2LJUA

Solution structure of putative oxidoreductase from ehrlichia chaffeensis, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
104
structure length
104
Chain Sequence
MQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYADNFTKPRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
publication title Solution structure of putative oxidoreductase from Ehrlichia chaffeensis
rcsb
source organism Ehrlichia chaffeensis
total genus 9
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.190 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain atu1810 like domain 2ljuA01
2JYAA 2LJUA
chains in the Genus database with same CATH superfamily
4P78A 1UILA 1KYQA 4NXNE 1TF6A 1G2FC 2YU5A 2EM3A 4BBYA 2EPCA 2R1FA 2UXCE 5LMNE 1N34E 5FLXC 2EPNA 4JYAE 2RQLA 4DR4E 1STUA 2A25A 4JI3E 2EOQA 4LF8E 4ZYHA 1GTKA 4BMJA 2V8QB 4X66E 2EN3A 4B3RE 4GEQB 4JI4E 4R2CA 4LTYA 2WBTA 4N4RB 4R2EA 1YYWA 2LRSA 2N3HA 4JV5E 2LTSA 4DKKA 1EH8A 4DV0E 2DB2A 4GKJE 2EMIA 1ZBQA 2KHXA 2ENAA 3MHHC 2LO3A 2YU8A 2FV4B 2LE2A 4JI2E 4WYQB 2EN7A 2EQ0A 4OX9E 4HTGA 2EMCA 4DMIA 1IQSA 1GQEA 4BHBA 2YTDA 2YT4A 2E72A 4LF5E 1X6EA 2MDRA 1PJSA 4JI5E 4DV5E 2EN4A 2EN8A 1X48A 3MSWA 2V89A 2LJUA 2PRTA 5AC5A 3ECRA 2EOZA 3VYYA 2NUFA 2EPPA 3KWRA 2M1SA 1JK1A 4B3SE 3UK3C 3FIGA 1XNQE 2NABA 5KL7A 2EN2A 2EPMX 2LT7A 1IBME 3BGHA 5A6AA 3L00A 3BF2A 2V86A 5KL3A 1A1JA 4B3ME 2M7QA 2HJJA 1WJPA 2M4IA 4L5NC 2UUCE 4DR5E 1N33E 3JAMC 5IWAE 4OOGC 4M2ZA 3HPZA 3ADGA 4X62E 1T4OA 2LV2A 2YZTA 2CPNA 2MDGA 5CFFE 1A1KA 1SR9A 2EMKA 2LUQA 2B7VA 3EPJA 4X9JA 2ENHA 1A1HA 4R2DA 2LVHA 4BS9A 3P1XA 1WHQA 2VRDA 2EP3A 5LL6R 4KHPE 2YTNA 4LU9A 3HXLA 3EQ1A 3OTOE 2EM7A 4YHHE 4WXCA 1ZAAC 5KL5A 4B3TE 2MC6A 2EPUA 2JWOA 3C4TA 2H36X 2L8TA 2YSOA 4WX9A 2ADRA 2UU9E 5DNYA 3EPLA 2EMLA 1B69A 2LJHA 1YUJA 2EN1A 2BB8A 4ZYDA 3T1YE 1YFHA 1MEYC 1GZ6A 3THNA 2NUGA 5LMUE 2UUBE 2YWQA 4NXME 2HHHE 2L2MA 4MLQA 5KL2A 2DRPA 4F9AB 5A69A 2M9AA 4RHBB 4X64E 2WCC3 1NCSA 3F6GA 3C6KA 4KZSA 5IT9C 1YYOA 1MGTA 4M0VA 4DR3E 4F54A 4F6MA 1TN9A 3DF6A 4J8ZA 5AC4A 2MKNA 2ENCA 2DMIA 2K7IA 2E1MA 2EOHA 2CTDA 5KL6A 3F6HA 4BC7A 2WBSA 1IBLE 2EMAA 1PKPA 4WXDA 1EKZA 2YTOA 2I13A 2EOEA 5IXMB 2B9DA 5A6BD 3J81C 4X65E 5AE2A 5LLQA 4R8OA 5A6BA 3BBGA 2I9IA 2G7HA 2N8XA 4IJDA 3J7Yp 2L2KB 3OMLA 1T4LB 2EL6A 2RSIA 3LMLA 5AE1A 2F4VE 2LBSB 1N3GA 1WXRA 3IWBA 4R2AA 1T39A 1DI2A 2EMWA 2EMGA 2YRHA 2EOOA 4F9CB 2HC5A 1T38A 4GKKE 2WZOA 2F8BA 1O0WA 5A2QC 4IS1C 1A1GA 4DUYE 1HR0E 2EQ3A 2EMHA 1L4SA 4R2RA 1G2DC 1YPNA 2YRMA 2GPIA 1EH7A 4BCAA 1LLMC 1UBDC 2VQEE 2LUPB 5TSEA 4BHCA 5F3WA 4K0KE 4R2PA 3IWCA 3AV0A 2J7JA 1HNZE 4JI8E 2EMXA 2YPNA 4R03A 1FJGE 2JP9A 1EH6A 2IHR1 2EOFA 1RC7A 1F2IG 4DR6E 2DLKA 1RQ0A 2B7TA 2FTXB 3LLHA 4MLVA 5A6JA 4LF7E 1WRJA 1X49A 2L6MA 1A1IA 3DJWA 2VF1A 5ADZA 5BR8E 4O4KA 4JI6E 1UN6B 1BB8A 1IBKE 2EMZA 2EOJA 2JVAA 2WBUA 4LF9E 2JOXA 3J80C 4WPYA 1AAYA 2EZ6A 1BBGA 3K6QA 1HNWE 5T6JA 1YZ9A 2KOUA 1X3CA 2Q8UA 4LFCE 1DQ3A 2UUAE 2ELYA 2V85A 2MKDA 5IV8B 1Z1BA 3VHTB 1PJQA 2V83A 1XMQE 2EN6A 3BIDA 4DV7E 2EPOA 5AASA 4O43A 2YTPA 2EM4A 2VQFE 2L2NA 2JYAA 4NHRA 2DMYA 3TQMA 1DGCA 1YSAC 2EM8A 3THOB 3JTZA 4AQYE 2EM2A 1AH5A 2ZM6E 4DR1E 2HGHA 2YTEA 4FK5C 1QNTA 2LCEA 3M99B 2EM5A 2EPAA 1T4NA 2RS6A 2RSMA 2JXPA 4LFAE 2ODRD 4DV4E 2FGGA 4L8NA 2EMBA 2DLQA 4WSGA 2JY9A 4I8OA 2JOBA 4DV6E 1HNXE 4F2JC 2YRKA 4R2SA 1J5EE 2CSHA 2L3JA 1SFEA 4TUGA 1JK2A 3J7AG 2KONA 2EMFA 4DV3E 3QG5C 2B3TB 2L3CA 2K4VA 2L92A 4GZNC 2EQ1A 1IQOA 1X6HA 4DUZE 2VE7C 2GHFA 2UXDE 1IMUA 2EM0A 4KWYA 4JI0E 4Q35B 2DIXA 2LTRA 2YTIA 1KJKA 1WHNA 4M30A 3VYXA 4YY3E 4JI1E 1A1FA 5AE3A 1YUIA 1RMDA 4F9BB 2JPAA 1PJTA 2YTQA 2ODRC 2LMZA 4LF4E 4DR7E 3HPSA 5A6KA 4WFTA 2GLIA 3HTXA 2D9HA 2V88A 1N36E 2NUEA 2BBGA 2EL4A 2RS7A 5KL4A 2EL5A 3C4BA 1XNRE 2EORA 4O5GA 1TF3A 1QU6A 2EE8A 4X8WA 4WSPA 4ZYEA 1YYKA 2YSPA 3IWDA 2L33A 2EOMA 4M9VC 4TUIA 3ADIA 2JR1A 3HQ1A 2R76A 4RH8A 3ZOQB 2YTJA 1A1LA 4BC9A 2DSYA 4HEIA 2RPCA 2EWLA 3VK6A 4R2QA 1BBOA 2UXBE 3C6MA 2EOSA 2E5LE 4LFBE 2CT1A 2YTFA 3KZYA 4NZVA 2EOXA 2EM9A 2ELZA 2DGCA 4DV1E 1UHZA 4JI7E 1P47A 2EPLX 4Q28A 2N3GA 2EJ4A 3T1HE 3ADJA 1XMOE 2RTXA 2EPZA 2YTGA 3EPHA 1X5WA 3AUZA 2V87A 3RMPA 1FKAE 3JU0A 1NEIA 2EPKX 1X47A 4O24A 2EPRA 2MC5A 2EPXA 2EMYA 3KZZA 3EPKA 1PDAA 4F6NA 4LF6E 2EOIA 2EOYA 3MHSC 1ZBTA 1N32E 3ADLA 3H09A 1X6FA 1ZR9A 2EM6A 4DV2E 1I94E 1J26A 1ZU1A 4P7DA 4ZYGA 2NA2A 4DR2E
chains in the Genus database with same CATH topology
2JYAA 2LJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYA A;  2LJU A; 
#chains in the Genus database with same CATH topology
 4P78 A;  1UIL A;  1KYQ A;  4NXN E;  1TF6 A;  1G2F C;  2YU5 A;  2EM3 A;  4BBY A;  2EPC A;  2R1F A;  2UXC E;  5LMN E;  1N34 E;  5FLX C;  2EPN A;  4JYA E;  2RQL A;  4DR4 E;  1STU A;  2A25 A;  4JI3 E;  2EOQ A;  4LF8 E;  4ZYH A;  1GTK A;  4BMJ A;  2V8Q B;  4X66 E;  2EN3 A;  4B3R E;  4GEQ B;  4JI4 E;  4R2C A;  4LTY A;  2WBT A;  4N4R B;  4R2E A;  1YYW A;  2LRS A;  2N3H A;  4JV5 E;  2LTS A;  4DKK A;  1EH8 A;  4DV0 E;  2DB2 A;  4GKJ E;  2EMI A;  1ZBQ A;  2KHX A;  2ENA A;  3MHH C;  2LO3 A;  2YU8 A;  2FV4 B;  2LE2 A;  4JI2 E;  4WYQ B;  2EN7 A;  2EQ0 A;  4OX9 E;  4HTG A;  2EMC A;  4DMI A;  1IQS A;  1GQE A;  4BHB A;  2YTD A;  2YT4 A;  2E72 A;  4LF5 E;  1X6E A;  2MDR A;  1PJS A;  4JI5 E;  4DV5 E;  2EN4 A;  2EN8 A;  1X48 A;  3MSW A;  2V89 A;  2LJU A;  2PRT A;  5AC5 A;  3ECR A;  2EOZ A;  3VYY A;  2NUF A;  2EPP A;  3KWR A;  2M1S A;  1JK1 A;  4B3S E;  3UK3 C;  3FIG A;  1XNQ E;  2NAB A;  5KL7 A;  2EN2 A;  2EPM X;  2LT7 A;  1IBM E;  3BGH A;  5A6A A;  3L00 A;  3BF2 A;  2V86 A;  5KL3 A;  1A1J A;  4B3M E;  2M7Q A;  2HJJ A;  1WJP A;  2M4I A;  4L5N C;  2UUC E;  4DR5 E;  1N33 E;  3JAM C;  5IWA E;  4OOG C;  4M2Z A;  3HPZ A;  3ADG A;  4X62 E;  1T4O A;  2LV2 A;  2YZT A;  2CPN A;  2MDG A;  5CFF E;  1A1K A;  1SR9 A;  2EMK A;  2LUQ A;  2B7V A;  3EPJ A;  4X9J A;  2ENH A;  1A1H A;  4R2D A;  2LVH A;  4BS9 A;  3P1X A;  1WHQ A;  2VRD A;  2EP3 A;  5LL6 R;  4KHP E;  2YTN A;  4LU9 A;  3HXL A;  3EQ1 A;  3OTO E;  2EM7 A;  4YHH E;  4WXC A;  1ZAA C;  5KL5 A;  4B3T E;  2MC6 A;  2EPU A;  2JWO A;  3C4T A;  2H36 X;  2L8T A;  2YSO A;  4WX9 A;  2ADR A;  2UU9 E;  5DNY A;  3EPL A;  2EML A;  1B69 A;  2LJH A;  1YUJ A;  2EN1 A;  2BB8 A;  4ZYD A;  3T1Y E;  1YFH A;  1MEY C;  1GZ6 A;  3THN A;  2NUG A;  5LMU E;  2UUB E;  2YWQ A;  4NXM E;  2HHH E;  2L2M A;  4MLQ A;  5KL2 A;  2DRP A;  4F9A B;  5A69 A;  2M9A A;  4RHB B;  4X64 E;  2WCC 3;  1NCS A;  3F6G A;  3C6K A;  4KZS A;  5IT9 C;  1YYO A;  1MGT A;  4M0V A;  4DR3 E;  4F54 A;  4F6M A;  1TN9 A;  3DF6 A;  4J8Z A;  5AC4 A;  2MKN A;  2ENC A;  2DMI A;  2K7I A;  2E1M A;  2EOH A;  2CTD A;  5KL6 A;  3F6H A;  4BC7 A;  2WBS A;  1IBL E;  2EMA A;  1PKP A;  4WXD A;  1EKZ A;  2YTO A;  2I13 A;  2EOE A;  5IXM B;  2B9D A;  5A6B D;  3J81 C;  4X65 E;  5AE2 A;  5LLQ A;  4R8O A;  5A6B A;  3BBG A;  2I9I A;  2G7H A;  2N8X A;  4IJD A;  3J7Y p;  2L2K B;  3OML A;  1T4L B;  2EL6 A;  2RSI A;  3LML A;  5AE1 A;  2F4V E;  2LBS B;  1N3G A;  1WXR A;  3IWB A;  4R2A A;  1T39 A;  1DI2 A;  2EMW A;  2EMG A;  2YRH A;  2EOO A;  4F9C B;  2HC5 A;  1T38 A;  4GKK E;  2WZO A;  2F8B A;  1O0W A;  5A2Q C;  4IS1 C;  1A1G A;  4DUY E;  1HR0 E;  2EQ3 A;  2EMH A;  1L4S A;  4R2R A;  1G2D C;  1YPN A;  2YRM A;  2GPI A;  1EH7 A;  4BCA A;  1LLM C;  1UBD C;  2VQE E;  2LUP B;  5TSE A;  4BHC A;  5F3W A;  4K0K E;  4R2P A;  3IWC A;  3AV0 A;  2J7J A;  1HNZ E;  4JI8 E;  2EMX A;  2YPN A;  4R03 A;  1FJG E;  2JP9 A;  1EH6 A;  2IHR 1;  2EOF A;  1RC7 A;  1F2I G;  4DR6 E;  2DLK A;  1RQ0 A;  2B7T A;  2FTX B;  3LLH A;  4MLV A;  5A6J A;  4LF7 E;  1WRJ A;  1X49 A;  2L6M A;  1A1I A;  3DJW A;  2VF1 A;  5ADZ A;  5BR8 E;  4O4K A;  4JI6 E;  1UN6 B;  1BB8 A;  1IBK E;  2EMZ A;  2EOJ A;  2JVA A;  2WBU A;  4LF9 E;  2JOX A;  3J80 C;  4WPY A;  1AAY A;  2EZ6 A;  1BBG A;  3K6Q A;  1HNW E;  5T6J A;  1YZ9 A;  2KOU A;  1X3C A;  2Q8U A;  4LFC E;  1DQ3 A;  2UUA E;  2ELY A;  2V85 A;  2MKD A;  5IV8 B;  1Z1B A;  3VHT B;  1PJQ A;  2V83 A;  1XMQ E;  2EN6 A;  3BID A;  4DV7 E;  2EPO A;  5AAS A;  4O43 A;  2YTP A;  2EM4 A;  2VQF E;  2L2N A;  2JYA A;  4NHR A;  2DMY A;  3TQM A;  1DGC A;  1YSA C;  2EM8 A;  3THO B;  3JTZ A;  4AQY E;  2EM2 A;  1AH5 A;  2ZM6 E;  4DR1 E;  2HGH A;  2YTE A;  4FK5 C;  1QNT A;  2LCE A;  3M99 B;  2EM5 A;  2EPA A;  1T4N A;  2RS6 A;  2RSM A;  2JXP A;  4LFA E;  2ODR D;  4DV4 E;  2FGG A;  4L8N A;  2EMB A;  2DLQ A;  4WSG A;  2JY9 A;  4I8O A;  2JOB A;  4DV6 E;  1HNX E;  4F2J C;  2YRK A;  4R2S A;  1J5E E;  2CSH A;  2L3J A;  1SFE A;  4TUG A;  1JK2 A;  3J7A G;  2KON A;  2EMF A;  4DV3 E;  3QG5 C;  2B3T B;  2L3C A;  2K4V A;  2L92 A;  4GZN C;  2EQ1 A;  1IQO A;  1X6H A;  4DUZ E;  2VE7 C;  2GHF A;  2UXD E;  1IMU A;  2EM0 A;  4KWY A;  4JI0 E;  4Q35 B;  2DIX A;  2LTR A;  2YTI A;  1KJK A;  1WHN A;  4M30 A;  3VYX A;  4YY3 E;  4JI1 E;  1A1F A;  5AE3 A;  1YUI A;  1RMD A;  4F9B B;  2JPA A;  1PJT A;  2YTQ A;  2ODR C;  2LMZ A;  4LF4 E;  4DR7 E;  3HPS A;  5A6K A;  4WFT A;  2GLI A;  3HTX A;  2D9H A;  2V88 A;  1N36 E;  2NUE A;  2BBG A;  2EL4 A;  2RS7 A;  5KL4 A;  2EL5 A;  3C4B A;  1XNR E;  2EOR A;  4O5G A;  1TF3 A;  1QU6 A;  2EE8 A;  4X8W A;  4WSP A;  4ZYE A;  1YYK A;  2YSP A;  3IWD A;  2L33 A;  2EOM A;  4M9V C;  4TUI A;  3ADI A;  2JR1 A;  3HQ1 A;  2R76 A;  4RH8 A;  3ZOQ B;  2YTJ A;  1A1L A;  4BC9 A;  2DSY A;  4HEI A;  2RPC A;  2EWL A;  3VK6 A;  4R2Q A;  1BBO A;  2UXB E;  3C6M A;  2EOS A;  2E5L E;  4LFB E;  2CT1 A;  2YTF A;  3KZY A;  4NZV A;  2EOX A;  2EM9 A;  2ELZ A;  2DGC A;  4DV1 E;  1UHZ A;  4JI7 E;  1P47 A;  2EPL X;  4Q28 A;  2N3G A;  2EJ4 A;  3T1H E;  3ADJ A;  1XMO E;  2RTX A;  2EPZ A;  2YTG A;  3EPH A;  1X5W A;  3AUZ A;  2V87 A;  3RMP A;  1FKA E;  3JU0 A;  1NEI A;  2EPK X;  1X47 A;  4O24 A;  2EPR A;  2MC5 A;  2EPX A;  2EMY A;  3KZZ A;  3EPK A;  1PDA A;  4F6N A;  4LF6 E;  2EOI A;  2EOY A;  3MHS C;  1ZBT A;  1N32 E;  3ADL A;  3H09 A;  1X6F A;  1ZR9 A;  2EM6 A;  4DV2 E;  1I94 E;  1J26 A;  1ZU1 A;  4P7D A;  4ZYG A;  2NA2 A;  4DR2 E; 
#chains in the Genus database with same CATH homology
 2JYA A;  2LJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...