5IV8B

The lps transporter lptde from klebsiella pneumoniae, core complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
146
Chain Sequence
GWHLRVPTTMKTMILQSSDPNGPLSRAVRNQLRLNGVDLIDASTLRKDVPSLRLDGSSIQKDTASVFQDGRTAEYQMVMTVHASVLIPGHDIYPITTKVYRSFFDNPQAALAKDAEQDMIIQEMYDKAAEQLIRKLPSVQVADVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords LPS biosynthesis protein
publication title Structural and Functional Characterization of the LPS Transporter LptDE from Gram-Negative Pathogens.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 37
structure length 146
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5iv8B00
4N4RB 2R76A 2N8XA 4NHRA 4KWYA 5TSEA 5IV8B 3BF2A 4Q35B 4RHBB 5IXMB 4RH8A 2JXPA
chains in the Genus database with same CATH superfamily
2EMAA 4P78A 2EM9A 2L33A 5KL6A 1HNZE 4B3SE 1T4OA 5IXMB 4F9AB 2UUCE 1J5EE 4X9JA 4WXDA 5ADZA 3T1HE 2EQ3A 2ENHA 2EOMA 4R2CA 2EZ6A 4R2EA 1IBKE 5IWAE 2HGHA 4X8WA 4LFBE 2LO3A 1IMUA 2WBSA 2RSIA 2VRDA 2RQLA 1FJGE 2DIXA 4O4KA 2V8QB 4L8NA 5A2QC 2EOZA 3C4BA 2MDGA 1A1KA 2KOUA 3KZYA 1B69A 2EPCA 3THOB 4BHBA 1N34E 1N3GA 1IQOA 1X47A 2NABA 3ADGA 2EQ0A 3MHHC 2RS6A 4DV7E 2A25A 2VQEE 2JR1A 2F4VE 3BGHA 2L3JA 2EN2A 2I13A 2JYAA 2LVHA 2PRTA 2LTRA 2N3GA 4X65E 1T39A 2YT4A 5A6JA 1YPNA 4R03A 1YFHA 2MC6A 1N36E 4J8ZA 5KL3A 2L2KB 3ADIA 2EM6A 4X66E 1YYWA 2JP9A 2EMKA 3C6KA 3RMPA 2EN1A 2EJ4A 1YSAC 1WJPA 4OX9E 2LRSA 4BC7A 2CT1A 2KONA 3VHTB 5A6BA 2GPIA 3IWBA 4DMIA 3EPJA 1T4LB 1A1IA 3AUZA 5T6JA 4NXNE 3C6MA 4LF9E 4JV5E 4IS1C 2YZTA 1PKPA 3ECRA 4ZYGA 2UU9E 2EMLA 5IV8B 3H09A 1RQ0A 1RMDA 4DV5E 2G7HA 4F9CB 4P7DA 4JI2E 4LF8E 1A1HA 3ADJA 2EE8A 4F54A 1EH8A 3JAMC 1HR0E 2UUAE 1YUJA 3VYXA 4JYAE 1WXRA 3HXLA 4ZYEA 3P1XA 2EM2A 4GKKE 4RH8A 4X64E 4B3ME 4K0KE 2YTFA 4LTYA 3LMLA 4BS9A 2JOBA 2BB8A 2M9AA 2V87A 5LLQA 1XNQE 2HJJA 4MLVA 2IHR1 4R2AA 2EMBA 2LJHA 2ADRA 2EOYA 1RC7A 4HTGA 4Q28A 3JTZA 4F6NA 2DLQA 2E1MA 2YTGA 1KJKA 1MGTA 2ODRD 3OMLA 1ZBTA 4LU9A 2ELZA 4KWYA 2RTXA 4DUYE 3ZOQB 2WBTA 5AC4A 2EMIA 2N8XA 5KL4A 5LL6R 4NHRA 4TUGA 2LUPB 2HC5A 2I9IA 2YSPA 1O0WA 2EOOA 3VYYA 2LTSA 4DR1E 5A6AA 1WRJA 3EQ1A 1TF6A 4BC9A 1IBLE 1MEYC 1PJSA 4OOGC 4DV4E 1X48A 2EMGA 5BR8E 1YYOA 2GHFA 4R2RA 1P47A 2EL6A 2EOHA 2JY9A 1GZ6A 2EM7A 1QU6A 4NZVA 1N33E 3UK3C 1T4NA 2EN7A 1I94E 1UILA 2EORA 1EH7A 3DJWA 2Q8UA 1UBDC 4DKKA 2EQ1A 2EPOA 4R2PA 1BBGA 2EN3A 4JI1E 2MDRA 2B3TB 2EOEA 4O5GA 1NEIA 4LF4E 2DMYA 4JI6E 4L5NC 2YU8A 3K6QA 3EPLA 5LMNE 2LUQA 4GZNC 2YPNA 2EMWA 4M9VC 2E72A 4JI8E 2EMHA 2KHXA 1N32E 2YTPA 1SR9A 2JWOA 4RHBB 2L8TA 2WCC3 5AE3A 1XMQE 2WZOA 2UXCE 5A6BD 1A1JA 2FTXB 1LLMC 3BBGA 5AC5A 4F2JC 2LJUA 4WPYA 4DV6E 2EPKX 2JVAA 2EPPA 2UXDE 2D9HA 4KZSA 3F6GA 4JI4E 2V89A 4R2SA 2RSMA 1ZR9A 1ZBQA 2V83A 4MLQA 5AE1A 2YTEA 4O24A 1PDAA 4M30A 4LFAE 2UXBE 2J7JA 3DF6A 2E5LE 1X6HA 2H36X 1IQSA 2NUGA 1QNTA 3VK6A 4LF6E 4WYQB 2FGGA 1J26A 4JI0E 2EM4A 2ODRC 1DI2A 3JU0A 4Q35B 2EPLX 1PJQA 1FKAE 3J80C 4JI5E 2YSOA 5F3WA 2RPCA 2EM8A 3OTOE 2EP3A 2BBGA 2NA2A 2CTDA 5A69A 2LV2A 2CSHA 2DRPA 2GLIA 3EPHA 1BB8A 2EPMX 3AV0A 4WSPA 4BHCA 2EN6A 3IWDA 2L6MA 4GEQB 3J7AG 1BBOA 4LFCE 4N4RB 2YRMA 3THNA 4ZYHA 3F6HA 1A1LA 4DR3E 4DR5E 2EWLA 2EMXA 1HNWE 1DQ3A 5TSEA 1X49A 2JOXA 4O43A 2JXPA 2EPRA 2EMZA 3HPSA 4TUIA 1STUA 2EPXA 4JI7E 2EOSA 2DSYA 2N3HA 4WFTA 2LT7A 2EM3A 4DR4E 1X6FA 4DUZE 4BCAA 1TF3A 3J81C 2EL5A 4YHHE 1XNRE 2R1FA 4DR2E 2DB2A 1GTKA 2LCEA 2EPUA 2ENAA 2DGCA 1ZU1A 2UUBE 4I8OA 1F2IG 1UHZA 4FK5C 1X5WA 2EPAA 2YTJA 4WX9A 2EOQA 5AE2A 1HNXE 1YYKA 4DR7E 2EMYA 4YY3E 1AAYA 2YTQA 2K7IA 5KL7A 3J7Yp 1XMOE 1A1FA 1G2FC 2L2MA 1DGCA 4HEIA 3T1YE 4BMJA 1TN9A 2LE2A 4B3TE 1IBME 2V88A 1GQEA 4NXME 2EPNA 3KZZA 3M99B 3HPZA 1YUIA 1WHNA 5KL5A 1EH6A 1JK1A 2EM0A 2YRHA 5IT9C 4DV2E 2B9DA 3MSWA 4ZYDA 4DV3E 3EPKA 4F9BB 2MKDA 3BF2A 1KYQA 3TQMA 2EOXA 2VQFE 4WXCA 1SFEA 3ADLA 2EOJA 3KWRA 2EMCA 5LMUE 2EN8A 1EKZA 1ZAAC 1L4SA 2HHHE 2EN4A 3C4TA 2FV4B 2RS7A 3LLHA 4JI3E 4F6MA 4AQYE 2YTOA 2EM5A 4GKJE 5FLXC 2M7QA 5A6KA 2V85A 4M2ZA 4R8OA 1Z1BA 1WHQA 3HQ1A 1UN6B 2B7TA 2F8BA 4X62E 1PJTA 1AH5A 2ENCA 3L00A 4R2DA 2L2NA 2EOFA 1G2DC 2B7VA 2MC5A 4DV0E 2MKNA 5DNYA 4WSGA 2VF1A 4LF7E 4DR6E 4BBYA 1NCSA 3IWCA 1YZ9A 1A1GA 2VE7C 4B3RE 3HTXA 4KHPE 2EOIA 2CPNA 5CFFE 1X6EA 2DLKA 2ELYA 2YTDA 2V86A 2EMFA 2M4IA 2K4VA 3FIGA 3MHSC 2NUEA 2R76A 4M0VA 2M1SA 3QG5C 1X3CA 2ZM6E 2EL4A 2LMZA 1JK2A 2WBUA 2DMIA 5AASA 4LF5E 2L3CA 2JPAA 4IJDA 1T38A 4DV1E 2YTIA 3BIDA 2YRKA 5KL2A 4R2QA 2L92A 2NUFA 2LBSB 2YTNA 2YWQA 2YU5A 2EPZA
chains in the Genus database with same CATH topology
4N4RB 2R76A 2N8XA 4NHRA 4KWYA 5TSEA 5IV8B 3BF2A 4Q35B 4RHBB 5IXMB 4RH8A 2JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4R B;  2R76 A;  2N8X A;  4NHR A;  4KWY A;  5TSE A;  5IV8 B;  3BF2 A;  4Q35 B;  4RHB B;  5IXM B;  4RH8 A;  2JXP A; 
#chains in the Genus database with same CATH topology
 2EMA A;  4P78 A;  2EM9 A;  2L33 A;  5KL6 A;  1HNZ E;  4B3S E;  1T4O A;  5IXM B;  4F9A B;  2UUC E;  1J5E E;  4X9J A;  4WXD A;  5ADZ A;  3T1H E;  2EQ3 A;  2ENH A;  2EOM A;  4R2C A;  2EZ6 A;  4R2E A;  1IBK E;  5IWA E;  2HGH A;  4X8W A;  4LFB E;  2LO3 A;  1IMU A;  2WBS A;  2RSI A;  2VRD A;  2RQL A;  1FJG E;  2DIX A;  4O4K A;  2V8Q B;  4L8N A;  5A2Q C;  2EOZ A;  3C4B A;  2MDG A;  1A1K A;  2KOU A;  3KZY A;  1B69 A;  2EPC A;  3THO B;  4BHB A;  1N34 E;  1N3G A;  1IQO A;  1X47 A;  2NAB A;  3ADG A;  2EQ0 A;  3MHH C;  2RS6 A;  4DV7 E;  2A25 A;  2VQE E;  2JR1 A;  2F4V E;  3BGH A;  2L3J A;  2EN2 A;  2I13 A;  2JYA A;  2LVH A;  2PRT A;  2LTR A;  2N3G A;  4X65 E;  1T39 A;  2YT4 A;  5A6J A;  1YPN A;  4R03 A;  1YFH A;  2MC6 A;  1N36 E;  4J8Z A;  5KL3 A;  2L2K B;  3ADI A;  2EM6 A;  4X66 E;  1YYW A;  2JP9 A;  2EMK A;  3C6K A;  3RMP A;  2EN1 A;  2EJ4 A;  1YSA C;  1WJP A;  4OX9 E;  2LRS A;  4BC7 A;  2CT1 A;  2KON A;  3VHT B;  5A6B A;  2GPI A;  3IWB A;  4DMI A;  3EPJ A;  1T4L B;  1A1I A;  3AUZ A;  5T6J A;  4NXN E;  3C6M A;  4LF9 E;  4JV5 E;  4IS1 C;  2YZT A;  1PKP A;  3ECR A;  4ZYG A;  2UU9 E;  2EML A;  5IV8 B;  3H09 A;  1RQ0 A;  1RMD A;  4DV5 E;  2G7H A;  4F9C B;  4P7D A;  4JI2 E;  4LF8 E;  1A1H A;  3ADJ A;  2EE8 A;  4F54 A;  1EH8 A;  3JAM C;  1HR0 E;  2UUA E;  1YUJ A;  3VYX A;  4JYA E;  1WXR A;  3HXL A;  4ZYE A;  3P1X A;  2EM2 A;  4GKK E;  4RH8 A;  4X64 E;  4B3M E;  4K0K E;  2YTF A;  4LTY A;  3LML A;  4BS9 A;  2JOB A;  2BB8 A;  2M9A A;  2V87 A;  5LLQ A;  1XNQ E;  2HJJ A;  4MLV A;  2IHR 1;  4R2A A;  2EMB A;  2LJH A;  2ADR A;  2EOY A;  1RC7 A;  4HTG A;  4Q28 A;  3JTZ A;  4F6N A;  2DLQ A;  2E1M A;  2YTG A;  1KJK A;  1MGT A;  2ODR D;  3OML A;  1ZBT A;  4LU9 A;  2ELZ A;  4KWY A;  2RTX A;  4DUY E;  3ZOQ B;  2WBT A;  5AC4 A;  2EMI A;  2N8X A;  5KL4 A;  5LL6 R;  4NHR A;  4TUG A;  2LUP B;  2HC5 A;  2I9I A;  2YSP A;  1O0W A;  2EOO A;  3VYY A;  2LTS A;  4DR1 E;  5A6A A;  1WRJ A;  3EQ1 A;  1TF6 A;  4BC9 A;  1IBL E;  1MEY C;  1PJS A;  4OOG C;  4DV4 E;  1X48 A;  2EMG A;  5BR8 E;  1YYO A;  2GHF A;  4R2R A;  1P47 A;  2EL6 A;  2EOH A;  2JY9 A;  1GZ6 A;  2EM7 A;  1QU6 A;  4NZV A;  1N33 E;  3UK3 C;  1T4N A;  2EN7 A;  1I94 E;  1UIL A;  2EOR A;  1EH7 A;  3DJW A;  2Q8U A;  1UBD C;  4DKK A;  2EQ1 A;  2EPO A;  4R2P A;  1BBG A;  2EN3 A;  4JI1 E;  2MDR A;  2B3T B;  2EOE A;  4O5G A;  1NEI A;  4LF4 E;  2DMY A;  4JI6 E;  4L5N C;  2YU8 A;  3K6Q A;  3EPL A;  5LMN E;  2LUQ A;  4GZN C;  2YPN A;  2EMW A;  4M9V C;  2E72 A;  4JI8 E;  2EMH A;  2KHX A;  1N32 E;  2YTP A;  1SR9 A;  2JWO A;  4RHB B;  2L8T A;  2WCC 3;  5AE3 A;  1XMQ E;  2WZO A;  2UXC E;  5A6B D;  1A1J A;  2FTX B;  1LLM C;  3BBG A;  5AC5 A;  4F2J C;  2LJU A;  4WPY A;  4DV6 E;  2EPK X;  2JVA A;  2EPP A;  2UXD E;  2D9H A;  4KZS A;  3F6G A;  4JI4 E;  2V89 A;  4R2S A;  2RSM A;  1ZR9 A;  1ZBQ A;  2V83 A;  4MLQ A;  5AE1 A;  2YTE A;  4O24 A;  1PDA A;  4M30 A;  4LFA E;  2UXB E;  2J7J A;  3DF6 A;  2E5L E;  1X6H A;  2H36 X;  1IQS A;  2NUG A;  1QNT A;  3VK6 A;  4LF6 E;  4WYQ B;  2FGG A;  1J26 A;  4JI0 E;  2EM4 A;  2ODR C;  1DI2 A;  3JU0 A;  4Q35 B;  2EPL X;  1PJQ A;  1FKA E;  3J80 C;  4JI5 E;  2YSO A;  5F3W A;  2RPC A;  2EM8 A;  3OTO E;  2EP3 A;  2BBG A;  2NA2 A;  2CTD A;  5A69 A;  2LV2 A;  2CSH A;  2DRP A;  2GLI A;  3EPH A;  1BB8 A;  2EPM X;  3AV0 A;  4WSP A;  4BHC A;  2EN6 A;  3IWD A;  2L6M A;  4GEQ B;  3J7A G;  1BBO A;  4LFC E;  4N4R B;  2YRM A;  3THN A;  4ZYH A;  3F6H A;  1A1L A;  4DR3 E;  4DR5 E;  2EWL A;  2EMX A;  1HNW E;  1DQ3 A;  5TSE A;  1X49 A;  2JOX A;  4O43 A;  2JXP A;  2EPR A;  2EMZ A;  3HPS A;  4TUI A;  1STU A;  2EPX A;  4JI7 E;  2EOS A;  2DSY A;  2N3H A;  4WFT A;  2LT7 A;  2EM3 A;  4DR4 E;  1X6F A;  4DUZ E;  4BCA A;  1TF3 A;  3J81 C;  2EL5 A;  4YHH E;  1XNR E;  2R1F A;  4DR2 E;  2DB2 A;  1GTK A;  2LCE A;  2EPU A;  2ENA A;  2DGC A;  1ZU1 A;  2UUB E;  4I8O A;  1F2I G;  1UHZ A;  4FK5 C;  1X5W A;  2EPA A;  2YTJ A;  4WX9 A;  2EOQ A;  5AE2 A;  1HNX E;  1YYK A;  4DR7 E;  2EMY A;  4YY3 E;  1AAY A;  2YTQ A;  2K7I A;  5KL7 A;  3J7Y p;  1XMO E;  1A1F A;  1G2F C;  2L2M A;  1DGC A;  4HEI A;  3T1Y E;  4BMJ A;  1TN9 A;  2LE2 A;  4B3T E;  1IBM E;  2V88 A;  1GQE A;  4NXM E;  2EPN A;  3KZZ A;  3M99 B;  3HPZ A;  1YUI A;  1WHN A;  5KL5 A;  1EH6 A;  1JK1 A;  2EM0 A;  2YRH A;  5IT9 C;  4DV2 E;  2B9D A;  3MSW A;  4ZYD A;  4DV3 E;  3EPK A;  4F9B B;  2MKD A;  3BF2 A;  1KYQ A;  3TQM A;  2EOX A;  2VQF E;  4WXC A;  1SFE A;  3ADL A;  2EOJ A;  3KWR A;  2EMC A;  5LMU E;  2EN8 A;  1EKZ A;  1ZAA C;  1L4S A;  2HHH E;  2EN4 A;  3C4T A;  2FV4 B;  2RS7 A;  3LLH A;  4JI3 E;  4F6M A;  4AQY E;  2YTO A;  2EM5 A;  4GKJ E;  5FLX C;  2M7Q A;  5A6K A;  2V85 A;  4M2Z A;  4R8O A;  1Z1B A;  1WHQ A;  3HQ1 A;  1UN6 B;  2B7T A;  2F8B A;  4X62 E;  1PJT A;  1AH5 A;  2ENC A;  3L00 A;  4R2D A;  2L2N A;  2EOF A;  1G2D C;  2B7V A;  2MC5 A;  4DV0 E;  2MKN A;  5DNY A;  4WSG A;  2VF1 A;  4LF7 E;  4DR6 E;  4BBY A;  1NCS A;  3IWC A;  1YZ9 A;  1A1G A;  2VE7 C;  4B3R E;  3HTX A;  4KHP E;  2EOI A;  2CPN A;  5CFF E;  1X6E A;  2DLK A;  2ELY A;  2YTD A;  2V86 A;  2EMF A;  2M4I A;  2K4V A;  3FIG A;  3MHS C;  2NUE A;  2R76 A;  4M0V A;  2M1S A;  3QG5 C;  1X3C A;  2ZM6 E;  2EL4 A;  2LMZ A;  1JK2 A;  2WBU A;  2DMI A;  5AAS A;  4LF5 E;  2L3C A;  2JPA A;  4IJD A;  1T38 A;  4DV1 E;  2YTI A;  3BID A;  2YRK A;  5KL2 A;  4R2Q A;  2L92 A;  2NUF A;  2LBS B;  2YTN A;  2YWQ A;  2YU5 A;  2EPZ A; 
#chains in the Genus database with same CATH homology
 4N4R B;  2R76 A;  2N8X A;  4NHR A;  4KWY A;  5TSE A;  5IV8 B;  3BF2 A;  4Q35 B;  4RHB B;  5IXM B;  4RH8 A;  2JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...