5IV8B

The lps transporter lptde from klebsiella pneumoniae, core complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
146
Chain Sequence
b'GWHLRVPTTMKTMILQSSDPNGPLSRAVRNQLRLNGVDLIDASTLRKDVPSLRLDGSSIQKDTASVFQDGRTAEYQMVMTVHASVLIPGHDIYPITTKVYRSFFDNPQAALAKDAEQDMIIQEMYDKAAEQLIRKLPSVQVADVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS biosynthesis protein
publication title Structural and Functional Characterization of the LPS Transporter LptDE from Gram-Negative Pathogens.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
total genus 37
structure length 146
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5iv8B00
4RHBB 5IXMB 4N4RB 4NHRA 5TSEA 4KWYA 4Q35B 3BF2A 2N8XA 4RH8A 2R76A 5IV8B 2JXPA
chains in the Genus database with same CATH superfamily
2YZTA 4JI6E 5LL6R 1A1HA 5A6BA 2MKNA 2JWOA 2EOOA 1XMQE 2MDGA 2ODRC 3VYYA 1FJGE 3T1HE 4B3TE 4ZYGA 1P47A 2EM7A 2EOQA 2YTDA 3ECRA 3JU0A 2V88A 4R2CA 1X5WA 2DB2A 2ENCA 2JR1A 2EOEA 5A69A 2HHHE 5IWAE 3L00A 1T4OA 2B7VA 2EN7A 4ZYEA 3K6QA 2EMLA 1HNXE 4I8OA 1FKAE 5AC5A 4F2JC 3VHTB 4MLQA 1BB8A 1QU6A 1A1KA 2EN8A 3BIDA 5KL4A 1ZBTA 2EPZA 1X47A 2CPNA 4LF6E 1A1IA 4B3ME 2F4VE 3UK3C 1BBOA 1YYKA 3KWRA 2MKDA 1EKZA 5T6JA 2EMWA 1BBGA 2EM8A 2LTRA 3C6KA 2EMHA 3IWDA 1PJSA 3KZYA 1EH8A 4JI7E 4JI5E 2LO3A 2EOHA 1KJKA 3HPZA 3C4BA 4NHRA 1XNRE 1QNTA 4MLVA 4JI8E 5A6JA 2YPNA 4DV4E 2V8QB 2CTDA 2GLIA 4R03A 1G2DC 5DNYA 1HNZE 1XMOE 4P7DA 2R76A 3EPHA 2EMKA 2EMGA 4KWYA 2A25A 4JI4E 4R2PA 2M9AA 2LTSA 2M4IA 2L2KB 2EM3A 2EM2A 1WXRA 4LF7E 3EPKA 2UXDE 1T4LB 3AV0A 4OX9E 2GHFA 2FTXB 2DLQA 1PJTA 4X66E 2EM5A 4BMJA 1HR0E 2RPCA 3OTOE 2EMAA 4R2EA 2GPIA 4WYQB 4NZVA 4DR3E 1I94E 1AH5A 4TUGA 2K7IA 4BC9A 2EL5A 4JI3E 1TN9A 4BHCA 5A6BD 2N3HA 4LTYA 3ADGA 3J7AG 5A6KA 1JK2A 2BB8A 3DJWA 5TSEA 5KL7A 4DV0E 2L8TA 2LRSA 4WSPA 3F6HA 2L6MA 4Q28A 2L3CA 3EPJA 2EOJA 2EPNA 2CSHA 4FK5C 3J80C 2V86A 4WFTA 2EP3A 3T1YE 1WHQA 3VK6A 2YTEA 4F6MA 3BBGA 4DV2E 1YSAC 2EOMA 5LMNE 2YT4A 3HQ1A 5AE2A 2YTOA 4F54A 2LJHA 2I13A 1B69A 2EOXA 4GKJE 2LMZA 2UUCE 4NXNE 3C6MA 4DR2E 2ZM6E 4KHPE 2FGGA 2YRMA 2RTXA 1EH6A 2JOBA 5FLXC 1IBME 2ELYA 1DQ3A 2HJJA 3QG5C 4IJDA 5KL3A 4M0VA 1YFHA 1PDAA 2DGCA 4LF9E 3MSWA 4BCAA 2KONA 1UBDC 5A2QC 2KHXA 4OOGC 3J81C 4JV5E 2EPCA 2EQ1A 2E72A 3AUZA 5BR8E 4F6NA 2UXCE 2BBGA 4HTGA 4R2AA 4WXDA 4IS1C 2LVHA 2EZ6A 2L2MA 2EJ4A 2EMBA 2JYAA 4X8WA 2N8XA 4GZNC 1XNQE 2H36X 1NCSA 4LFCE 2E1MA 2ELZA 1RC7A 2EMXA 1STUA 2M1SA 1IQOA 2EPMX 2RS6A 1DGCA 2YTIA 3C4TA 4DV7E 4K0KE 5KL2A 2EPOA 1PJQA 1WJPA 2EPXA 1KYQA 2YTQA 2YWQA 1LLMC 2LBSB 4B3SE 3M99B 4YY3E 2NABA 2EE8A 4R2QA 3RMPA 2JY9A 2VQFE 3HXLA 3EPLA 3IWCA 1DI2A 2EN3A 2D9HA 2G7HA 1N34E 4M30A 4DR6E 3JAMC 4DR5E 1IQSA 4WXCA 1YPNA 3H09A 2EMZA 5AE3A 3DF6A 3IWBA 1TF3A 2UUAE 1YUIA 1T4NA 2LCEA 1F2IG 2NUFA 2YTGA 1L4SA 2DMIA 2EN6A 1PKPA 4YHHE 2ENHA 5CFFE 2DLKA 2EOZA 2LUQA 4R2DA 3KZZA 3JTZA 2RQLA 1JK1A 5LLQA 2HGHA 1T39A 1A1JA 2RSIA 4X62E 2RSMA 4NXME 2YU5A 4HEIA 4DV6E 3VYXA 3ADIA 3MHSC 2V83A 4DKKA 2MDRA 4BBYA 2EPKX 2YSPA 4BHBA 2VE7C 1A1GA 1X49A 2YU8A 4DR1E 1MEYC 3MHHC 4DV5E 4O4KA 4P78A 4RH8A 5IT9C 1IBKE 2YTPA 2L33A 4F9BB 5A6AA 4DUYE 2DRPA 2WCC3 4GKKE 2LUPB 3HPSA 2EOFA 4LF4E 2DMYA 2Q8UA 3P1XA 2NUEA 2YTFA 1T38A 2UUBE 4JYAE 2K4VA 2NUGA 4TUIA 1ZBQA 4LU9A 2LJUA 2LE2A 1AAYA 2ADRA 2MC5A 2J7JA 1YZ9A 2EM9A 5AASA 1N36E 3ADJA 1RMDA 2PRTA 4M2ZA 1MGTA 1YYOA 5ADZA 2N3GA 1GTKA 3TQMA 2LT7A 2L92A 1J5EE 3LLHA 1GZ6A 4ZYDA 5IV8B 2ODRD 2FV4B 1A1FA 2YTNA 4WPYA 2E5LE 2EPAA 4LF8E 4M9VC 1X6FA 2B3TB 2EOSA 1IMUA 2DIXA 5AE1A 2EN2A 1N3GA 1YYWA 4DR4E 1N33E 4AQYE 1Z1BA 2WBTA 2F8BA 4JI1E 3J7Yp 4DR7E 4ZYHA 1TF6A 3THNA 2I9IA 4BC7A 5F3WA 4B3RE 2EL6A 2JP9A 1X48A 1A1LA 1YUJA 2EPLX 2YSOA 2HC5A 2EN4A 5KL6A 2EPUA 5LMUE 4X9JA 1NEIA 1SR9A 3HTXA 1X3CA 1WRJA 4N4RB 2LV2A 1ZR9A 2EMFA 2CT1A 2JPAA 1UN6B 2WBUA 4GEQB 2JVAA 2IHR1 1X6EA 4Q35B 4JI0E 2EMCA 2WZOA 1UHZA 4O24A 4L5NC 2V87A 4L8NA 2EM4A 1O0WA 2EL4A 2V89A 4O43A 4JI2E 4R8OA 2V85A 2VF1A 4RHBB 2EQ0A 3LMLA 3F6GA 2B9DA 4X64E 2EM0A 2M7QA 2EN1A 3THOB 4LF5E 2VQEE 2EPPA 2YTJA 2B7TA 5IXMB 1EH7A 4R2RA 4DUZE 5KL5A 3BGHA 2EM6A 4O5GA 1RQ0A 1ZU1A 4DMIA 2L3JA 2EORA 4F9CB 1ZAAC 3ADLA 1X6HA 2NA2A 2YRHA 5AC4A 4WSGA 4BS9A 2ENAA 2KOUA 4LFBE 2UXBE 2YRKA 2DSYA 2L2NA 4DV3E 3BF2A 1GQEA 2EMIA 2JOXA 1HNWE 1SFEA 1UILA 2RS7A 3FIGA 2VRDA 2EOYA 2JXPA 4X65E 1N32E 2R1FA 2EWLA 4DV1E 4KZSA 1G2FC 1WHNA 2EMYA 4J8ZA 3ZOQB 2WBSA 3EQ1A 4LFAE 2UU9E 4R2SA 4WX9A 3OMLA 4F9AB 2EQ3A 2EPRA 1J26A 1IBLE 2EOIA 2MC6A
chains in the Genus database with same CATH topology
4RHBB 5IXMB 4N4RB 4NHRA 5TSEA 4KWYA 4Q35B 3BF2A 2N8XA 4RH8A 2R76A 5IV8B 2JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHB B;  5IXM B;  4N4R B;  4NHR A;  5TSE A;  4KWY A;  4Q35 B;  3BF2 A;  2N8X A;  4RH8 A;  2R76 A;  5IV8 B;  2JXP A; 
#chains in the Genus database with same CATH topology
 2YZT A;  4JI6 E;  5LL6 R;  1A1H A;  5A6B A;  2MKN A;  2JWO A;  2EOO A;  1XMQ E;  2MDG A;  2ODR C;  3VYY A;  1FJG E;  3T1H E;  4B3T E;  4ZYG A;  1P47 A;  2EM7 A;  2EOQ A;  2YTD A;  3ECR A;  3JU0 A;  2V88 A;  4R2C A;  1X5W A;  2DB2 A;  2ENC A;  2JR1 A;  2EOE A;  5A69 A;  2HHH E;  5IWA E;  3L00 A;  1T4O A;  2B7V A;  2EN7 A;  4ZYE A;  3K6Q A;  2EML A;  1HNX E;  4I8O A;  1FKA E;  5AC5 A;  4F2J C;  3VHT B;  4MLQ A;  1BB8 A;  1QU6 A;  1A1K A;  2EN8 A;  3BID A;  5KL4 A;  1ZBT A;  2EPZ A;  1X47 A;  2CPN A;  4LF6 E;  1A1I A;  4B3M E;  2F4V E;  3UK3 C;  1BBO A;  1YYK A;  3KWR A;  2MKD A;  1EKZ A;  5T6J A;  2EMW A;  1BBG A;  2EM8 A;  2LTR A;  3C6K A;  2EMH A;  3IWD A;  1PJS A;  3KZY A;  1EH8 A;  4JI7 E;  4JI5 E;  2LO3 A;  2EOH A;  1KJK A;  3HPZ A;  3C4B A;  4NHR A;  1XNR E;  1QNT A;  4MLV A;  4JI8 E;  5A6J A;  2YPN A;  4DV4 E;  2V8Q B;  2CTD A;  2GLI A;  4R03 A;  1G2D C;  5DNY A;  1HNZ E;  1XMO E;  4P7D A;  2R76 A;  3EPH A;  2EMK A;  2EMG A;  4KWY A;  2A25 A;  4JI4 E;  4R2P A;  2M9A A;  2LTS A;  2M4I A;  2L2K B;  2EM3 A;  2EM2 A;  1WXR A;  4LF7 E;  3EPK A;  2UXD E;  1T4L B;  3AV0 A;  4OX9 E;  2GHF A;  2FTX B;  2DLQ A;  1PJT A;  4X66 E;  2EM5 A;  4BMJ A;  1HR0 E;  2RPC A;  3OTO E;  2EMA A;  4R2E A;  2GPI A;  4WYQ B;  4NZV A;  4DR3 E;  1I94 E;  1AH5 A;  4TUG A;  2K7I A;  4BC9 A;  2EL5 A;  4JI3 E;  1TN9 A;  4BHC A;  5A6B D;  2N3H A;  4LTY A;  3ADG A;  3J7A G;  5A6K A;  1JK2 A;  2BB8 A;  3DJW A;  5TSE A;  5KL7 A;  4DV0 E;  2L8T A;  2LRS A;  4WSP A;  3F6H A;  2L6M A;  4Q28 A;  2L3C A;  3EPJ A;  2EOJ A;  2EPN A;  2CSH A;  4FK5 C;  3J80 C;  2V86 A;  4WFT A;  2EP3 A;  3T1Y E;  1WHQ A;  3VK6 A;  2YTE A;  4F6M A;  3BBG A;  4DV2 E;  1YSA C;  2EOM A;  5LMN E;  2YT4 A;  3HQ1 A;  5AE2 A;  2YTO A;  4F54 A;  2LJH A;  2I13 A;  1B69 A;  2EOX A;  4GKJ E;  2LMZ A;  2UUC E;  4NXN E;  3C6M A;  4DR2 E;  2ZM6 E;  4KHP E;  2FGG A;  2YRM A;  2RTX A;  1EH6 A;  2JOB A;  5FLX C;  1IBM E;  2ELY A;  1DQ3 A;  2HJJ A;  3QG5 C;  4IJD A;  5KL3 A;  4M0V A;  1YFH A;  1PDA A;  2DGC A;  4LF9 E;  3MSW A;  4BCA A;  2KON A;  1UBD C;  5A2Q C;  2KHX A;  4OOG C;  3J81 C;  4JV5 E;  2EPC A;  2EQ1 A;  2E72 A;  3AUZ A;  5BR8 E;  4F6N A;  2UXC E;  2BBG A;  4HTG A;  4R2A A;  4WXD A;  4IS1 C;  2LVH A;  2EZ6 A;  2L2M A;  2EJ4 A;  2EMB A;  2JYA A;  4X8W A;  2N8X A;  4GZN C;  1XNQ E;  2H36 X;  1NCS A;  4LFC E;  2E1M A;  2ELZ A;  1RC7 A;  2EMX A;  1STU A;  2M1S A;  1IQO A;  2EPM X;  2RS6 A;  1DGC A;  2YTI A;  3C4T A;  4DV7 E;  4K0K E;  5KL2 A;  2EPO A;  1PJQ A;  1WJP A;  2EPX A;  1KYQ A;  2YTQ A;  2YWQ A;  1LLM C;  2LBS B;  4B3S E;  3M99 B;  4YY3 E;  2NAB A;  2EE8 A;  4R2Q A;  3RMP A;  2JY9 A;  2VQF E;  3HXL A;  3EPL A;  3IWC A;  1DI2 A;  2EN3 A;  2D9H A;  2G7H A;  1N34 E;  4M30 A;  4DR6 E;  3JAM C;  4DR5 E;  1IQS A;  4WXC A;  1YPN A;  3H09 A;  2EMZ A;  5AE3 A;  3DF6 A;  3IWB A;  1TF3 A;  2UUA E;  1YUI A;  1T4N A;  2LCE A;  1F2I G;  2NUF A;  2YTG A;  1L4S A;  2DMI A;  2EN6 A;  1PKP A;  4YHH E;  2ENH A;  5CFF E;  2DLK A;  2EOZ A;  2LUQ A;  4R2D A;  3KZZ A;  3JTZ A;  2RQL A;  1JK1 A;  5LLQ A;  2HGH A;  1T39 A;  1A1J A;  2RSI A;  4X62 E;  2RSM A;  4NXM E;  2YU5 A;  4HEI A;  4DV6 E;  3VYX A;  3ADI A;  3MHS C;  2V83 A;  4DKK A;  2MDR A;  4BBY A;  2EPK X;  2YSP A;  4BHB A;  2VE7 C;  1A1G A;  1X49 A;  2YU8 A;  4DR1 E;  1MEY C;  3MHH C;  4DV5 E;  4O4K A;  4P78 A;  4RH8 A;  5IT9 C;  1IBK E;  2YTP A;  2L33 A;  4F9B B;  5A6A A;  4DUY E;  2DRP A;  2WCC 3;  4GKK E;  2LUP B;  3HPS A;  2EOF A;  4LF4 E;  2DMY A;  2Q8U A;  3P1X A;  2NUE A;  2YTF A;  1T38 A;  2UUB E;  4JYA E;  2K4V A;  2NUG A;  4TUI A;  1ZBQ A;  4LU9 A;  2LJU A;  2LE2 A;  1AAY A;  2ADR A;  2MC5 A;  2J7J A;  1YZ9 A;  2EM9 A;  5AAS A;  1N36 E;  3ADJ A;  1RMD A;  2PRT A;  4M2Z A;  1MGT A;  1YYO A;  5ADZ A;  2N3G A;  1GTK A;  3TQM A;  2LT7 A;  2L92 A;  1J5E E;  3LLH A;  1GZ6 A;  4ZYD A;  5IV8 B;  2ODR D;  2FV4 B;  1A1F A;  2YTN A;  4WPY A;  2E5L E;  2EPA A;  4LF8 E;  4M9V C;  1X6F A;  2B3T B;  2EOS A;  1IMU A;  2DIX A;  5AE1 A;  2EN2 A;  1N3G A;  1YYW A;  4DR4 E;  1N33 E;  4AQY E;  1Z1B A;  2WBT A;  2F8B A;  4JI1 E;  3J7Y p;  4DR7 E;  4ZYH A;  1TF6 A;  3THN A;  2I9I A;  4BC7 A;  5F3W A;  4B3R E;  2EL6 A;  2JP9 A;  1X48 A;  1A1L A;  1YUJ A;  2EPL X;  2YSO A;  2HC5 A;  2EN4 A;  5KL6 A;  2EPU A;  5LMU E;  4X9J A;  1NEI A;  1SR9 A;  3HTX A;  1X3C A;  1WRJ A;  4N4R B;  2LV2 A;  1ZR9 A;  2EMF A;  2CT1 A;  2JPA A;  1UN6 B;  2WBU A;  4GEQ B;  2JVA A;  2IHR 1;  1X6E A;  4Q35 B;  4JI0 E;  2EMC A;  2WZO A;  1UHZ A;  4O24 A;  4L5N C;  2V87 A;  4L8N A;  2EM4 A;  1O0W A;  2EL4 A;  2V89 A;  4O43 A;  4JI2 E;  4R8O A;  2V85 A;  2VF1 A;  4RHB B;  2EQ0 A;  3LML A;  3F6G A;  2B9D A;  4X64 E;  2EM0 A;  2M7Q A;  2EN1 A;  3THO B;  4LF5 E;  2VQE E;  2EPP A;  2YTJ A;  2B7T A;  5IXM B;  1EH7 A;  4R2R A;  4DUZ E;  5KL5 A;  3BGH A;  2EM6 A;  4O5G A;  1RQ0 A;  1ZU1 A;  4DMI A;  2L3J A;  2EOR A;  4F9C B;  1ZAA C;  3ADL A;  1X6H A;  2NA2 A;  2YRH A;  5AC4 A;  4WSG A;  4BS9 A;  2ENA A;  2KOU A;  4LFB E;  2UXB E;  2YRK A;  2DSY A;  2L2N A;  4DV3 E;  3BF2 A;  1GQE A;  2EMI A;  2JOX A;  1HNW E;  1SFE A;  1UIL A;  2RS7 A;  3FIG A;  2VRD A;  2EOY A;  2JXP A;  4X65 E;  1N32 E;  2R1F A;  2EWL A;  4DV1 E;  4KZS A;  1G2F C;  1WHN A;  2EMY A;  4J8Z A;  3ZOQ B;  2WBS A;  3EQ1 A;  4LFA E;  2UU9 E;  4R2S A;  4WX9 A;  3OML A;  4F9A B;  2EQ3 A;  2EPR A;  1J26 A;  1IBL E;  2EOI A;  2MC6 A; 
#chains in the Genus database with same CATH homology
 4RHB B;  5IXM B;  4N4R B;  4NHR A;  5TSE A;  4KWY A;  4Q35 B;  3BF2 A;  2N8X A;  4RH8 A;  2R76 A;  5IV8 B;  2JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...