2LJUA

Solution structure of putative oxidoreductase from ehrlichia chaffeensis, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
104
Chain Sequence
MQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYADNFTKPRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of putative oxidoreductase from Ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 9
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2ljuA01
2LJUA 2JYAA
chains in the Genus database with same CATH superfamily
2EOEA 5A6KA 4NXNE 5F3WA 1HNZE 1J26A 5TSEA 4JI1E 4BBYA 2YTPA 2YTQA 2EN7A 5AC4A 4GKJE 2V83A 3VK6A 2EN2A 1GZ6A 2EM9A 2ODRD 3ADJA 2YRMA 4NXME 1YYOA 4LF6E 2EM3A 2YRKA 2EOZA 3MHHC 2NABA 5AE3A 2EM8A 4F2JC 1G2FC 2YU5A 3BGHA 2KHXA 2EOHA 2GHFA 2JWOA 3VHTB 2EQ3A 3EPLA 3AUZA 1Z1BA 1KJKA 4R03A 4L5NC 1JK1A 4HEIA 4O4KA 4Q35B 5A69A 2JYAA 3J80C 1EH8A 4KHPE 3ECRA 1HNWE 4F9CB 3F6GA 1YYKA 1X48A 4KZSA 3THNA 3M99B 2EOXA 2B7VA 4JI7E 4X64E 1X6HA 2NA2A 2RSMA 5AE1A 2R76A 4TUIA 2M1SA 3LMLA 1YYWA 2ENCA 1NEIA 2ENAA 2EP3A 1HNXE 2YRHA 3VYYA 4O5GA 2CSHA 3C6MA 4LF4E 2LE2A 2VE7C 4DV0E 1ZU1A 2EPOA 1QNTA 3BF2A 1GQEA 4YY3E 2EN6A 2EPLX 4DR3E 2DLKA 2YTGA 2R1FA 5A6JA 2VQFE 2YTOA 4GEQB 3EPHA 2L2MA 4LTYA 1BBOA 4LF8E 1QU6A 2EL5A 2ODRC 2EPMX 2JXPA 5IT9C 2DMIA 1UN6B 3LLHA 2V86A 1EH6A 1KYQA 1XNRE 5AC5A 5LL6R 2EMIA 4BMJA 2FV4B 2EPZA 2M9AA 3ADLA 2ADRA 1YFHA 1FJGE 5IXMB 2EPPA 2YTFA 4WX9A 2LTRA 2F4VE 1ZBTA 2HHHE 2DSYA 2EN4A 4HTGA 2E1MA 2UUAE 4R8OA 1AAYA 1DGCA 2WBUA 1RC7A 2L92A 2EMYA 3THOB 2HC5A 2B9DA 3EQ1A 2DLQA 2H36X 1NCSA 2N3HA 4IJDA 5AE2A 1A1GA 3TQMA 4WSGA 2EMBA 2EOIA 4N4RB 2EM4A 2HJJA 4OOGC 2A25A 2LJUA 2GLIA 1DI2A 1N3GA 2V88A 4JV5E 1UILA 4LF7E 3DF6A 4R2PA 2YTIA 2EMLA 3JAMC 2EPCA 4WFTA 4X8WA 2N8XA 2EMZA 3IWBA 5KL2A 4B3ME 4X65E 4Q28A 4O24A 4WSPA 5IV8B 1BB8A 2EOMA 4DR7E 2F8BA 4LU9A 4X66E 1ZBQA 2LT7A 4M0VA 2L33A 3QG5C 1G2DC 4WYQB 4DV3E 2GPIA 4JI6E 1YUIA 4X62E 2EN1A 2EOYA 2RS6A 2EQ1A 4WXCA 2EL6A 1O0WA 3MHSC 2B7TA 4DV2E 2EM5A 2YT4A 4DV7E 2EPNA 2VF1A 5KL3A 3J81C 2EPKX 4R2CA 1ZAAC 4BHCA 1IMUA 4BS9A 1YPNA 4JI3E 1A1FA 2YZTA 2EJ4A 4DR5E 2YWQA 3RMPA 2EM0A 3J7AG 2EMKA 4BC9A 4LFBE 2RQLA 2VRDA 2VQEE 4DUYE 2YTJA 2YTNA 3UK3C 1A1HA 4LFAE 1X3CA 2UXCE 2ELZA 2FGGA 4LF5E 1IBLE 2LMZA 3KWRA 1XMQE 1UBDC 2DRPA 5FLXC 3BBGA 1RMDA 3DJWA 5ADZA 2UU9E 2EMCA 1WJPA 4KWYA 2EOQA 2I9IA 1L4SA 1XNQE 4NZVA 4JYAE 4R2EA 4DKKA 2EORA 2JR1A 4K0KE 2V8QB 1JK2A 3L00A 3BIDA 2EM7A 2EQ0A 1X47A 2LVHA 4JI5E 2K7IA 3HQ1A 2MC5A 4BCAA 2UXBE 2UUBE 1LLMC 2DGCA 4TUGA 2LBSB 3ADGA 2EPXA 4MLVA 4BC7A 4R2AA 4ZYHA 4AQYE 1N32E 2NUEA 3C4BA 2EZ6A 1PJSA 4F6NA 2EWLA 1XMOE 2WBTA 2LV2A 1WHNA 2ENHA 3H09A 1UHZA 2EOFA 2LUPB 1PDAA 2YTEA 1IBME 2I13A 2LCEA 5BR8E 2KONA 4NHRA 2RTXA 1GTKA 1T38A 2EOJA 1DQ3A 2YPNA 4P78A 1P47A 2EMWA 2IHR1 4DR4E 3P1XA 2YU8A 1X49A 5A2QC 1BBGA 3AV0A 5A6BD 4F54A 4M2ZA 1X6FA 5KL7A 1T4LB 2E5LE 4DR6E 3FIGA 2EOOA 3KZYA 2WZOA 4LFCE 2L3JA 1YZ9A 2UUCE 4JI0E 3IWCA 1EKZA 2JOXA 1IQSA 3J7Yp 4DV6E 2EPRA 3C6KA 1N36E 2KOUA 3IWDA 2WBSA 4DV1E 4R2QA 2G7HA 2EM6A 2EOSA 2LJHA 4F9AB 2LUQA 3HPZA 3JTZA 3K6QA 2CPNA 1X6EA 2D9HA 3HPSA 1J5EE 2JOBA 3T1YE 1WHQA 2B3TB 1TF3A 3EPJA 2EMFA 1N33E 5KL4A 1T39A 4BHBA 2EPAA 1MEYC 1TF6A 2RS7A 4L8NA 1WXRA 4GZNC 5LMUE 2EMGA 2EMHA 1AH5A 2FTXB 2LTSA 4R2DA 2LO3A 2MDRA 2EN3A 4DUZE 2MKNA 2M4IA 3MSWA 1RQ0A 4J8ZA 2BB8A 2RPCA 2N3GA 3F6HA 4X9JA 2YTDA 1PJTA 2ZM6E 2WCC3 2YSOA 2K4VA 2JPAA 2DIXA 3JU0A 1WRJA 4B3SE 1STUA 2PRTA 4OX9E 1I94E 1PJQA 4JI8E 1ZR9A 2MKDA 4ZYEA 4B3RE 1SFEA 2EMAA 4F9BB 1F2IG 5LLQA 2MC6A 2UXDE 4R2RA 4RHBB 5KL5A 2EMXA 2NUFA 5A6AA 1IQOA 5T6JA 2EE8A 4JI4E 4WPYA 3ADIA 4ZYGA 4YHHE 3OMLA 2LRSA 2JP9A 5AASA 2L8TA 2CTDA 2V87A 2DB2A 1YUJA 4DV4E 4IS1C 3T1HE 2L6MA 1T4OA 1FKAE 1TN9A 1HR0E 4JI2E 4I8OA 5A6BA 4ZYDA 2MDGA 4MLQA 5LMNE 5CFFE 2M7QA 1IBKE 1N34E 2L3CA 1T4NA 1X5WA 5DNYA 2CT1A 2YSPA 2ELYA 2V89A 1SR9A 2EM2A 2EPUA 4GKKE 2J7JA 1A1IA 4FK5C 1B69A 1MGTA 3KZZA 3HTXA 2HGHA 4P7DA 1YSAC 4F6MA 4DMIA 2RSIA 4DR2E 4O43A 4WXDA 4M9VC 2JVAA 1A1LA 2EL4A 3C4TA 3ZOQB 1PKPA 4DR1E 5IWAE 2NUGA 4R2SA 2V85A 3VYXA 2DMYA 1EH7A 2EN8A 4DV5E 2L2KB 2BBGA 4B3TE 3OTOE 1A1KA 2JY9A 3EPKA 3HXLA 1A1JA 5KL6A 2Q8UA 2L2NA 4M30A 2E72A 4LF9E 4RH8A
chains in the Genus database with same CATH topology
2LJUA 2JYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJU A;  2JYA A; 
#chains in the Genus database with same CATH topology
 2EOE A;  5A6K A;  4NXN E;  5F3W A;  1HNZ E;  1J26 A;  5TSE A;  4JI1 E;  4BBY A;  2YTP A;  2YTQ A;  2EN7 A;  5AC4 A;  4GKJ E;  2V83 A;  3VK6 A;  2EN2 A;  1GZ6 A;  2EM9 A;  2ODR D;  3ADJ A;  2YRM A;  4NXM E;  1YYO A;  4LF6 E;  2EM3 A;  2YRK A;  2EOZ A;  3MHH C;  2NAB A;  5AE3 A;  2EM8 A;  4F2J C;  1G2F C;  2YU5 A;  3BGH A;  2KHX A;  2EOH A;  2GHF A;  2JWO A;  3VHT B;  2EQ3 A;  3EPL A;  3AUZ A;  1Z1B A;  1KJK A;  4R03 A;  4L5N C;  1JK1 A;  4HEI A;  4O4K A;  4Q35 B;  5A69 A;  2JYA A;  3J80 C;  1EH8 A;  4KHP E;  3ECR A;  1HNW E;  4F9C B;  3F6G A;  1YYK A;  1X48 A;  4KZS A;  3THN A;  3M99 B;  2EOX A;  2B7V A;  4JI7 E;  4X64 E;  1X6H A;  2NA2 A;  2RSM A;  5AE1 A;  2R76 A;  4TUI A;  2M1S A;  3LML A;  1YYW A;  2ENC A;  1NEI A;  2ENA A;  2EP3 A;  1HNX E;  2YRH A;  3VYY A;  4O5G A;  2CSH A;  3C6M A;  4LF4 E;  2LE2 A;  2VE7 C;  4DV0 E;  1ZU1 A;  2EPO A;  1QNT A;  3BF2 A;  1GQE A;  4YY3 E;  2EN6 A;  2EPL X;  4DR3 E;  2DLK A;  2YTG A;  2R1F A;  5A6J A;  2VQF E;  2YTO A;  4GEQ B;  3EPH A;  2L2M A;  4LTY A;  1BBO A;  4LF8 E;  1QU6 A;  2EL5 A;  2ODR C;  2EPM X;  2JXP A;  5IT9 C;  2DMI A;  1UN6 B;  3LLH A;  2V86 A;  1EH6 A;  1KYQ A;  1XNR E;  5AC5 A;  5LL6 R;  2EMI A;  4BMJ A;  2FV4 B;  2EPZ A;  2M9A A;  3ADL A;  2ADR A;  1YFH A;  1FJG E;  5IXM B;  2EPP A;  2YTF A;  4WX9 A;  2LTR A;  2F4V E;  1ZBT A;  2HHH E;  2DSY A;  2EN4 A;  4HTG A;  2E1M A;  2UUA E;  4R8O A;  1AAY A;  1DGC A;  2WBU A;  1RC7 A;  2L92 A;  2EMY A;  3THO B;  2HC5 A;  2B9D A;  3EQ1 A;  2DLQ A;  2H36 X;  1NCS A;  2N3H A;  4IJD A;  5AE2 A;  1A1G A;  3TQM A;  4WSG A;  2EMB A;  2EOI A;  4N4R B;  2EM4 A;  2HJJ A;  4OOG C;  2A25 A;  2LJU A;  2GLI A;  1DI2 A;  1N3G A;  2V88 A;  4JV5 E;  1UIL A;  4LF7 E;  3DF6 A;  4R2P A;  2YTI A;  2EML A;  3JAM C;  2EPC A;  4WFT A;  4X8W A;  2N8X A;  2EMZ A;  3IWB A;  5KL2 A;  4B3M E;  4X65 E;  4Q28 A;  4O24 A;  4WSP A;  5IV8 B;  1BB8 A;  2EOM A;  4DR7 E;  2F8B A;  4LU9 A;  4X66 E;  1ZBQ A;  2LT7 A;  4M0V A;  2L33 A;  3QG5 C;  1G2D C;  4WYQ B;  4DV3 E;  2GPI A;  4JI6 E;  1YUI A;  4X62 E;  2EN1 A;  2EOY A;  2RS6 A;  2EQ1 A;  4WXC A;  2EL6 A;  1O0W A;  3MHS C;  2B7T A;  4DV2 E;  2EM5 A;  2YT4 A;  4DV7 E;  2EPN A;  2VF1 A;  5KL3 A;  3J81 C;  2EPK X;  4R2C A;  1ZAA C;  4BHC A;  1IMU A;  4BS9 A;  1YPN A;  4JI3 E;  1A1F A;  2YZT A;  2EJ4 A;  4DR5 E;  2YWQ A;  3RMP A;  2EM0 A;  3J7A G;  2EMK A;  4BC9 A;  4LFB E;  2RQL A;  2VRD A;  2VQE E;  4DUY E;  2YTJ A;  2YTN A;  3UK3 C;  1A1H A;  4LFA E;  1X3C A;  2UXC E;  2ELZ A;  2FGG A;  4LF5 E;  1IBL E;  2LMZ A;  3KWR A;  1XMQ E;  1UBD C;  2DRP A;  5FLX C;  3BBG A;  1RMD A;  3DJW A;  5ADZ A;  2UU9 E;  2EMC A;  1WJP A;  4KWY A;  2EOQ A;  2I9I A;  1L4S A;  1XNQ E;  4NZV A;  4JYA E;  4R2E A;  4DKK A;  2EOR A;  2JR1 A;  4K0K E;  2V8Q B;  1JK2 A;  3L00 A;  3BID A;  2EM7 A;  2EQ0 A;  1X47 A;  2LVH A;  4JI5 E;  2K7I A;  3HQ1 A;  2MC5 A;  4BCA A;  2UXB E;  2UUB E;  1LLM C;  2DGC A;  4TUG A;  2LBS B;  3ADG A;  2EPX A;  4MLV A;  4BC7 A;  4R2A A;  4ZYH A;  4AQY E;  1N32 E;  2NUE A;  3C4B A;  2EZ6 A;  1PJS A;  4F6N A;  2EWL A;  1XMO E;  2WBT A;  2LV2 A;  1WHN A;  2ENH A;  3H09 A;  1UHZ A;  2EOF A;  2LUP B;  1PDA A;  2YTE A;  1IBM E;  2I13 A;  2LCE A;  5BR8 E;  2KON A;  4NHR A;  2RTX A;  1GTK A;  1T38 A;  2EOJ A;  1DQ3 A;  2YPN A;  4P78 A;  1P47 A;  2EMW A;  2IHR 1;  4DR4 E;  3P1X A;  2YU8 A;  1X49 A;  5A2Q C;  1BBG A;  3AV0 A;  5A6B D;  4F54 A;  4M2Z A;  1X6F A;  5KL7 A;  1T4L B;  2E5L E;  4DR6 E;  3FIG A;  2EOO A;  3KZY A;  2WZO A;  4LFC E;  2L3J A;  1YZ9 A;  2UUC E;  4JI0 E;  3IWC A;  1EKZ A;  2JOX A;  1IQS A;  3J7Y p;  4DV6 E;  2EPR A;  3C6K A;  1N36 E;  2KOU A;  3IWD A;  2WBS A;  4DV1 E;  4R2Q A;  2G7H A;  2EM6 A;  2EOS A;  2LJH A;  4F9A B;  2LUQ A;  3HPZ A;  3JTZ A;  3K6Q A;  2CPN A;  1X6E A;  2D9H A;  3HPS A;  1J5E E;  2JOB A;  3T1Y E;  1WHQ A;  2B3T B;  1TF3 A;  3EPJ A;  2EMF A;  1N33 E;  5KL4 A;  1T39 A;  4BHB A;  2EPA A;  1MEY C;  1TF6 A;  2RS7 A;  4L8N A;  1WXR A;  4GZN C;  5LMU E;  2EMG A;  2EMH A;  1AH5 A;  2FTX B;  2LTS A;  4R2D A;  2LO3 A;  2MDR A;  2EN3 A;  4DUZ E;  2MKN A;  2M4I A;  3MSW A;  1RQ0 A;  4J8Z A;  2BB8 A;  2RPC A;  2N3G A;  3F6H A;  4X9J A;  2YTD A;  1PJT A;  2ZM6 E;  2WCC 3;  2YSO A;  2K4V A;  2JPA A;  2DIX A;  3JU0 A;  1WRJ A;  4B3S E;  1STU A;  2PRT A;  4OX9 E;  1I94 E;  1PJQ A;  4JI8 E;  1ZR9 A;  2MKD A;  4ZYE A;  4B3R E;  1SFE A;  2EMA A;  4F9B B;  1F2I G;  5LLQ A;  2MC6 A;  2UXD E;  4R2R A;  4RHB B;  5KL5 A;  2EMX A;  2NUF A;  5A6A A;  1IQO A;  5T6J A;  2EE8 A;  4JI4 E;  4WPY A;  3ADI A;  4ZYG A;  4YHH E;  3OML A;  2LRS A;  2JP9 A;  5AAS A;  2L8T A;  2CTD A;  2V87 A;  2DB2 A;  1YUJ A;  4DV4 E;  4IS1 C;  3T1H E;  2L6M A;  1T4O A;  1FKA E;  1TN9 A;  1HR0 E;  4JI2 E;  4I8O A;  5A6B A;  4ZYD A;  2MDG A;  4MLQ A;  5LMN E;  5CFF E;  2M7Q A;  1IBK E;  1N34 E;  2L3C A;  1T4N A;  1X5W A;  5DNY A;  2CT1 A;  2YSP A;  2ELY A;  2V89 A;  1SR9 A;  2EM2 A;  2EPU A;  4GKK E;  2J7J A;  1A1I A;  4FK5 C;  1B69 A;  1MGT A;  3KZZ A;  3HTX A;  2HGH A;  4P7D A;  1YSA C;  4F6M A;  4DMI A;  2RSI A;  4DR2 E;  4O43 A;  4WXD A;  4M9V C;  2JVA A;  1A1L A;  2EL4 A;  3C4T A;  3ZOQ B;  1PKP A;  4DR1 E;  5IWA E;  2NUG A;  4R2S A;  2V85 A;  3VYX A;  2DMY A;  1EH7 A;  2EN8 A;  4DV5 E;  2L2K B;  2BBG A;  4B3T E;  3OTO E;  1A1K A;  2JY9 A;  3EPK A;  3HXL A;  1A1J A;  5KL6 A;  2Q8U A;  2L2N A;  4M30 A;  2E72 A;  4LF9 E;  4RH8 A; 
#chains in the Genus database with same CATH homology
 2LJU A;  2JYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...