2LJUA

Solution structure of putative oxidoreductase from ehrlichia chaffeensis, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
104
Chain Sequence
MQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYADNFTKPRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Solution structure of putative oxidoreductase from Ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
molecule tags Oxidoreductase
total genus 9
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2ljuA01
2JYAA 2LJUA
chains in the Genus database with same CATH superfamily
1XNRE 2YWQA 2LBSB 2UUCE 1SR9A 2EN2A 3THOB 1WHNA 4BS9A 2EN6A 2F8BA 3IWBA 1B69A 5FLXC 4KZSA 1T4OA 4NXNE 2MC6A 2EM2A 1T39A 4ZYDA 2H36X 3AUZA 1AAYA 2EPRA 2EN8A 1QNTA 1X49A 2EPLX 1YYKA 3J81C 2PRTA 4X62E 2EOIA 4B3ME 1UHZA 1BBOA 2YTPA 4B3RE 4I8OA 1STUA 2EOFA 2LE2A 2EOZA 2K7IA 1FJGE 2EPAA 2ENHA 2YTGA 4DR6E 1T38A 3BGHA 1T4LB 2YRHA 2MDGA 2EOXA 2EMZA 3RMPA 1GQEA 2JYAA 2YPNA 2CSHA 1X48A 4R2RA 4DR2E 1YPNA 1DI2A 4BCAA 2EMBA 4DR7E 2YTOA 4R8OA 3DJWA 1O0WA 3BIDA 2YZTA 4F6NA 1YUIA 4L8NA 1MGTA 4JV5E 4X64E 4DV3E 5F3WA 3HPSA 1UN6B 2EPKX 2LJUA 1QU6A 2LCEA 4M9VC 1LLMC 2N3HA 3JTZA 4O4KA 2YTJA 2EMWA 2YT4A 2HC5A 3HQ1A 2FTXB 2CTDA 4OOGC 4B3SE 1X3CA 1A1IA 2ENCA 3KWRA 4GZNC 1FKAE 2MKDA 4JI8E 2G7HA 2DIXA 4RH8A 2KHXA 2LT7A 3ADIA 4JI4E 2YRMA 3J7Yp 2LTSA 2V89A 1N33E 2L3CA 1A1LA 4GKJE 4JI3E 2NUGA 2EP3A 2DMYA 2ODRD 2NABA 4JI6E 2EMHA 5KL4A 2E1MA 1A1HA 2EM4A 2MDRA 3VHTB 4TUIA 2L8TA 2EPNA 2L3JA 4R2QA 1ZBQA 2EMYA 1X47A 1YUJA 2V83A 2B3TB 1N32E 4DV0E 2N3GA 4P7DA 2EPUA 2EPMX 3L00A 1PDAA 1NCSA 4DR3E 4F6MA 4HTGA 3K6QA 2LMZA 3EPJA 2V87A 4M0VA 1ZR9A 2FV4B 4M2ZA 4WSGA 4X65E 5DNYA 1XMOE 3J7AG 2LUQA 1ZBTA 4GKKE 3BBGA 2DMIA 2HHHE 2EN4A 3KZZA 3DF6A 2I9IA 1IBLE 2ELYA 1IBME 5A6BA 1X6HA 2EL4A 1GZ6A 2UXCE 2LUPB 4WSPA 1YZ9A 1RMDA 2JY9A 4F9AB 2EWLA 4BMJA 4IJDA 4Q28A 1X5WA 2EPZA 2EQ1A 4YY3E 2N8XA 2MKNA 3HXLA 5AC4A 4B3TE 4O5GA 2CT1A 1EKZA 2HGHA 2RS7A 1UBDC 2L2MA 5A69A 3VYYA 4DKKA 3UK3C 2RSMA 2VE7C 2EOYA 1Z1BA 4F54A 2DB2A 2NUEA 1P47A 2EPPA 3C4BA 3JAMC 4ZYEA 2EQ0A 2RS6A 5KL7A 2EOJA 2LV2A 4WX9A 4BC9A 5IT9C 4DR5E 2YU5A 1X6EA 2EN3A 1EH6A 5AASA 1ZU1A 4LF6E 1IQSA 2EORA 2NA2A 4R2EA 2R76A 1JK1A 1N34E 4AQYE 4R2AA 1UILA 2M4IA 2EM3A 3LLHA 4DV4E 4LF4E 4WXDA 5A6AA 3HPZA 3IWDA 2EL5A 2B7VA 2YTIA 4JYAE 1XNQE 4DR4E 4NHRA 1X6FA 4F9BB 2M1SA 4LF9E 4DV7E 3VYXA 2JP9A 2ZM6E 4F2JC 1N36E 2L2KB 2LTRA 2ENAA 3MHSC 2EM9A 1G2FC 4ZYHA 4DV2E 4X9JA 1YYWA 3BF2A 2EMIA 2BB8A 2EN7A 1YYOA 1WRJA 2JXPA 2JVAA 4KHPE 2HJJA 3QG5C 3EPLA 4Q35B 2DRPA 2I13A 5A6KA 4MLQA 2DLKA 2YTQA 3F6GA 1DQ3A 2KOUA 3C6MA 4GEQB 2JPAA 1EH8A 2EZ6A 2RPCA 4JI1E 2V88A 4O43A 2EM0A 4LTYA 4R2CA 3KZYA 3EPKA 4BHCA 3VK6A 5TSEA 4LF5E 2JOBA 1T4NA 2V86A 2YTEA 2VQFE 1ZAAC 3TQMA 1PJQA 1TF3A 5LL6R 2WCC3 1YFHA 1A1KA 1IMUA 2EQ3A 4IS1C 2EM7A 1RQ0A 4LF8E 4R2PA 2WZOA 2YTFA 1BB8A 5AE3A 3M99B 4TUGA 1BBGA 2L33A 1PKPA 3OTOE 2LRSA 2KONA 4JI5E 5BR8E 2YU8A 1L4SA 1WXRA 2FGGA 1A1FA 3EQ1A 1JK2A 2JOXA 2V85A 2L92A 2JWOA 1G2DC 4JI7E 4MLVA 4LU9A 1NEIA 4DUYE 5KL3A 4WYQB 4P78A 5AE2A 2EN1A 3IWCA 4N4RB 1A1GA 2EOHA 4LFBE 4X8WA 2EOMA 5A2QC 2WBSA 2RSIA 1A1JA 2EMAA 1TF6A 4RHBB 4BC7A 2GLIA 1MEYC 3JU0A 5CFFE 3C6KA 4WFTA 3T1YE 1J26A 1I94E 2NUFA 1KYQA 2RTXA 1DGCA 2GHFA 2UXDE 3AV0A 4WXCA 2EM6A 5AC5A 2EM5A 2L2NA 1GTKA 2J7JA 2WBUA 3HTXA 2ELZA 2L6MA 1F2IG 2K4VA 2R1FA 2BBGA 4DUZE 1HNZE 2EPXA 4J8ZA 4NZVA 4NXME 1KJKA 2EOEA 2YRKA 4LFAE 3F6HA 2E72A 2M7QA 3H09A 1PJSA 4R2SA 2YSPA 4L5NC 1IBKE 2EMCA 5A6JA 1XMQE 2EMFA 2EMKA 3ADLA 3J80C 1HR0E 2UXBE 2VQEE 2ODRC 4FK5C 5LLQA 4DV1E 1PJTA 3ZOQB 4R03A 5KL2A 2YTDA 5KL6A 2DSYA 5IXMB 2RQLA 2UUAE 4DV5E 2B9DA 2EJ4A 2EE8A 4LF7E 5IV8B 4X66E 3OMLA 2DLQA 4WPYA 4JI0E 2EL6A 2YSOA 4HEIA 2EMLA 4BBYA 2EMGA 2F4VE 3ADJA 3MSWA 4JI2E 1TN9A 1AH5A 4DV6E 4DMIA 2JR1A 2A25A 1J5EE 2GPIA 1HNWE 4F9CB 2VF1A 3ADGA 2EPOA 2EOSA 4BHBA 2EMXA 2LO3A 2V8QB 4ZYGA 2CPNA 2UUBE 2UU9E 2B7TA 5LMUE 1SFEA 3THNA 5LMNE 4LFCE 5T6JA 2EOOA 5A6BD 3C4TA 4YHHE 3FIGA 5ADZA 3T1HE 5KL5A 2MC5A 2ADRA 5AE1A 4OX9E 4K0KE 2D9HA 1EH7A 1N3GA 4DR1E 2LVHA 2LJHA 3MHHC 3LMLA 1WJPA 1HNXE 1RC7A 2E5LE 2Q8UA 2IHR1 3P1XA 2M9AA 2VRDA 2EM8A 5IWAE 1YSAC 2EPCA 3EPHA 2YTNA 4M30A 2EOQA 1WHQA 2DGCA 4O24A 4R2DA 4KWYA 1IQOA 2WBTA 3ECRA
chains in the Genus database with same CATH topology
2JYAA 2LJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYA A;  2LJU A; 
#chains in the Genus database with same CATH topology
 1XNR E;  2YWQ A;  2LBS B;  2UUC E;  1SR9 A;  2EN2 A;  3THO B;  1WHN A;  4BS9 A;  2EN6 A;  2F8B A;  3IWB A;  1B69 A;  5FLX C;  4KZS A;  1T4O A;  4NXN E;  2MC6 A;  2EM2 A;  1T39 A;  4ZYD A;  2H36 X;  3AUZ A;  1AAY A;  2EPR A;  2EN8 A;  1QNT A;  1X49 A;  2EPL X;  1YYK A;  3J81 C;  2PRT A;  4X62 E;  2EOI A;  4B3M E;  1UHZ A;  1BBO A;  2YTP A;  4B3R E;  4I8O A;  1STU A;  2EOF A;  2LE2 A;  2EOZ A;  2K7I A;  1FJG E;  2EPA A;  2ENH A;  2YTG A;  4DR6 E;  1T38 A;  3BGH A;  1T4L B;  2YRH A;  2MDG A;  2EOX A;  2EMZ A;  3RMP A;  1GQE A;  2JYA A;  2YPN A;  2CSH A;  1X48 A;  4R2R A;  4DR2 E;  1YPN A;  1DI2 A;  4BCA A;  2EMB A;  4DR7 E;  2YTO A;  4R8O A;  3DJW A;  1O0W A;  3BID A;  2YZT A;  4F6N A;  1YUI A;  4L8N A;  1MGT A;  4JV5 E;  4X64 E;  4DV3 E;  5F3W A;  3HPS A;  1UN6 B;  2EPK X;  2LJU A;  1QU6 A;  2LCE A;  4M9V C;  1LLM C;  2N3H A;  3JTZ A;  4O4K A;  2YTJ A;  2EMW A;  2YT4 A;  2HC5 A;  3HQ1 A;  2FTX B;  2CTD A;  4OOG C;  4B3S E;  1X3C A;  1A1I A;  2ENC A;  3KWR A;  4GZN C;  1FKA E;  2MKD A;  4JI8 E;  2G7H A;  2DIX A;  4RH8 A;  2KHX A;  2LT7 A;  3ADI A;  4JI4 E;  2YRM A;  3J7Y p;  2LTS A;  2V89 A;  1N33 E;  2L3C A;  1A1L A;  4GKJ E;  4JI3 E;  2NUG A;  2EP3 A;  2DMY A;  2ODR D;  2NAB A;  4JI6 E;  2EMH A;  5KL4 A;  2E1M A;  1A1H A;  2EM4 A;  2MDR A;  3VHT B;  4TUI A;  2L8T A;  2EPN A;  2L3J A;  4R2Q A;  1ZBQ A;  2EMY A;  1X47 A;  1YUJ A;  2V83 A;  2B3T B;  1N32 E;  4DV0 E;  2N3G A;  4P7D A;  2EPU A;  2EPM X;  3L00 A;  1PDA A;  1NCS A;  4DR3 E;  4F6M A;  4HTG A;  3K6Q A;  2LMZ A;  3EPJ A;  2V87 A;  4M0V A;  1ZR9 A;  2FV4 B;  4M2Z A;  4WSG A;  4X65 E;  5DNY A;  1XMO E;  3J7A G;  2LUQ A;  1ZBT A;  4GKK E;  3BBG A;  2DMI A;  2HHH E;  2EN4 A;  3KZZ A;  3DF6 A;  2I9I A;  1IBL E;  2ELY A;  1IBM E;  5A6B A;  1X6H A;  2EL4 A;  1GZ6 A;  2UXC E;  2LUP B;  4WSP A;  1YZ9 A;  1RMD A;  2JY9 A;  4F9A B;  2EWL A;  4BMJ A;  4IJD A;  4Q28 A;  1X5W A;  2EPZ A;  2EQ1 A;  4YY3 E;  2N8X A;  2MKN A;  3HXL A;  5AC4 A;  4B3T E;  4O5G A;  2CT1 A;  1EKZ A;  2HGH A;  2RS7 A;  1UBD C;  2L2M A;  5A69 A;  3VYY A;  4DKK A;  3UK3 C;  2RSM A;  2VE7 C;  2EOY A;  1Z1B A;  4F54 A;  2DB2 A;  2NUE A;  1P47 A;  2EPP A;  3C4B A;  3JAM C;  4ZYE A;  2EQ0 A;  2RS6 A;  5KL7 A;  2EOJ A;  2LV2 A;  4WX9 A;  4BC9 A;  5IT9 C;  4DR5 E;  2YU5 A;  1X6E A;  2EN3 A;  1EH6 A;  5AAS A;  1ZU1 A;  4LF6 E;  1IQS A;  2EOR A;  2NA2 A;  4R2E A;  2R76 A;  1JK1 A;  1N34 E;  4AQY E;  4R2A A;  1UIL A;  2M4I A;  2EM3 A;  3LLH A;  4DV4 E;  4LF4 E;  4WXD A;  5A6A A;  3HPZ A;  3IWD A;  2EL5 A;  2B7V A;  2YTI A;  4JYA E;  1XNQ E;  4DR4 E;  4NHR A;  1X6F A;  4F9B B;  2M1S A;  4LF9 E;  4DV7 E;  3VYX A;  2JP9 A;  2ZM6 E;  4F2J C;  1N36 E;  2L2K B;  2LTR A;  2ENA A;  3MHS C;  2EM9 A;  1G2F C;  4ZYH A;  4DV2 E;  4X9J A;  1YYW A;  3BF2 A;  2EMI A;  2BB8 A;  2EN7 A;  1YYO A;  1WRJ A;  2JXP A;  2JVA A;  4KHP E;  2HJJ A;  3QG5 C;  3EPL A;  4Q35 B;  2DRP A;  2I13 A;  5A6K A;  4MLQ A;  2DLK A;  2YTQ A;  3F6G A;  1DQ3 A;  2KOU A;  3C6M A;  4GEQ B;  2JPA A;  1EH8 A;  2EZ6 A;  2RPC A;  4JI1 E;  2V88 A;  4O43 A;  2EM0 A;  4LTY A;  4R2C A;  3KZY A;  3EPK A;  4BHC A;  3VK6 A;  5TSE A;  4LF5 E;  2JOB A;  1T4N A;  2V86 A;  2YTE A;  2VQF E;  1ZAA C;  3TQM A;  1PJQ A;  1TF3 A;  5LL6 R;  2WCC 3;  1YFH A;  1A1K A;  1IMU A;  2EQ3 A;  4IS1 C;  2EM7 A;  1RQ0 A;  4LF8 E;  4R2P A;  2WZO A;  2YTF A;  1BB8 A;  5AE3 A;  3M99 B;  4TUG A;  1BBG A;  2L33 A;  1PKP A;  3OTO E;  2LRS A;  2KON A;  4JI5 E;  5BR8 E;  2YU8 A;  1L4S A;  1WXR A;  2FGG A;  1A1F A;  3EQ1 A;  1JK2 A;  2JOX A;  2V85 A;  2L92 A;  2JWO A;  1G2D C;  4JI7 E;  4MLV A;  4LU9 A;  1NEI A;  4DUY E;  5KL3 A;  4WYQ B;  4P78 A;  5AE2 A;  2EN1 A;  3IWC A;  4N4R B;  1A1G A;  2EOH A;  4LFB E;  4X8W A;  2EOM A;  5A2Q C;  2WBS A;  2RSI A;  1A1J A;  2EMA A;  1TF6 A;  4RHB B;  4BC7 A;  2GLI A;  1MEY C;  3JU0 A;  5CFF E;  3C6K A;  4WFT A;  3T1Y E;  1J26 A;  1I94 E;  2NUF A;  1KYQ A;  2RTX A;  1DGC A;  2GHF A;  2UXD E;  3AV0 A;  4WXC A;  2EM6 A;  5AC5 A;  2EM5 A;  2L2N A;  1GTK A;  2J7J A;  2WBU A;  3HTX A;  2ELZ A;  2L6M A;  1F2I G;  2K4V A;  2R1F A;  2BBG A;  4DUZ E;  1HNZ E;  2EPX A;  4J8Z A;  4NZV A;  4NXM E;  1KJK A;  2EOE A;  2YRK A;  4LFA E;  3F6H A;  2E72 A;  2M7Q A;  3H09 A;  1PJS A;  4R2S A;  2YSP A;  4L5N C;  1IBK E;  2EMC A;  5A6J A;  1XMQ E;  2EMF A;  2EMK A;  3ADL A;  3J80 C;  1HR0 E;  2UXB E;  2VQE E;  2ODR C;  4FK5 C;  5LLQ A;  4DV1 E;  1PJT A;  3ZOQ B;  4R03 A;  5KL2 A;  2YTD A;  5KL6 A;  2DSY A;  5IXM B;  2RQL A;  2UUA E;  4DV5 E;  2B9D A;  2EJ4 A;  2EE8 A;  4LF7 E;  5IV8 B;  4X66 E;  3OML A;  2DLQ A;  4WPY A;  4JI0 E;  2EL6 A;  2YSO A;  4HEI A;  2EML A;  4BBY A;  2EMG A;  2F4V E;  3ADJ A;  3MSW A;  4JI2 E;  1TN9 A;  1AH5 A;  4DV6 E;  4DMI A;  2JR1 A;  2A25 A;  1J5E E;  2GPI A;  1HNW E;  4F9C B;  2VF1 A;  3ADG A;  2EPO A;  2EOS A;  4BHB A;  2EMX A;  2LO3 A;  2V8Q B;  4ZYG A;  2CPN A;  2UUB E;  2UU9 E;  2B7T A;  5LMU E;  1SFE A;  3THN A;  5LMN E;  4LFC E;  5T6J A;  2EOO A;  5A6B D;  3C4T A;  4YHH E;  3FIG A;  5ADZ A;  3T1H E;  5KL5 A;  2MC5 A;  2ADR A;  5AE1 A;  4OX9 E;  4K0K E;  2D9H A;  1EH7 A;  1N3G A;  4DR1 E;  2LVH A;  2LJH A;  3MHH C;  3LML A;  1WJP A;  1HNX E;  1RC7 A;  2E5L E;  2Q8U A;  2IHR 1;  3P1X A;  2M9A A;  2VRD A;  2EM8 A;  5IWA E;  1YSA C;  2EPC A;  3EPH A;  2YTN A;  4M30 A;  2EOQ A;  1WHQ A;  2DGC A;  4O24 A;  4R2D A;  4KWY A;  1IQO A;  2WBT A;  3ECR A; 
#chains in the Genus database with same CATH homology
 2JYA A;  2LJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...