A;  1QKA A;  1B58 A;  2QPQ A;  4LON B;  4LP2 B;  4F1U A;  4F2Q A;  5I59 A;  3UK4 A;  1FTJ A;  2I3W A;  3M8U A;  3OO8 A;  4NF5 B;  4KQP A;  4RNS A;  5A5X A;  1LGB C;  5BWJ A;  3GZG A;  1USY H;  3OSR A;  5DYH A;  3SDF A;  2AL5 A;  5AA3 A;  4JSD A;  1N7W A;  3T9U A;  1MPB A;  4FAT A;  3KEI A;  1QJM A;  4MH5 A;  2DQV A;  3OOA A;  3A09 A;  5H8Q B;  4KFQ A;  3IOU A;  1FQD A;  1JEU A;  2HAV A;  3FJ7 A;  1A7L A;  4G4P A;  4QRZ A;  1IXC A;  3CSG A;  4XKP A;  1EU8 A;  1URG A;  2QL3 A;  2UYE A;  4I1D A;  1MXZ A;  1S9T A;  2FNC A;  2HCA A;  1MDP 1;  1FTO A;  1XVY A;  1CB6 A;  3C31 A;  1S50 A;  3CSB A;  4M4G A;  3ZKK A;  3K6W A;  2RKM A;  4EDP A;  4TQU Q;  2HAU A;  1OLA A;  1L5T A;  3IJO B;  3CIJ A;  1FQE A;  5F1Q A;  4DLD A;  1B40 A;  2XX8 A;  1UTH B;  1MXW A;  2V93 A;  4PFU A;  1Y20 A;  2KLF A;  4FEB A;  4P0G A;  4RA1 A;  5IKB A;  1LFH A;  1SI0 A;  3TFL A;  4JWO A;  2QS1 A;  4IY5 A;  2PT1 A;  1UTB B;  1ELJ A;  3C4M A;  2LAO A;  2F34 A;  3G3J A;  3HHF A;  4DIG A;  4EF2 A;  4DZ1 A;  3EHS A;  5CBR A;  4WXJ A;  2Y7W A;  1CE2 A;  4RXL A;  1Y1Z A;  5DEX A;  1Q35 A;  2OCU A;  3D4C A;  3FUZ A;  4OEU A;  4R6Y A;  3I3V A;  4UA8 A;  4POX A;  2YLN A;  1M5C A;  3LSW A;  3LUY A;  4PFY A;  3PPQ A;  4QFK A;  1SW1 A;  1URD A;  1TXF A;  2HFB A;  1MDQ A;  3UIF A;  3BFU A;  3MPK A;  4ELQ A;  1MXY A;  2M8C A;  5IAI A;  1H3D A;  2RCA A;  4F22 A;  2O69 A;  1DOT A;  1LBB A;  3MZB A;  2F7B A;  1B9J A;  2O6A A;  2ZYN A;  3H4Z A;  2F7A A;  3B6W A;  3EN3 A;  4FJP A;  3N6U A;  3MVW A;  4ZED A;  5B70 A;  3M3F A;  3MP1 A;  2GHA A;  4BDQ A;  4DE8 A;  1RYX A;  1P1W A;  5I57 A;  3IO4 A;  3E4R A;  2DXY A;  2OWT A;  3H6W A;  1BTJ A;  1PB9 A;  3IOT A;  3L6H A;  3N26 A;  4H0W A;  1B1H A;  4IO7 A;  3TCH A;  3VDF A;  1XC1 A;  2OWS A;  1MY3 A;  1GR2 A;  2ESN A;  3W9W A;  5TP9 B;  1B3G A;  1JNF A;  2PT2 A;  2DVC A;  3DM0 A;  3I5O A;  3PPR A;  4OFO A;  3R7X A;  4PFT A;  3RQT A;  2NUV A;  4NF5 A;  3RT8 A;  1IIW A;  4EQB A;  1B3E A;  3S9L C;  4C1U A;  3SER A;  3IOV A;  4YMB A;  5DVI A;  1MM6 A;  5TPA A;  4GXS B;  3UN6 A;  2H4I A;  3BBR A;  5CMB A;  3MZ9 A;  3TCG A;  4ZE9 A;  2B3F A;  4BDL A;  2FYI A;  2Y84 A;  1H43 A;  2H99 A;  2V3T A;  3Q29 A;  5I2K B;  3VVF A;  3O28 A;  3O97 A;  2XD3 A;  1POY 1;  4EQ9 A;  2V3Q A;  1M5E A;  4G68 B;  4OWD A;  2OLB A;  3K0V A;  3T22 A;  2D3I A;  3PGF A;  1SQY A;  4YKJ A;  3SES A;  3C32 A;  3K1P A;  5I84 A;  2XXU A;  4NTL A;  4OQO A;  1H44 A;  2I4B A;  2NOO A;  5CC2 A;  3T9H B;  3SEW A;  3HN0 A;  4BLA A;  1DPE A;  2V84 A;  1UTH A;  2ZMB A;  3PUX E;  3ILU B;  4H8J A;  1DTG A;  3B6T A;  4QSD A;  4TLL B;  2GRV A;  5I58 A;  3K1N A;  4F29 A;  1OMP A;  3U72 A;  1AH5 A;  3CI8 A;  3OD7 A;  2XX9 A;  1D9V A;  2ZNU A;  2VGQ A;  4XKQ A;  4OTE A;  1Q1K A;  5AE4 A;  3SEX A;  1B46 A;  1ZJL A;  3ILT B;  1B5H A;  1TWY A;  2H25 A;  4GVO A;  2Q88 A;  1FW0 A;  2REJ A;  4YMA A;  4EXL A;  2I6E A;  2PMS A;  3HO7 A;  1F9B A;  1MQG A;  3CG3 A;  3L6G A;  1EZ9 A;  4ISU A;  2DE4 A;  4KCC A;  1KWH A;  3FVO A;  4F3B A;  5I2N A;  4G8M A;  1FQC A;  3ZKL A;  5KDT A;  4U1Z A;  1UIV A;  2OBG A;  5I57 B;  3W9V A;  1N0T A;  3S9M C;  3U93 A;  2DWJ A;  4U4X A;  2BJJ X;  2F78 A;  4ECF A;  1DSN A;  4QSE A;  4OES A;  4U1O A;  3T9V A;  1O7T A;  2RC8 A;  3DLN A;  1H45 A;  2UVJ A;  2QS3 A;  1FTK A;  3PPN A;  5H8N A;  4NE4 A;  3PD9 A;  2PYY A;  3MVX A;  5ITO A;  1B2H A;  5JK4 A;  3SET A;  5K2Y A;  3K6X A;  2NVU B;  1OVB A;  1B5I A;  3LSL A;  3IB1 A;  1NMU A;  1VR5 A;  2NXO A;  3KOS A;  3RN8 A;  1BP5 A;  1ANF A;  2V3U A;  3M3K A;  4F3S A;  5I59 B;  3H3G A;  5DVF A;  5M2V A;  3TUS A;  3UGW A;  4EUO A;  4ZEI A;  1WVJ A;  4G68 A;  1I6Q A;  2XXY A;  3H6T A;  4L17 A;  4KYE A;  4X1D A;  1UQW A;  1XOC A;  4GQO A;  5ITP A;  3FAS A;  1OQG A;  5H8Q A;  5DT6 A;  4YU0 A;  4GWO A;  2DS9 A;  1SW2 A;  4AB6 A;  1A99 A;  4H5G A;  2CMO A;  1ZBM A;  4QHQ A;  3IB0 A;  4OMB A;  3C9H A;  1SBP A;  1BIY A;  4G8H A;  4ZEF A;  3R26 A;  4ESW A;  4F2O A;  2YJP A;  3K1M A;  4F31 B;  2QS4 A;  4RPN A;  4P0I A;  5I56 B;  3E3K A;  2ZNT A;  4YIC A;  3O66 A;  3U92 A;  1YTV A;  1D9Y A;  1MXX A;  2DYX A;  2P0S A;  2I0B A;  5ICT A;  4YKI A;  3AXF A;  4NED A;  4F1V A;  3JV9 A;  1MG1 A;  3MPL A;  4OZ9 A;  4R74 A;  3TTK A;  3N5L A;  1Y3Q A;  2D21 A;  1USY E;  2RIN A;  3P7I A;  4KD5 A;  3O9P A;  4YB5 A;  2UVI A;  3C36 A;  2ONR A;  3SEU A;  1TFD A;  3LSF B;  3PPP A;  1ZIU A;  4F3G A;  1M5F A;  1MH4 A;  2I0C A;  2XXP A;  1ZU0 A;  4GL0 A;  1QVS A;  3CFL A;  2H9B A;  1IXG A;  2QRY A;  3IL1 B;  3T9X B;  1BKA A;  4WKM A;  4EXK A;  1XS5 A;  3IOR A;  4RY1 A;  3RTF B;  1WDN A;  5L8D A;  1FQA A;  1MXV A;  3QAX A;  4BDR A;  2R9J A;  1AMF A;  1PBP A;  1VFE A;  2R6G E;  3JZJ A;  1PBQ A;  1PC3 A;  4XKR A;  3K6V A;  3QUJ A;  3D4G A;  5DVJ A;  1N76 A;  5TP9 A;  2XX7 A;  4MLV A;  2R71 A;  2OZZ A;  4OEN A;  5CMM A;  1Y1M A;  4NF4 B;  3RTW B;  2O68 A;  4OVJ A;  4Q5T A;  3RGY A;  1SW5 A;  1MH3 A;  3MBP A;  5TPA B;  4P11 A;  1ZKB A;  3O6G A;  4ZEK A;  3HCQ A;  2Q9T A;  1P99 A;  1OLC A;  1SVX B;  1H76 A;  5FHN A;  1B51 A;  1Y4T A;  4THI A;  2Y7K A;  1XT8 A;  4LQ5 A;  5JEI A; 
#chains in the Genus database with same CATH topology
 1MRP A;  3I6V A;  1RYO A;  4R2C A;  4XFE A;  1FJ6 A;  4Q30 B;  1JVX A;  4FAJ A;  2O7I A;  3DP8 A;  2Z8E A;  2LTR A;  4GZN C;  1R9L A;  3HPS A;  2KOU A;  1KA1 A;  4U23 A;  3FXU A;  4GWW A;  1I6A A;  4BDN A;  3MP6 A;  1II5 A;  3MW0 A;  2M7Q A;  4LFA E;  3E9X A;  4KCD A;  2XXX A;  5JTY A;  2EOS A;  2WBB A;  1NNT A;  4QSC A;  2EM4 A;  2LTS A;  3M99 B;  5CI5 A;  3MAM A;  1YZ9 A;  3DP4 A;  4DXB A;  2IHR 1;  2DE3 A;  5DW8 A;  4PAI A;  2VRD A;  3RMP A;  3MVZ A;  2JY9 A;  4OET A;  1JW4 A;  2DWA A;  2ZM6 E;  1TN9 A;  1EH3 A;  1QUI A;  3T66 A;  1EYJ A;  1A8E A;  4NXN E;  3USD A;  2PVU A;  3C33 A;  4LAT A;  3KC0 A;  1LBX A;  4XXU A;  3RPW A;  2VD2 A;  4AS5 A;  5H8F A;  3IOW A;  4N13 A;  2AYS A;  3G3I A;  2YRK A;  4IY6 A;  3RY3 A;  2YZT A;  4YHH E;  5A5L A;  2K7I A;  4BHB A;  2DLK A;  4DV0 E;  4OXV A;  5A69 A;  3Q28 A;  2B65 A;  4IO6 A;  4JXI A;  2I3V A;  3DEL B;  4H5F A;  4G61 A;  2ANJ A;  2ZYM A;  3FGS A;  2LV2 A;  4KYS A;  1ATG A;  4LQ2 A;  4PFW A;  2YRM A;  4LF7 E;  1LB9 A;  1MQH A;  5H8S A;  2QMW A;  4MJO A;  4PAF A;  2PBW A;  4R9G A;  4NF4 A;  2R8T A;  3MJN A;  1FBP A;  4WXD A;  3C35 A;  3B50 A;  4L5N C;  4P56 A;  1B3L A;  4DV4 E;  4LN5 A;  2PFY A;  4PGN A;  1A55 A;  1FQF A;  3PUV E;  2J7J A;  4NWC A;  4N15 A;  1SW4 A;  3TZA A;  1JK1 A;  4U21 A;  2P2A A;  4GBV A;  4H6D A;  3VLV A;  2ZYO A;  4KWY A;  3TQL A;  1IXI A;  3H6V A;  3CFZ A;  1I6B A;  5ET5 A;  5L9S A;  2M4I A;  3VYX A;  2EN8 A;  2EMG A;  2H5Y A;  2M9A A;  3K01 A;  2DWH A;  4I9D A;  4PAK A;  1SD3 A;  3IAZ A;  2EOR A;  4R9F A;  5AA4 A;  4EF1 A;  2EMC A;  1US5 A;  2EOJ A;  4KHZ E;  3SEY A;  2ODR D;  3MWB A;  4OHN A;  4MAG A;  1RMD A;  1MY1 A;  3FD3 A;  4X66 E;  3UK3 C;  1BBG A;  1GZ6 A;  4NF8 B;  4BCA A;  4TLM B;  2YU8 A;  4FOR A;  1JW5 A;  4N81 A;  1B0L A;  2BB8 A;  2EPO A;  1YUI A;  2XXI A;  2E5L E;  4MF3 A;  1IMA A;  2UXA A;  4DXU A;  1NV5 A;  4HS7 A;  1JW1 A;  1MQI A;  3RPL B;  4LA9 A;  3VXB A;  4OAN A;  3A3U A;  2EPR A;  3U94 A;  3KJT A;  3B6Q A;  3QYT A;  1FJ9 A;  4M0V A;  3H03 A;  4GWS A;  2HZL A;  1JVY A;  1MY4 A;  5I58 B;  1GQE A;  1IBK E;  3VE1 B;  4PFR A;  2Q2A A;  1QNT A;  3TMG A;  4ZYH A;  3QG5 C;  5AA2 B;  2EOF A;  1QU6 A;  2P1S A;  4H45 A;  4RK2 A;  4ELO A;  2EPC A;  2H98 A;  2V25 A;  1EH7 A;  4N91 A;  2EML A;  1B05 A;  1LLS A;  3OO7 A;  3QSL A;  4MNC A;  1PJS A;  1A1I A;  2A5T B;  2FV4 B;  2F5X A;  1PDA A;  1Z1B A;  2IEE A;  4FE8 A;  4PP0 A;  2YPN A;  1X48 A;  5L9O A;  2Y7R A;  3PMW A;  3VVE A;  2EN7 A;  4OER A;  4ELR A;  4NF6 A;  2HGH A;  1NUX A;  3MST A;  4OVQ A;  2VD3 A;  4O3B A;  4PC9 A;  1LFI A;  4F3P A;  1LCF A;  4JDF A;  2F35 A;  2CEY A;  3E13 X;  1YCJ A;  1OVT A;  3QUF A;  1YXI A;  3A29 A;  1QW0 A;  2F36 A;  2YSO A;  2XD2 A;  4JI7 E;  3KG2 A;  4ND9 A;  1YFH A;  3TPA A;  4YB6 A;  5EYF A;  2EN3 A;  3TAJ A;  1HNX E;  4LFC E;  3P1X A;  1NV2 A;  4QFP A;  2EMK A;  3GLB A;  3OSQ A;  4X1B A;  3K6Q A;  5H8N B;  1XHY A;  2XXT A;  1PJQ A;  3D1R A;  1UIL A;  1LB8 A;  4O24 A;  5A6B D;  1B52 A;  2V89 A;  4RPO A;  1LLM C;  3OMB A;  1QKA A;  1B58 A;  4LON B;  4LP2 B;  2EPL X;  4AS4 A;  4RNS A;  1BK4 A;  3T0J A;  1LBY A;  3OSR A;  5DYH A;  1B69 A;  1XNQ E;  2EM3 A;  4N4R B;  1N7W A;  3T9U A;  4FAT A;  2DQV A;  4KFQ A;  1A7L A;  1EU8 A;  2HCA A;  1XVY A;  4M4G A;  1S50 A;  3CSB A;  2HAU A;  3IJO B;  3CIJ A;  4DLD A;  2PFZ A;  1UTH B;  2KLF A;  1SI0 A;  4IY5 A;  4MMP A;  2MKZ A;  2LAO A;  2F34 A;  4EF2 A;  2EOE A;  5CBR A;  2UXD E;  5DEX A;  4JVD A;  3FUZ A;  4BC7 A;  2HFB A;  1MDQ A;  2M8C A;  4IJD A;  4PFB A;  4P9K A;  2O69 A;  3MZB A;  1T4O A;  2F7A A;  4FJP A;  5IZ1 A;  5AAS A;  1P1W A;  5I57 A;  4F2J C;  3IOT A;  1BTJ A;  1PB9 A;  4F31 B;  2OWS A;  5TP9 B;  1JNF A;  2DVC A;  4PFT A;  2NUV A;  1IIW A;  4EQB A;  4C1U A;  4YMB A;  5DVI A;  2UUB E;  2DMI A;  4GXS B;  2H4I A;  1HR0 E;  2Y84 A;  2H99 A;  5I2K B;  4Q28 A;  3O97 A;  4HXV A;  4EQ9 A;  3T22 A;  5LMU E;  1ZBQ A;  1SQY A;  3C32 A;  1IQO A;  1LBW A;  3VK6 A;  3SEW A;  4BLA A;  1PJT A;  1DTG A;  2EPZ A;  3B6T A;  2EPU A;  1KA0 A;  3OD7 A;  5I5P A;  2L92 A;  5EQ8 A;  1Q1K A;  1ZJL A;  1B5H A;  5FLX C;  2H25 A;  1X6H A;  2Q88 A;  4EXL A;  3HO7 A;  3L6G A;  4P47 A;  4G8M A;  1FQC A;  4PBH A;  3ZKL A;  2YTF A;  3S9M C;  2Q74 A;  2L2N A;  2FTX B;  2DWJ A;  2BJJ X;  4QSE A;  4U1O A;  4OES A;  4PF6 A;  2ENH A;  1RC7 A;  2XWO A;  3PPN A;  2ZZX A;  2EQ0 A;  5JK4 A;  4X04 A;  2NVU B;  1OVB A;  2EOZ A;  3RN8 A;  2H36 X;  3M3K A;  5I59 B;  4O7M A;  5M2V A;  1HNW E;  4BBY A;  3UGW A;  4ZEI A;  3B8B A;  4WSP A;  4NHR A;  4BC9 A;  2XXY A;  4X1D A;  4KYE A;  3BIG A;  5F24 A;  5H8Q A;  4AB6 A;  1SW2 A;  3IWD A;  2EOH A;  4JI6 E;  2CMO A;  3IB0 A;  2LBS B;  1KZ8 A;  4ESW A;  4F2O A;  2B9D A;  3HTX A;  2QVR A;  3U92 A;  2DYX A;  4YKI A;  1MGT A;  4R74 A;  3N5L A;  3P7I A;  3O9P A;  2RS7 A;  3PPP A;  2I0C A;  3J7A G;  1ZU0 A;  4GL0 A;  3DJW A;  2V4C A;  5EQA A;  3IL1 B;  5BR8 E;  1SFE A;  2QVV A;  5LLQ A;  4EXK A;  1XS5 A;  2V85 A;  3HFU A;  2R9J A;  4DR2 E;  2RSI A;  3D4G A;  5DVJ A;  4WXC A;  2UUA E;  2OZZ A;  5CMM A;  2HC5 A;  5AC5 A;  1ZKB A;  2MKD A;  1SVX B;  1H76 A;  1Y4T A;  1XT8 A;  3ONM A;  1FBC A;  4PE5 B;  1NV3 A;  1T4N A;  2XXR A;  3DF6 A;  3OEL A;  4O3A A;  2F8D A;  4QFL A;  3MSW A;  3MHS C;  1JEV A;  1JET A;  4MFI A;  5KL6 A;  3HPI A;  4U2R A;  1EZP A;  1EKZ A;  2VHA A;  3OO9 A;  1B7H A;  4H1X A;  3CR9 A;  3KZY A;  1TT1 A;  1LAH E;  1LAF E;  3FJG A;  2WKY A;  3MHH C;  2YSP A;  1IQS A;  1N32 E;  2O1M A;  1B0H A;  3FVN A;  3IWC A;  2F6P A;  1PKP A;  4F39 A;  2EM6 A;  2ELY A;  3SZP A;  2MC6 A;  1MQJ A;  2CZK A;  4I40 A;  3KN3 A;  1K9Z A;  4JB7 A;  4G2Z A;  4RK9 A;  3RT6 B;  4F6N A;  3V5A A;  4XTC Q;  2L33 A;  2DOJ A;  3PU5 A;  4GWX A;  1B7U A;  5KCJ A;  5EYH A;  2O7U A;  3N6T A;  3EHU A;  2VE7 C;  4ZE8 A;  2EL4 A;  2Y5K A;  2WZO A;  4MBP A;  3F11 A;  4IB2 A;  3HST A;  4OA4 A;  3IX1 A;  2XXW A;  2EOY A;  3IO6 A;  1LBZ A;  2B3T B;  2RC7 A;  4QBA A;  3V89 B;  3VHT B;  4MEV A;  1EH6 A;  3EPK A;  3GBA A;  3TTN A;  4IO3 A;  5HM4 B;  2WEF A;  2JYA A;  2CZL A;  3TCF A;  4L8N A;  1T4L B;  3C4B A;  1IXH A;  5A5X B;  2DXR A;  2P3V A;  4JBZ A;  3F6H A;  2CTD A;  4PCD A;  3C6K A;  4ESX A;  4ZDM A;  3S2V A;  4N8G A;  3EPE A;  1AAY A;  1LAG E;  3PTY A;  4R2E A;  4IGT A;  1FQB A;  1MXU A;  5IXM B;  1PB7 A;  1QUL A;  4KYD A;  4LVQ A;  5IZ3 B;  3K6U A;  3MQ9 A;  1HNZ E;  3TOD A;  3W15 C;  2GQ1 A;  2QSX A;  4LZ7 A;  2X7P A;  3VLW A;  1UTB A;  3BFT A;  3KSJ A;  2YTO A;  2P3N A;  3EHT A;  2GH9 A;  4NX1 A;  2DGC A;  5I56 A;  1MPC A;  2HJJ A;  1A54 A;  2EOM A;  4IS1 C;  1B3F A;  5ET6 A;  1ZLQ A;  4R2S A;  3MZ1 A;  2EOI A;  4O43 A;  4UAC A;  5L9M A;  1SYI A;  1ZTY A;  2Q8J A;  1POT A;  3PUZ E;  4DR5 E;  2KON A;  4POW A;  2ONK E;  2LO3 A;  4R2D A;  2JOX A;  1ZAA C;  3CG1 A;  4NMY A;  5KL4 A;  3H06 B;  4K3F A;  2EM7 A;  2I58 A;  3KBR A;  1LAX A;  5ELV A;  2B3B A;  3RLF E;  5A6A A;  2WYP A;  4GLI A;  3LC8 A;  4JSO A;  1NNP A;  3UP9 A;  1CNQ A;  4YZZ A;  1AOV A;  2VQF E;  1MY0 A;  2EMA A;  1IBM E;  5KCJ B;  3EF7 A;  3MC2 A;  3OTO E;  2B7T A;  2MC5 A;  3PUY E;  5HBC A;  3GYY A;  3K4U A;  4P3L A;  4JVC A;  3H7M A;  3VVD A;  2GHF A;  2AIX A;  2PX1 A;  2JPA A;  1SYH A;  3FXB A;  3K2D A;  1AIV A;  3BID A;  2WBS A;  3FV2 A;  3THI A;  3QIM A;  1KJK A;  4HE0 A;  2QMX A;  2JWO A;  5AA4 B;  1XVX A;  4YB7 A;  4ZEC A;  1B6H A;  3T1Y E;  1IME A;  1O63 A;  1NUW A;  5KDT B;  1ZBT A;  1N33 E;  1NNK A;  4JV5 E;  1FPB A;  1YYZ A;  4KPT A;  3PMX A;  4DR6 E;  3E78 A;  4OFJ A;  4B3M E;  3SKP A;  3G3K A;  4ELP A;  3TKD A;  2EMI A;  1QUJ A;  4X8R A;  2Z8F A;  4GKJ E;  1Z7M E;  4LZ8 A;  5EQ9 A;  4R2F A;  4UAB A;  4U22 A;  4IGR A;  4HE2 A;  5A6B A;  1YSA C;  4DV7 E;  4G8N A;  4JWX A;  3KSX A;  5AE2 A;  1A1J A;  3RPL A;  1NKX A;  4P78 A;  2ABH A;  1WOD A;  4DV1 E;  4OVP A;  2WBT A;  1YYW A;  2O84 X;  2DSY A;  4HEI A;  1QUK A;  1VE4 A;  3VXC A;  1MS7 A;  3OEK A;  1GVC A;  2E0S A;  2V86 A;  4QFO A;  3QXM A;  2EPN A;  3WAE A;  3M3L A;  4MNP A;  2ALU A;  3KOT A;  5AE3 A;  1M5B A;  4IO2 A;  4N07 A;  4DMI A;  1FJG E;  3JTZ A;  3FV1 A;  3ZOQ B;  4F2Q A;  3OO8 A;  3GZG A;  1USY H;  5AA3 A;  2EWL A;  2FGG A;  3IOU A;  1FQD A;  1JEU A;  2HAV A;  4QRZ A;  4XKP A;  1URG A;  1FPJ A;  3FBP A;  1MXZ A;  1S9T A;  2FNC A;  1FTO A;  2WYK A;  3C31 A;  4EDP A;  3JAM C;  1FSA A;  4R2P A;  1ZU1 A;  1FQE A;  1B40 A;  1IMU A;  2JVA A;  4FEB A;  5IKB A;  1TF3 A;  4GX4 A;  4LU9 A;  2PT1 A;  1ELJ A;  4DR7 E;  3EHS A;  4YY3 E;  2Y7W A;  1Q35 A;  2OCU A;  3D4C A;  4POX A;  2BJI A;  3LUY A;  2YU5 A;  4ELQ A;  1MXY A;  1T38 A;  2RSM A;  2RCA A;  1LBB A;  2DRP A;  2F7B A;  1B9J A;  5CC2 A;  3B6W A;  3EN3 A;  5B70 A;  4DI3 D;  3MP1 A;  4DE8 A;  2GHA A;  1EH8 A;  2B7V A;  3L6H A;  1MY3 A;  4MNI A;  4XF5 A;  3PPR A;  1WJP A;  2KHX A;  4PGP A;  1MM6 A;  1FPK A;  5TPA A;  3UN6 A;  2LRS A;  4ZE9 A;  2FYI A;  2Y5L A;  3O28 A;  1POY 1;  5I84 A;  2EQ3 A;  4OQO A;  4NTL A;  5IT9 C;  1H44 A;  2R1F A;  3T9H B;  3ADJ A;  4N17 A;  2YTP A;  1UTH A;  3ILU B;  5I58 A;  1J5E E;  4QSD A;  2GRV A;  2EM9 A;  1OMP A;  3IWB A;  3CI8 A;  4XKQ A;  3SEX A;  3ILT B;  2ODR C;  4GVO A;  1N36 E;  1X47 A;  2V87 A;  4DR3 E;  3S9E A;  4KCC A;  3CG3 A;  2DE4 A;  1IBL E;  1UIV A;  1BBO A;  4TUG A;  5I57 B;  3U93 A;  4X64 E;  3ADI A;  4MCO A;  4ECF A;  1MEY C;  2OWZ A;  1FPE A;  2QS3 A;  2PYY A;  3MVX A;  5T3J A;  2YTG A;  3J7Y p;  3K6X A;  1VR5 A;  1ANF A;  1X6F A;  5DVF A;  4O7I A;  3KWR A;  3H6T A;  2EPK X;  4GQO A;  5ITP A;  2FIX A;  4JYA E;  1ZBM A;  4TUI A;  4KHP E;  1BIY A;  4ZEF A;  4OVT A;  3HQ1 A;  2EOX A;  2FHY A;  5KL5 A;  1YTV A;  1MXX A;  1NCS A;  5EQ7 A;  2P0S A;  5ICT A;  4NED A;  3JV9 A;  1MG1 A;  4OZ9 A;  3SEU A;  3C36 A;  4F3G A;  1MH4 A;  3C4T A;  1IXG A;  1SPI A;  1FPF A;  5J16 A;  4WKM A;  4RY1 A;  5IWA E;  5L8D A;  3JZJ A;  1PC3 A;  3ADL A;  2WBD A;  2XX7 A;  4OEN A;  1Y1M A;  4R2Q A;  4OVJ A;  2UXC E;  1MH3 A;  2YTJ A;  3EPJ A;  2NUE A;  2Q9T A;  3BF2 A;  1B51 A;  2B4M A;  2Y7K A;  5JEI A;  3Q26 A;  2JJK A;  4WSG A;  4B3S E;  5EHM A;  4ZEB A;  4F9B B;  2DWI A;  1RKM A;  3O6H A;  4N4U A;  2HHH E;  1YPN A;  4F9C B;  2VPO A;  3TTR A;  1A1G A;  1DCU A;  2UVH A;  1BLF A;  3RUM A;  1Z7N E;  2DDK A;  4YKK A;  3B7D A;  5BUU A;  2E1S A;  3TEL A;  2A5S A;  2Z23 A;  3PUW E;  1P1U A;  2UXB E;  5IGA A;  2R76 A;  1Y3N A;  3PV0 E;  3KFM A;  2UVG A;  5ET8 A;  4JWY A;  1EZO A;  1FBE A;  4X65 E;  1B7Z A;  1NFT A;  1Y9U A;  1WHN A;  3G3F A;  4R73 A;  5I2K A;  2IA4 A;  4GOT A;  2Q2C A;  3RYD A;  5AA1 A;  3MYU A;  2XXQ A;  3KBZ A;  1HSL A;  3FIR A;  2YTI A;  2NWJ A;  4N6D A;  2LJU A;  4QFN A;  4H67 A;  2UYF A;  1P1Q A;  3ECR A;  2O51 A;  2VP1 A;  3ZSF A;  5I3S A;  1P1O A;  2MDG A;  3K00 A;  4DDD A;  1MPD A;  3THN A;  5EYG A;  5F3W A;  3CRB A;  3OO6 A;  2X7Q A;  4HTG A;  3KGC A;  4NQ8 A;  5IV8 B;  4WX9 A;  3BKI B;  2FA7 A;  3J81 C;  2F6G A;  3CVG A;  4M9V C;  2MKN A;  4P8B A;  2F8B A;  2V88 A;  2JR1 A;  1B4Z A;  4FED A;  4XIG Q;  1FBF A;  1GTK A;  2I13 A;  1M5D A;  4Z7E A;  2DE2 A;  4C0R A;  1X5W A;  3VV5 A;  5LDZ A;  3H09 A;  2I49 A;  3GXA A;  4N6P A;  2Z8D A;  1FCK A;  2G29 A;  2Q89 A;  1G2D C;  4Q0C A;  2NA2 A;  2L3C A;  3FXQ A;  2XXH A;  3Q27 A;  1GGG A;  3C34 A;  4PTK A;  3KZZ A;  4DR1 E;  1LCT A;  2HQ0 A;  1DPP A;  3EQ1 A;  3LV0 A;  2ZXT A;  1B3H A;  1FKA E;  2N3H A;  2CPN A;  3JYR A;  1HSJ A;  4Q8R A;  2EPM X;  3S9N C;  5AE1 A;  4KZS A;  1FBD A;  2THI A;  4Z0I A;  3UOR A;  4PFI A;  4F54 A;  4IO4 A;  3EKI A;  4NZV A;  1PB8 A;  2E1M A;  3U8Q A;  2G93 A;  3L00 A;  4E0X A;  3SEV A;  3N94 A;  1JQF A;  2HXR A;  3R6U A;  1RDY A;  3U65 A;  3OEM A;  5J1D A;  5JTY B;  1LBC A;  1UN6 B;  2G7H A;  2QS2 A;  2LE2 A;  4GWZ A;  2EMB A;  4MLQ A;  4JI3 E;  3K02 A;  3KN8 A;  3O29 A;  2REG A;  3TTM A;  1R9Q A;  3IFA A;  3O2A A;  1TFA A;  4C1T A;  2UUC E;  2VOZ A;  4O94 A;  2ZNS A;  4DXC A;  2F3D A;  5H8H A;  1Y4C A;  5KZT A;  1RQ0 A;  1RDX A;  2O1L A;  5H8F B;  4BDO A;  4NN3 A;  3KN7 A;  4R72 A;  2EN2 A;  3HPZ A;  2DP8 A;  5I2N B;  3TEP A;  1I69 A;  4FIM A;  4YAH X;  3PD8 A;  5CMK A;  4WED A;  1IZ1 A;  4PBQ A;  2LT7 A;  4BS9 A;  5LOM A;  4AB5 A;  3ODB A;  2I4C A;  2ZYK A;  4DR4 E;  3T1H E;  2GFE A;  1N34 E;  4LF9 E;  3PMV A;  1AL3 A;  3Q25 A;  3OEN A;  1HSE A;  3S4U A;  2XWV A;  3LML A;  1IMC A;  3U1O A;  2WX9 A;  4GRK A;  4R6H A;  3KZG A;  4RJZ A;  5IZZ A;  4K0K E;  2HEU A;  2YRH A;  4WYQ B;  4R75 A;  4IO5 A;  1AWB A;  2QJE A;  3TDJ A;  4P7D A;  1O0W A;  4ZYG A;  4OFL A;  5KL7 A;  4H65 A;  1FPI A;  3FVK A;  4X8W A;  4O8M A;  4R2A A;  3TTL A;  1LST A;  1D3K A;  1R6Z A;  3LBS A;  3MUQ A;  5ICQ A;  2E72 A;  3BIH A;  3VYY A;  3FVG A;  4DUY E;  3ZS6 A;  3OXN A;  3ADG A;  4FBP A;  1OIB A;  4I8C A;  3LR1 A;  5K2X A;  2QPQ A;  4F1U A;  5I59 A;  2I3W A;  3M8U A;  4NF5 B;  4KQP A;  5A5X A;  2BBG A;  1LGB C;  5BWJ A;  1IMB A;  2PRT A;  3SDF A;  3KEI A;  1Q9D A;  1QJM A;  4MH5 A;  5H8Q B;  3A09 A;  4RH8 A;  3FJ7 A;  4G4P A;  3CSG A;  2M1S A;  3S9L C;  5EHS A;  1MDP 1;  1QGX A;  4GX3 A;  5I7I A;  5F1Q A;  2K4V A;  4JI0 E;  1MXW A;  4PFU A;  1Y20 A;  4RA1 A;  4JWO A;  2QS1 A;  4DIG A;  1UTB B;  1VDW A;  1CE2 A;  4RXL A;  1Y1Z A;  4OEU A;  4R6Y A;  2YLN A;  1KYQ A;  3PPQ A;  4QFK A;  1SW1 A;  1TXF A;  5IAI A;  2CEX A;  3MPK A;  4F22 A;  4KXP A;  5FHO A;  2ZYN A;  2EM0 A;  3MVW A;  4ZED A;  3M3F A;  2OWT A;  3H6W A;  3VDF A;  1B1H A;  4IO7 A;  3W9W A;  1XC1 A;  1J26 A;  2FBP A;  1B3G A;  2PT2 A;  3RQT A;  4OFO A;  3OML A;  4N6K A;  1B3E A;  2L5V A;  2CZH A;  4IR8 A;  3SER A;  3NOH A;  1WHQ A;  2YTN A;  2LUQ A;  3BBR A;  1N3G A;  5CMB A;  2L6M A;  3MZ9 A;  4NXM E;  2B3F A;  4BDL A;  2V3T A;  2XD3 A;  4X9J A;  2XA5 A;  1M5E A;  4G68 B;  4OWD A;  2OLB A;  3PGF A;  3SES A;  3K1P A;  1X49 A;  2NUG A;  2NOO A;  3HN0 A;  2XWI A;  2V84 A;  4XEQ A;  4B3R E;  4H46 A;  2JP9 A;  3K1N A;  2DIX A;  2LMZ A;  1XMQ E;  4F29 A;  3U72 A;  1AH5 A;  1D9V A;  2VGQ A;  4OTE A;  2YWQ A;  3EPL A;  2EL6 A;  1TWY A;  1X3C A;  1FW0 A;  4YMA A;  4LFB E;  3HXL A;  4ISU A;  5KDT A;  1KWH A;  4F3B A;  2EMZ A;  1N0T A;  4U4X A;  1DSN A;  3T9V A;  1O7T A;  2RC8 A;  4OX9 E;  1H45 A;  2UVJ A;  5H8N A;  2GLI A;  3SET A;  5K2Y A;  3LSL A;  3IB1 A;  1FRP A;  5TSE A;  4F6M A;  3AV0 A;  1X6E A;  2VT5 A;  1T39 A;  4EUO A;  4P1L A;  2EM2 A;  5T6J A;  1I6Q A;  5A6K A;  2HPG A;  4L17 A;  1UQW A;  2UU9 E;  2VQE E;  3FAS A;  1WRJ A;  4YU0 A;  2DS9 A;  1A99 A;  4P1E A;  4H5G A;  4QHQ A;  4OMB A;  3FIG A;  1SBP A;  4G8H A;  3R26 A;  1XI6 A;  2YJP A;  4RPN A;  3E3K A;  2ZNT A;  5A6J A;  3AXF A;  3MPL A;  4F1Y A;  1Y3Q A;  2D21 A;  2RIN A;  4KD5 A;  3T93 B;  1YYK A;  2EP3 A;  2I9I A;  5LL6 R;  3LSF B;  1M5F A;  2RQL A;  1EYI A;  2VF1 A;  1QVS A;  3CFL A;  5A2Q C;  1DGC A;  4LF6 E;  1BKA A;  2EN4 A;  2V8Q B;  1FQA A;  1MXV A;  2RTX A;  1AMF A;  1PBP A;  1VFE A;  2R6G E;  5IZ3 A;  3EPH A;  5TP9 A;  2L2M A;  2RPC A;  4MLV A;  4N8Y A;  4DUZ E;  2OX3 A;  4NF0 A;  3RGY A;  4M30 A;  2PCR A;  3BGH A;  4P11 A;  1LEV A;  3O6G A;  4BHC A;  1K9Y A;  4ZEK A;  4BMJ A;  3HCQ A;  5FHN A;  4THI A;  1NUZ A;  4LQ5 A;  1OQH A;  4R6K A;  5CRY A;  2JXP A;  4R8O A;  4LUB A;  3WAF A;  1NNF A;  2GPI A;  1J1N A;  2V83 A;  1ZMG A;  2EN6 A;  4BDM A;  2X26 A;  1FTM A;  4I62 A;  1NV4 A;  5AA2 D;  1A8F A;  1D4N A;  3KJ7 A;  1N04 A;  1S7Y A;  1FPG A;  4OVS A;  3PPO A;  1F2I G;  1N7X A;  3IFC A;  2CSH A;  5ISU A;  3HV1 A;  3H6U A;  5FTH A;  2XXV A;  3RNN A;  1IMF A;  1DMB A;  1VFD A;  4PDD A;  2Q8M A;  1DI2 A;  2CT1 A;  4QF9 A;  4E0W A;  2EE8 A;  4NF6 B;  1TF6 A;  3QMF A;  5DTB A;  5DNY A;  2XHD A;  3T1B A;  4JI2 E;  3T96 B;  4DV3 E;  1YYO A;  4MIJ A;  4NHB A;  2MDR A;  3IK6 B;  1JP4 A;  2Y7P A;  2QFL A;  3LSX A;  2KQZ A;  1B4H A;  2EL5 A;  3LUZ A;  1G0I A;  1T0K A;  1P47 A;  1IUD A;  4GIZ A;  5F7V A;  4M1V A;  2FIE A;  4ZYD A;  2N8X A;  2DLQ A;  4OYV A;  4PET A;  1DTZ A;  2NUF A;  2HXW A;  4H8I A;  4I3E A;  4TOZ A;  2XXK A;  2Y7I A;  2ENC A;  2A25 A;  3JU0 A;  3IB2 A;  2RCB A;  5CM6 A;  2DSF A;  4WEP A;  2B4L A;  3DP6 A;  4NF8 A;  2EZ6 A;  2ENA A;  3QK6 A;  1G0H A;  4LTY A;  4JI1 E;  4DV5 E;  1DBZ A;  4GF8 A;  5IM2 A;  1NH8 A;  4OVR A;  2LCE A;  2EMW A;  4HCY A;  4G68 C;  1MM7 A;  1URS A;  2Z22 A;  2EMH A;  1A1L A;  3G3H A;  2OK2 A;  4AQY E;  3FXR A;  1P1N A;  4FEC A;  4LF8 E;  4GD5 A;  4U4S A;  3VFJ A;  4JI8 E;  4R2B A;  3TYH A;  1O64 A;  1FTA A;  5AA2 A;  3FAT A;  1UHZ A;  1N84 A;  4GEQ B;  5FHM A;  3V83 A;  3V8X B;  4F18 A;  3O6I A;  1JK2 A;  4HCW A;  4LF5 E;  4G77 A;  2VPN A;  2A5T A;  1N3W A;  4PF8 A;  3IR1 A;  2F7C A;  5LMN E;  4DV6 E;  2DVZ A;  4GXA A;  5B7D A;  5CFF E;  4MX6 A;  5KL2 A;  1I94 E;  2I48 A;  4RYA A;  2F4V E;  4GL8 A;  4LZ5 A;  1B1X A;  1N3X A;  3A3C A;  4F9A B;  5ADZ A;  4ZZE A;  4X48 A;  5FTI A;  1IQ7 A;  3TQW A;  3AUZ A;  3MP8 A;  1IIT A;  4QXD A;  2EPX A;  3VLU A;  1NUY A;  3LLH A;  4M2Z A;  1NL5 A;  4GKK E;  4GBW A;  1SI1 A;  2EPA A;  4ZYE A;  4JI5 E;  1NV6 A;  1IEJ A;  1Y3P A;  4YKP A;  1NI9 A;  2LVH A;  3IJX B;  4O3C A;  2QVU A;  4F19 A;  3HHG A;  4NG7 A;  1VSO A;  2Q8U A;  2DB2 A;  2LUP B;  2KR0 A;  1YAE A;  2RF1 A;  4KI0 E;  1SR9 A;  4X9T A;  4ZZA A;  2D5W A;  4I8O A;  2W7Y A;  2XWK A;  4MHF A;  4HW8 A;  4DCY A;  2OJT A;  1A1H A;  1LFG A;  1SDX A;  4AQ4 A;  1GV8 A;  1MQD A;  5HPQ A;  2LJH A;  3BBG A;  2ONS A;  2FVZ A;  5TU0 A;  3G3G A;  3UA8 A;  4LF4 E;  2AL4 A;  2DMY A;  1NH7 A;  3FJM A;  2GHB A;  4KR5 A;  2CZI A;  3THO B;  4NWD A;  4NGU A;  5CBS A;  2EN1 A;  2HZK A;  4ZS9 A;  3G7W A;  4JI4 E;  5CMC A;  1US4 A;  1NV0 A;  4OEV A;  4PQJ A;  1A1F A;  5DEX B;  4JVI A;  1B5J A;  5H8H B;  1RDZ A;  4DV2 E;  1NV1 A;  1FTL A;  3MVY A;  4HE1 A;  1UBD C;  1QKB A;  2YT4 A;  2RC9 A;  4GFR A;  3FZV A;  1XNR E;  1R1N A;  2F97 A;  4XKN A;  2EMY A;  3CFX A;  3GBB A;  4ONY A;  3TUS A;  1A40 A;  1MY2 A;  1PEB A;  1B32 A;  1UIU A;  3UK4 A;  1FTJ A;  4DI4 B;  2AL5 A;  4JSD A;  1MPB A;  3OOA A;  1IXC A;  4FK5 C;  4O4K A;  2UYE A;  2QL3 A;  4I1D A;  4F3S A;  1CB6 A;  3ZKK A;  3K6W A;  2RKM A;  4TQU Q;  1OLA A;  4DKK A;  1L5T A;  2D9H A;  2XX8 A;  2V93 A;  4P0G A;  1LFH A;  2ELZ A;  3TFL A;  3C4M A;  3G3J A;  3HHF A;  4J8Z A;  4GWU A;  4DZ1 A;  4WXJ A;  4EQ7 A;  4UA8 A;  4PDH A;  3I3V A;  1NV7 A;  1M5C A;  3LSW A;  4PFY A;  4WPY A;  3E79 A;  5FBP A;  1URD A;  3UIF A;  2NAB A;  3BFU A;  1H3D A;  1DOT A;  3TTK A;  2YTE A;  4RHB B;  2O6A A;  3H4Z A;  1EYK A;  3N6U A;  4BDQ A;  4R03 A;  1RYX A;  3IO4 A;  3E4R A;  2DXY A;  4H0W A;  4DCX A;  3N26 A;  3TCH A;  2YTQ A;  1GR2 A;  2ESN A;  1FBH A;  3I5O A;  3DM0 A;  3R7X A;  3ROJ A;  3RT8 A;  4NF5 A;  2EMF A;  2EM8 A;  3IOV A;  3TQM A;  1NEI A;  2F3B A;  1IMD A;  3TCG A;  1H43 A;  3Q29 A;  3VVF A;  2L3J A;  2V3Q A;  3K0V A;  2EPP A;  2D3I A;  4YKJ A;  2ADR A;  2XXU A;  2I4B A;  2HHM A;  1DPE A;  2RS6 A;  2ZMB A;  3ISP A;  3PUX E;  2EJ4 A;  4H8J A;  4TLL B;  4X62 E;  2XX9 A;  2ZNU A;  5AE4 A;  4PE3 A;  1B46 A;  5KL3 A;  4O5G A;  2REJ A;  1A1K A;  2I6E A;  2PMS A;  1F9B A;  1MQG A;  1EZ9 A;  3FVO A;  5I2N A;  4U1Z A;  2OBG A;  3CHG A;  3W9V A;  2F78 A;  4R2R A;  4I3Y A;  5ET7 A;  1FPD A;  3DLN A;  1INP A;  1FTK A;  4NE4 A;  3PD9 A;  5ITO A;  4B3T E;  1B2H A;  1B5I A;  1NMU A;  2NXO A;  3KOS A;  1BP5 A;  4OOG C;  2V3U A;  3H3G A;  4Q35 B;  3F6G A;  1YUJ A;  1G2F C;  3C6M A;  1WVJ A;  4NAP A;  4G68 A;  2YTD A;  2EOQ A;  2WBU A;  1XOC A;  4GWY A;  1OQG A;  5DT6 A;  4GWO A;  2EQ1 A;  1FBG A;  3C9H A;  2L2K B;  1XMO E;  3K1M A;  2ZZV A;  2QS4 A;  1FPL A;  4P0I A;  4WFT A;  5I56 B;  4YIC A;  3O66 A;  1ZR9 A;  1D9Y A;  4GX6 A;  2I0B A;  3J80 C;  2L8T A;  4F1V A;  1DQ3 A;  4YB5 A;  1USY E;  2UVI A;  2ONR A;  1TFD A;  1ZIU A;  2XXP A;  2EOO A;  5AC4 A;  2H9B A;  1YZ0 A;  1D9Q A;  2QRY A;  2WCC 3;  3T9X B;  2EM5 A;  3IOR A;  1STU A;  3RTF B;  1WDN A;  1LBV A;  1DK4 A;  3QAX A;  5ESY A;  4BDR A;  2JOB A;  1PBQ A;  4XKR A;  2N3G A;  3K6V A;  3QUJ A;  1N76 A;  2R71 A;  2EMX A;  1BB8 A;  4NF4 B;  3RTW B;  2O68 A;  4Q5T A;  1L4S A;  1SW5 A;  3MBP A;  5TPA B;  5LTC A;  1WXR A;  1P99 A;  1OLC A;  3KC1 A;  2ZZW A; 
#chains in the Genus database with same CATH homology
 1OQH A;  3ONM A;  3Q26 A;  1MRP A;  4R6K A;  3I6V A;  1RYO A;  4PE5 B;  4LUB A;  5CRY A;  2XXR A;  3WAF A;  1NNF A;  5EHM A;  3OEL A;  4O3A A;  2F8D A;  4Q30 B;  4QFL A;  1JVX A;  4ZEB A;  2DWI A;  1J1N A;  1RKM A;  4FAJ A;  2O7I A;  1ZMG A;  3DP8 A;  1JEV A;  2Z8E A;  1JET A;  3O6H A;  1R9L A;  4MFI A;  4BDM A;  2X26 A;  1YPN A;  1FTM A;  4I62 A;  3HPI A;  5AA2 D;  1A8F A;  1D4N A;  2UVH A;  1N04 A;  1S7Y A;  3KJ7 A;  4U2R A;  1BLF A;  2VHA A;  4U23 A;  3PPO A;  1EZP A;  3FXU A;  3OO9 A;  1B7H A;  1Z7N E;  3RUM A;  4YKK A;  3B7D A;  4H1X A;  5BUU A;  1I6A A;  1N7X A;  3CR9 A;  4BDN A;  3MP6 A;  1II5 A;  3MW0 A;  5ISU A;  3HV1 A;  1TT1 A;  2E1S A;  3H6U A;  5FTH A;  3E9X A;  1LAH E;  1LAF E;  4KCD A;  3FJG A;  2WKY A;  2XXV A;  2XXX A;  3RNN A;  5JTY A;  3TEL A;  1NNT A;  4QSC A;  2A5S A;  2Z23 A;  2O1M A;  1DMB A;  1B0H A;  1VFD A;  3FVN A;  3PUW E;  1P1U A;  5CI5 A;  3MAM A;  2F6P A;  3DP4 A;  4QF9 A;  4E0W A;  1Y3N A;  4F39 A;  3PV0 E;  3KFM A;  2UVG A;  4DXB A;  4NF6 B;  4JWY A;  2DE3 A;  1EZO A;  1B7Z A;  1NFT A;  1Y9U A;  3G3F A;  4R73 A;  5DTB A;  5I2K A;  1MQJ A;  3KN3 A;  2IA4 A;  3MVZ A;  4GOT A;  2Q2C A;  4OET A;  1JW4 A;  2DWA A;  2XHD A;  5AA1 A;  1EH3 A;  4JB7 A;  1QUI A;  4G2Z A;  2XXQ A;  4RK9 A;  1HSL A;  3T66 A;  3RT6 B;  1A8E A;  3V5A A;  3T96 B;  4XTC Q;  3USD A;  2DOJ A;  2PVU A;  3C33 A;  3FIR A;  4LAT A;  3RPW A;  4XXU A;  2VD2 A;  2NWJ A;  5H8F A;  3IK6 B;  3IOW A;  4N13 A;  2AYS A;  4QFN A;  3G3I A;  2Y7P A;  2UYF A;  1P1Q A;  3LSX A;  3ECR A;  3PU5 A;  4H67 A;  4IY6 A;  3RY3 A;  2O51 A;  2VP1 A;  1B4H A;  1B7U A;  3ZSF A;  5KCJ A;  1P1O A;  2O7U A;  3K00 A;  4DDD A;  3N6T A;  1MPD A;  3EHU A;  4ZE8 A;  3CRB A;  1T0K A;  1IUD A;  3OO6 A;  2X7Q A;  4GIZ A;  5F7V A;  4HTG A;  4M1V A;  3KGC A;  3F11 A;  4MBP A;  4F1Y A;  4IB2 A;  4OXV A;  3BKI B;  3Q28 A;  2B65 A;  2FA7 A;  3HST A;  4IO6 A;  4JXI A;  4OYV A;  3IX1 A;  2XXW A;  3IO6 A;  4PET A;  2I3V A;  3DEL B;  2F6G A;  4H5F A;  1DTZ A;  2ANJ A;  2HXW A;  2RC7 A;  2ZYM A;  4H8I A;  3CVG A;  3FGS A;  4TOZ A;  3V89 B;  4KYS A;  2Y7I A;  3IB2 A;  3GBA A;  3TTN A;  1ATG A;  2RCB A;  5CM6 A;  2DSF A;  4IO3 A;  4LQ2 A;  4PFW A;  5HM4 B;  1LB9 A;  1MQH A;  5H8S A;  2CZL A;  2QMW A;  4R9G A;  4WEP A;  2PBW A;  3TCF A;  4NF4 A;  3DP6 A;  1B4Z A;  1IXH A;  4NF8 A;  5A5X B;  4FED A;  2DXR A;  4JBZ A;  3MJN A;  4XIG Q;  3QK6 A;  1GTK A;  3C35 A;  1M5D A;  1B3L A;  4GF8 A;  4Z7E A;  2DE2 A;  4C0R A;  4ESX A;  1NH8 A;  4ZDM A;  3VV5 A;  3S2V A;  1A55 A;  1FQF A;  4HCY A;  3PUV E;  4G68 C;  4NWC A;  1MM7 A;  3EPE A;  1SW4 A;  2I49 A;  3GXA A;  3TZA A;  1URS A;  1LAG E;  3S9E A;  4N6P A;  2Z8D A;  2Z22 A;  4DCX A;  3G3H A;  1FCK A;  4IGT A;  2P2A A;  1FQB A;  1MXU A;  1PB7 A;  2G29 A;  1QUL A;  2OK2 A;  3FXR A;  4H6D A;  4KYD A;  4LVQ A;  2Q89 A;  3VLV A;  4Q0C A;  2ZYO A;  3K6U A;  3MQ9 A;  1P1N A;  3TQL A;  1IXI A;  3FXQ A;  3H6V A;  4FEC A;  3CFZ A;  3TOD A;  1I6B A;  3W15 C;  5L9S A;  2QSX A;  4GD5 A;  4LZ7 A;  4U4S A;  2X7P A;  3VFJ A;  2XXH A;  3Q27 A;  1UTB A;  1GGG A;  2H5Y A;  3BFT A;  3KSJ A;  3C34 A;  3K01 A;  3EHT A;  2DWH A;  2GH9 A;  4R2B A;  1LCT A;  2HQ0 A;  1O64 A;  3TYH A;  5AA2 A;  4I9D A;  5FHO A;  1DPP A;  3EQ1 A;  5I56 A;  2ZXT A;  1B3H A;  1SD3 A;  3FAT A;  3IAZ A;  4R9F A;  5AA4 A;  1N84 A;  1MPC A;  4EF1 A;  1A54 A;  5FHM A;  3V83 A;  3V8X B;  4F18 A;  3JYR A;  1B3F A;  3O6I A;  1HSJ A;  1ZLQ A;  4HCW A;  1US5 A;  4Q8R A;  4U21 A;  4G77 A;  3MZ1 A;  4KHZ E;  3SEY A;  3S9N C;  2A5T A;  2THI A;  1N3W A;  4UAC A;  3MWB A;  3IR1 A;  4Z0I A;  3UOR A;  2F7C A;  4IO4 A;  4OHN A;  1SYI A;  1ZTY A;  5L9M A;  2Q8J A;  2DVZ A;  4GXA A;  3VLW A;  1POT A;  3PUZ E;  4POW A;  5B7D A;  1MY1 A;  2ONK E;  2I48 A;  3FD3 A;  3CG1 A;  4RYA A;  4NMY A;  4GL8 A;  1PB8 A;  3U8Q A;  3H06 B;  2G93 A;  4K3F A;  4LZ5 A;  4NF8 B;  2I58 A;  4TLM B;  3KBR A;  1B1X A;  1LAX A;  5ELV A;  1N3X A;  2B3B A;  3A3C A;  4ZZE A;  3RLF E;  3SEV A;  3N94 A;  1JQF A;  4X48 A;  4E0X A;  4FOR A;  1JW5 A;  3R6U A;  4GLI A;  3OEM A;  1B0L A;  3LC8 A;  4JSO A;  1NNP A;  5J1D A;  5FTI A;  1IQ7 A;  1LBC A;  5JTY B;  3TQW A;  3UP9 A;  3TTR A;  2XXI A;  2QS2 A;  3MP8 A;  4MF3 A;  2UXA A;  1IIT A;  4DXU A;  4YZZ A;  1AOV A;  1MY0 A;  4HS7 A;  4MLQ A;  1JW1 A;  1MQI A;  3VLU A;  5KCJ B;  4LA9 A;  3EF7 A;  3MC2 A;  3K02 A;  3KN8 A;  3VXB A;  3O29 A;  3A3U A;  3PUY E;  1NL5 A;  2REG A;  5HBC A;  1R9Q A;  3TTM A;  3U94 A;  3KJT A;  3B6Q A;  3QYT A;  3H03 A;  3K4U A;  3VVD A;  2HZL A;  3H7M A;  1JVY A;  1MY4 A;  3O2A A;  2AIX A;  5I58 B;  1TFA A;  2PX1 A;  1SI1 A;  1SYH A;  3K2D A;  3VE1 B;  1AIV A;  2Q2A A;  3THI A;  3FV2 A;  3QIM A;  3TMG A;  2VOZ A;  4C1T A;  2ZNS A;  1IEJ A;  4DXC A;  5AA2 B;  5H8H A;  1Y4C A;  2QMX A;  1Y3P A;  2P1S A;  2O1L A;  4YKP A;  5H8F B;  4BDO A;  4RK2 A;  4ELO A;  3IJX B;  2H98 A;  1XVX A;  4O3C A;  5AA4 B;  4F19 A;  2V25 A;  3KN7 A;  3HHG A;  4R72 A;  1B05 A;  1LLS A;  1VSO A;  4YB7 A;  3OO7 A;  4ZEC A;  3T93 B;  1B6H A;  3QSL A;  1O63 A;  1YAE A;  2RF1 A;  4KI0 E;  5KDT B;  5KZT A;  2DP8 A;  5I2N B;  3TEP A;  1I69 A;  2A5T B;  4X9T A;  1NNK A;  2F5X A;  2D5W A;  2W7Y A;  4FIM A;  4ZZA A;  4HW8 A;  4KPT A;  1PDA A;  4YAH X;  3PD8 A;  3PMX A;  2OJT A;  4DCY A;  2IEE A;  4FE8 A;  4PP0 A;  5CMK A;  1LFG A;  2YPN A;  1SDX A;  4OFJ A;  4WED A;  1GV8 A;  4AQ4 A;  1IZ1 A;  1MQD A;  4EQ7 A;  3SKP A;  3G3K A;  5L9O A;  4ELP A;  5HPQ A;  2ONS A;  5TU0 A;  3TKD A;  2Y7R A;  3G3G A;  3ODB A;  3UA8 A;  4AB5 A;  5LOM A;  3PMW A;  2I4C A;  2AL4 A;  2ZYK A;  1QUJ A;  5EHS A;  2Z8F A;  2GFE A;  3VVE A;  4OER A;  1Z7M E;  1NH7 A;  3FJM A;  4NF6 A;  4LZ8 A;  4ELR A;  2GHB A;  4KR5 A;  3PMV A;  4R2F A;  4U22 A;  1AL3 A;  4IGR A;  3Q25 A;  3OEN A;  4NWD A;  1HSE A;  3S4U A;  2VD3 A;  4O3B A;  4G8N A;  4JWX A;  3KSX A;  3U1O A;  1LFI A;  4F3P A;  1LCF A;  4GRK A;  4JDF A;  3KZG A;  2F35 A;  1NKX A;  4R6H A;  5CBS A;  2ABH A;  3E13 X;  4RJZ A;  1WOD A;  1YCJ A;  2HEU A;  1OVT A;  3QUF A;  2HZK A;  4R75 A;  1QW0 A;  2O84 X;  2F36 A;  4ZS9 A;  1QUK A;  1VE4 A;  3G7W A;  5CMC A;  1US4 A;  3VXC A;  2XD2 A;  1MS7 A;  3KG2 A;  4IO5 A;  4OEV A;  2QJE A;  4ND9 A;  3TDJ A;  4PQJ A;  3OEK A;  5DEX B;  1GVC A;  2E0S A;  4OFL A;  1B5J A;  4H65 A;  3TPA A;  5H8H B;  4YB6 A;  3FVK A;  5EYF A;  3TTL A;  1FTL A;  1LST A;  1D3K A;  1R6Z A;  3LBS A;  3MUQ A;  4QFO A;  3TAJ A;  5ICQ A;  3MVY A;  3QXM A;  3WAE A;  1QKB A;  3M3L A;  2RC9 A;  4GFR A;  4QFP A;  3FVG A;  3FZV A;  1R1N A;  2F97 A;  3GLB A;  3OSQ A;  2ALU A;  3CFX A;  3KOT A;  4XKN A;  4X1B A;  3GBB A;  3ZS6 A;  3OXN A;  5H8N B;  1XHY A;  4ONY A;  2XXT A;  4IO2 A;  1A40 A;  1M5B A;  1MY2 A;  4N07 A;  1OIB A;  1LB8 A;  1PEB A;  1B32 A;  1B52 A;  1UIU A;  4RPO A;  4I8C A;  3LR1 A;  3OMB A;  5K2X A;  3FV1 A;  1QKA A;  1B58 A;  2QPQ A;  4LON B;  4LP2 B;  4F1U A;  4F2Q A;  5I59 A;  3UK4 A;  1FTJ A;  2I3W A;  3M8U A;  3OO8 A;  4NF5 B;  4KQP A;  4RNS A;  5A5X A;  1LGB C;  5BWJ A;  3GZG A;  1USY H;  3OSR A;  5DYH A;  3SDF A;  2AL5 A;  5AA3 A;  4JSD A;  1N7W A;  3T9U A;  1MPB A;  4FAT A;  3KEI A;  1QJM A;  4MH5 A;  2DQV A;  3OOA A;  3A09 A;  5H8Q B;  4KFQ A;  3IOU A;  1FQD A;  1JEU A;  2HAV A;  3FJ7 A;  1A7L A;  4G4P A;  4QRZ A;  1IXC A;  3CSG A;  4XKP A;  1EU8 A;  1URG A;  2QL3 A;  2UYE A;  4I1D A;  1MXZ A;  1S9T A;  2FNC A;  2HCA A;  1MDP 1;  1FTO A;  1XVY A;  1CB6 A;  3C31 A;  1S50 A;  3CSB A;  4M4G A;  3ZKK A;  3K6W A;  2RKM A;  4EDP A;  4TQU Q;  2HAU A;  1OLA A;  1L5T A;  3IJO B;  3CIJ A;  1FQE A;  5F1Q A;  4DLD A;  1B40 A;  2XX8 A;  1UTH B;  1MXW A;  2V93 A;  4PFU A;  1Y20 A;  2KLF A;  4FEB A;  4P0G A;  4RA1 A;  5IKB A;  1LFH A;  1SI0 A;  3TFL A;  4JWO A;  2QS1 A;  4IY5 A;  2PT1 A;  1UTB B;  1ELJ A;  3C4M A;  2LAO A;  2F34 A;  3G3J A;  3HHF A;  4DIG A;  4EF2 A;  4DZ1 A;  3EHS A;  5CBR A;  4WXJ A;  2Y7W A;  1CE2 A;  4RXL A;  1Y1Z A;  5DEX A;  1Q35 A;  2OCU A;  3D4C A;  3FUZ A;  4OEU A;  4R6Y A;  3I3V A;  4UA8 A;  4POX A;  2YLN A;  1M5C A;  3LSW A;  3LUY A;  4PFY A;  3PPQ A;  4QFK A;  1SW1 A;  1URD A;  1TXF A;  2HFB A;  1MDQ A;  3UIF A;  3BFU A;  3MPK A;  4ELQ A;  1MXY A;  2M8C A;  5IAI A;  1H3D A;  2RCA A;  4F22 A;  2O69 A;  1DOT A;  1LBB A;  3MZB A;  2F7B A;  1B9J A;  2O6A A;  2ZYN A;  3H4Z A;  2F7A A;  3B6W A;  3EN3 A;  4FJP A;  3N6U A;  3MVW A;  4ZED A;  5B70 A;  3M3F A;  3MP1 A;  2GHA A;  4BDQ A;  4DE8 A;  1RYX A;  1P1W A;  5I57 A;  3IO4 A;  3E4R A;  2DXY A;  2OWT A;  3H6W A;  1BTJ A;  1PB9 A;  3IOT A;  3L6H A;  3N26 A;  4H0W A;  1B1H A;  4IO7 A;  3TCH A;  3VDF A;  1XC1 A;  2OWS A;  1MY3 A;  1GR2 A;  2ESN A;  3W9W A;  5TP9 B;  1B3G A;  1JNF A;  2PT2 A;  2DVC A;  3DM0 A;  3I5O A;  3PPR A;  4OFO A;  3R7X A;  4PFT A;  3RQT A;  2NUV A;  4NF5 A;  3RT8 A;  1IIW A;  4EQB A;  1B3E A;  3S9L C;  4C1U A;  3SER A;  3IOV A;  4YMB A;  5DVI A;  1MM6 A;  5TPA A;  4GXS B;  3UN6 A;  2H4I A;  3BBR A;  5CMB A;  3MZ9 A;  3TCG A;  4ZE9 A;  2B3F A;  4BDL A;  2FYI A;  2Y84 A;  1H43 A;  2H99 A;  2V3T A;  3Q29 A;  5I2K B;  3VVF A;  3O28 A;  3O97 A;  2XD3 A;  1POY 1;  4EQ9 A;  2V3Q A;  1M5E A;  4G68 B;  4OWD A;  2OLB A;  3K0V A;  3T22 A;  2D3I A;  3PGF A;  1SQY A;  4YKJ A;  3SES A;  3C32 A;  3K1P A;  5I84 A;  2XXU A;  4NTL A;  4OQO A;  1H44 A;  2I4B A;  2NOO A;  5CC2 A;  3T9H B;  3SEW A;  3HN0 A;  4BLA A;  1DPE A;  2V84 A;  1UTH A;  2ZMB A;  3PUX E;  3ILU B;  4H8J A;  1DTG A;  3B6T A;  4QSD A;  4TLL B;  2GRV A;  5I58 A;  3K1N A;  4F29 A;  1OMP A;  3U72 A;  1AH5 A;  3CI8 A;  3OD7 A;  2XX9 A;  1D9V A;  2ZNU A;  2VGQ A;  4XKQ A;  4OTE A;  1Q1K A;  5AE4 A;  3SEX A;  1B46 A;  1ZJL A;  3ILT B;  1B5H A;  1TWY A;  2H25 A;  4GVO A;  2Q88 A;  1FW0 A;  2REJ A;  4YMA A;  4EXL A;  2I6E A;  2PMS A;  3HO7 A;  1F9B A;  1MQG A;  3CG3 A;  3L6G A;  1EZ9 A;  4ISU A;  2DE4 A;  4KCC A;  1KWH A;  3FVO A;  4F3B A;  5I2N A;  4G8M A;  1FQC A;  3ZKL A;  5KDT A;  4U1Z A;  1UIV A;  2OBG A;  5I57 B;  3W9V A;  1N0T A;  3S9M C;  3U93 A;  2DWJ A;  4U4X A;  2BJJ X;  2F78 A;  4ECF A;  1DSN A;  4QSE A;  4OES A;  4U1O A;  3T9V A;  1O7T A;  2RC8 A;  3DLN A;  1H45 A;  2UVJ A;  2QS3 A;  1FTK A;  3PPN A;  5H8N A;  4NE4 A;  3PD9 A;  2PYY A;  3MVX A;  5ITO A;  1B2H A;  5JK4 A;  3SET A;  5K2Y A;  3K6X A;  2NVU B;  1OVB A;  1B5I A;  3LSL A;  3IB1 A;  1NMU A;  1VR5 A;  2NXO A;  3KOS A;  3RN8 A;  1BP5 A;  1ANF A;  2V3U A;  3M3K A;  4F3S A;  5I59 B;  3H3G A;  5DVF A;  5M2V A;  3TUS A;  3UGW A;  4EUO A;  4ZEI A;  1WVJ A;  4G68 A;  1I6Q A;  2XXY A;  3H6T A;  4L17 A;  4KYE A;  4X1D A;  1UQW A;  1XOC A;  4GQO A;  5ITP A;  3FAS A;  1OQG A;  5H8Q A;  5DT6 A;  4YU0 A;  4GWO A;  2DS9 A;  1SW2 A;  4AB6 A;  1A99 A;  4H5G A;  2CMO A;  1ZBM A;  4QHQ A;  3IB0 A;  4OMB A;  3C9H A;  1SBP A;  1BIY A;  4G8H A;  4ZEF A;  3R26 A;  4ESW A;  4F2O A;  2YJP A;  3K1M A;  4F31 B;  2QS4 A;  4RPN A;  4P0I A;  5I56 B;  3E3K A;  2ZNT A;  4YIC A;  3O66 A;  3U92 A;  1YTV A;  1D9Y A;  1MXX A;  2DYX A;  2P0S A;  2I0B A;  5ICT A;  4YKI A;  3AXF A;  4NED A;  4F1V A;  3JV9 A;  1MG1 A;  3MPL A;  4OZ9 A;  4R74 A;  3TTK A;  3N5L A;  1Y3Q A;  2D21 A;  1USY E;  2RIN A;  3P7I A;  4KD5 A;  3O9P A;  4YB5 A;  2UVI A;  3C36 A;  2ONR A;  3SEU A;  1TFD A;  3LSF B;  3PPP A;  1ZIU A;  4F3G A;  1M5F A;  1MH4 A;  2I0C A;  2XXP A;  1ZU0 A;  4GL0 A;  1QVS A;  3CFL A;  2H9B A;  1IXG A;  2QRY A;  3IL1 B;  3T9X B;  1BKA A;  4WKM A;  4EXK A;  1XS5 A;  3IOR A;  4RY1 A;  3RTF B;  1WDN A;  5L8D A;  1FQA A;  1MXV A;  3QAX A;  4BDR A;  2R9J A;  1AMF A;  1PBP A;  1VFE A;  2R6G E;  3JZJ A;  1PBQ A;  1PC3 A;  4XKR A;  3K6V A;  3QUJ A;  3D4G A;  5DVJ A;  1N76 A;  5TP9 A;  2XX7 A;  4MLV A;  2R71 A;  2OZZ A;  4OEN A;  5CMM A;  1Y1M A;  4NF4 B;  3RTW B;  2O68 A;  4OVJ A;  4Q5T A;  3RGY A;  1SW5 A;  1MH3 A;  3MBP A;  5TPA B;  4P11 A;  1ZKB A;  3O6G A;  4ZEK A;  3HCQ A;  2Q9T A;  1P99 A;  1OLC A;  1SVX B;  1H76 A;  5FHN A;  1B51 A;  1Y4T A;  4THI A;  2Y7K A;  1XT8 A;  4LQ5 A;  5JEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...