5IV8B

The lps transporter lptde from klebsiella pneumoniae, core complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
146
Chain Sequence
GWHLRVPTTMKTMILQSSDPNGPLSRAVRNQLRLNGVDLIDASTLRKDVPSLRLDGSSIQKDTASVFQDGRTAEYQMVMTVHASVLIPGHDIYPITTKVYRSFFDNPQAALAKDAEQDMIIQEMYDKAAEQLIRKLPSVQVADVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the LPS Transporter LptDE from Gram-Negative Pathogens.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
molecule keywords LPS biosynthesis protein
total genus 37
structure length 146
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5iv8B00
4NHRA 4N4RB 4RH8A 5IV8B 5TSEA 2JXPA 2N8XA 4KWYA 4Q35B 2R76A 3BF2A 4RHBB 5IXMB
chains in the Genus database with same CATH superfamily
4DV2E 2YTGA 1GZ6A 1BBOA 2YRHA 1RMDA 2MC6A 4NHRA 2WBUA 3P1XA 2LBSB 2LO3A 2L2NA 2LTRA 4JI7E 1ZBTA 4ZYEA 1T4OA 2LVHA 1PKPA 1A1JA 2YSPA 3AV0A 2G7HA 2GLIA 4HTGA 4JI1E 3JTZA 2E5LE 1DQ3A 2J7JA 3HXLA 2EN2A 5KL4A 3VHTB 2EMLA 2FGGA 1P47A 4LFBE 2EOYA 1IQOA 1YPNA 4JI3E 5BR8E 2Q8UA 2LCEA 2EL4A 2FV4B 5A6BD 1AH5A 4R8OA 2EM8A 4X64E 2EPXA 5A6AA 4R2AA 5T6JA 3HPZA 2RS6A 3L00A 1EKZA 3DJWA 4BS9A 4JI4E 3IWDA 5KL6A 2IHR1 4DR7E 2EZ6A 3ADJA 2R76A 3FIGA 5A69A 3KZZA 4B3RE 2EQ1A 2YTQA 2EM7A 1HNXE 2JR1A 2EMCA 2LMZA 4L8NA 1HNZE 1IMUA 1HR0E 5LLQA 2EM6A 2EMIA 3C6KA 2NUFA 3EQ1A 4LF5E 2YU5A 3QG5C 2EOIA 2H36X 2KHXA 4RH8A 4WYQB 2YTJA 2DMYA 4WFTA 2EWLA 2B9DA 3J7Yp 4R2SA 4DUZE 3F6GA 2KOUA 2V88A 2EN3A 2K4VA 4LF7E 3KZYA 4TUIA 1Z1BA 2LTSA 1X6FA 1N3GA 4WPYA 4LF8E 4N4RB 4LU9A 2EPLX 3HPSA 4R2QA 5KL3A 4DR5E 1YFHA 1RC7A 3OTOE 2ELZA 2VQFE 2B7VA 2EMGA 5LMNE 1FKAE 2LJHA 2KONA 2RPCA 1IQSA 2L8TA 2EMYA 1A1GA 4AQYE 3K6QA 2UXBE 2EPCA 1YYOA 1AAYA 5AE2A 2EOHA 2ENHA 2EOFA 2EPAA 2YTEA 2MC5A 4Q28A 4X66E 5KL2A 4LFCE 4DKKA 2WBTA 1X49A 4MLQA 1YZ9A 2UUBE 4X62E 1XMQE 2EN6A 2EN4A 2MDGA 1TN9A 2F4VE 4JI2E 4JI5E 2ZM6E 4DR6E 4L5NC 1A1KA 3T1YE 4M9VC 4OOGC 4DR1E 2VRDA 4BMJA 1UHZA 4F9AB 2EMXA 4DV4E 4GZNC 2GHFA 2EOQA 3BGHA 2MDRA 2D9HA 2YRMA 2GPIA 2LV2A 1PJQA 4YY3E 1X5WA 2YTIA 4JYAE 2E1MA 2EJ4A 2EN8A 2YTPA 1DGCA 4HEIA 1B69A 3MHSC 3VYXA 4P78A 3EPLA 1FJGE 5IWAE 3THNA 1JK2A 2LUPB 2L33A 2JP9A 4KWYA 2YSOA 3OMLA 4DV1E 1J26A 3H09A 2MKDA 1UN6B 1N36E 1DI2A 2RS7A 2EPKX 4DV6E 2HC5A 2PRTA 1GQEA 1ZU1A 4BC7A 3KWRA 1UILA 2NABA 4WXDA 4DV7E 4JI8E 2FTXB 4BC9A 3ADIA 5AASA 2N3GA 4R2CA 2L3CA 4DMIA 4F54A 4F6NA 2A25A 2LJUA 1G2DC 2I9IA 2ADRA 3TQMA 1YSAC 2F8BA 2MKNA 1MEYC 3ADGA 2CPNA 4O24A 2EN1A 2WZOA 3BF2A 2B3TB 4ZYGA 2L2KB 4R2EA 1X48A 2EPMX 3THOB 4F9CB 4LF6E 5A6BA 4J8ZA 2DGCA 3MHHC 4M30A 4WX9A 1IBLE 1XMOE 2ENAA 4R2RA 4DR3E 2NUEA 1KJKA 4IJDA 2HJJA 2JY9A 2EOOA 4X8WA 1WXRA 2L6MA 3J80C 4DV0E 2EP3A 2DMIA 2CSHA 4NXME 4B3SE 5A6KA 4JI6E 2L92A 2EORA 4JV5E 2EOMA 4DV3E 1YUIA 5AC5A 2EMKA 5LMUE 3UK3C 1J5EE 2EOJA 1N34E 2WCC3 4IS1C 4JI0E 1T4LB 2EN7A 4F9BB 1BBGA 2EE8A 5F3WA 1G2FC 1KYQA 2YTOA 2L3JA 1SFEA 2EMHA 2M7QA 1RQ0A 4O43A 1XNRE 5AE3A 3ADLA 1MGTA 1ZBQA 2EQ3A 2UU9E 1PJTA 2EOSA 2EM0A 5A2QC 1ZR9A 1WRJA 4P7DA 1YYKA 2EQ0A 1O0WA 3VYYA 1X47A 3EPHA 2M1SA 3C6MA 2HGHA 4F2JC 4BBYA 2NUGA 2UXCE 1SR9A 5KL7A 1LLMC 2V86A 2UUCE 4WSGA 1WJPA 2LRSA 2N8XA 3C4BA 2ODRC 2EM5A 2V87A 2VF1A 2EPUA 2DB2A 3EPKA 4ZYDA 2WBSA 1X6EA 5DNYA 2JXPA 4M0VA 1N32E 1NCSA 2RQLA 1YYWA 2RTXA 2EMFA 3AUZA 2V85A 2EPOA 4BHBA 4O4KA 4X9JA 5ADZA 1YUJA 2JOBA 3DF6A 5IV8B 1A1LA 2V83A 3ECRA 2CT1A 2I13A 4F6MA 3EPJA 4M2ZA 2EM9A 2EPNA 2YWQA 4GKKE 3LLHA 1I94E 4TUGA 4DR2E 2EM4A 4WSPA 4DV5E 1TF3A 4BCAA 1EH7A 1ZAAC 1QNTA 4LFAE 5LL6R 3F6HA 2EOXA 2V89A 2CTDA 2EPZA 4OX9E 2BBGA 2DLKA 2HHHE 4R03A 1L4SA 4GEQB 2EMZA 2N3HA 2DSYA 4B3ME 4FK5C 2VQEE 2EPPA 2EL6A 3J81C 2YT4A 2ENCA 1N33E 3BBGA 3HQ1A 1T38A 2YZTA 2EOZA 4LTYA 5IT9C 3HTXA 2RSIA 2EMBA 4NZVA 2JWOA 2YTFA 5A6JA 1UBDC 1T39A 2YU8A 2LE2A 1JK1A 2EMWA 3JU0A 2BB8A 2LT7A 3M99B 4Q35B 5AE1A 1T4NA 1GTKA 3VK6A 2JPAA 2VE7C 1IBKE 3C4TA 3RMPA 2YTNA 4O5GA 2EM2A 2EMAA 2B7TA 2DIXA 1X3CA 2M9AA 4MLVA 5TSEA 4DR4E 4X65E 1BB8A 5CFFE 2JYAA 2YTDA 2EL5A 5FLXC 1A1HA 3J7AG 4LF9E 1HNWE 2K7IA 3JAMC 5AC4A 3MSWA 3BIDA 2ODRD 4YHHE 1PDAA 4LF4E 1IBME 1WHNA 1PJSA 3T1HE 4DUYE 2ELYA 1XNQE 3ZOQB 2DLQA 1X6HA 2YRKA 4RHBB 2JOXA 2NA2A 1NEIA 2RSMA 2UUAE 2LUQA 4B3TE 1EH8A 1EH6A 5IXMB 3LMLA 2UXDE 1TF6A 2EOEA 4WXCA 1A1FA 4R2DA 2V8QB 4GKJE 2M4IA 4NXNE 2EPRA 4ZYHA 5KL5A 1A1IA 4R2PA 1F2IG 4K0KE 2L2MA 4KHPE 2JVAA 2EM3A 1STUA 2E72A 1QU6A 4I8OA 3IWCA 2YPNA 4KZSA 2DRPA 1WHQA 3IWBA 4BHCA 2R1FA
chains in the Genus database with same CATH topology
4NHRA 4N4RB 4RH8A 5IV8B 5TSEA 2JXPA 2N8XA 4KWYA 4Q35B 2R76A 3BF2A 4RHBB 5IXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHR A;  4N4R B;  4RH8 A;  5IV8 B;  5TSE A;  2JXP A;  2N8X A;  4KWY A;  4Q35 B;  2R76 A;  3BF2 A;  4RHB B;  5IXM B; 
#chains in the Genus database with same CATH topology
 4DV2 E;  2YTG A;  1GZ6 A;  1BBO A;  2YRH A;  1RMD A;  2MC6 A;  4NHR A;  2WBU A;  3P1X A;  2LBS B;  2LO3 A;  2L2N A;  2LTR A;  4JI7 E;  1ZBT A;  4ZYE A;  1T4O A;  2LVH A;  1PKP A;  1A1J A;  2YSP A;  3AV0 A;  2G7H A;  2GLI A;  4HTG A;  4JI1 E;  3JTZ A;  2E5L E;  1DQ3 A;  2J7J A;  3HXL A;  2EN2 A;  5KL4 A;  3VHT B;  2EML A;  2FGG A;  1P47 A;  4LFB E;  2EOY A;  1IQO A;  1YPN A;  4JI3 E;  5BR8 E;  2Q8U A;  2LCE A;  2EL4 A;  2FV4 B;  5A6B D;  1AH5 A;  4R8O A;  2EM8 A;  4X64 E;  2EPX A;  5A6A A;  4R2A A;  5T6J A;  3HPZ A;  2RS6 A;  3L00 A;  1EKZ A;  3DJW A;  4BS9 A;  4JI4 E;  3IWD A;  5KL6 A;  2IHR 1;  4DR7 E;  2EZ6 A;  3ADJ A;  2R76 A;  3FIG A;  5A69 A;  3KZZ A;  4B3R E;  2EQ1 A;  2YTQ A;  2EM7 A;  1HNX E;  2JR1 A;  2EMC A;  2LMZ A;  4L8N A;  1HNZ E;  1IMU A;  1HR0 E;  5LLQ A;  2EM6 A;  2EMI A;  3C6K A;  2NUF A;  3EQ1 A;  4LF5 E;  2YU5 A;  3QG5 C;  2EOI A;  2H36 X;  2KHX A;  4RH8 A;  4WYQ B;  2YTJ A;  2DMY A;  4WFT A;  2EWL A;  2B9D A;  3J7Y p;  4R2S A;  4DUZ E;  3F6G A;  2KOU A;  2V88 A;  2EN3 A;  2K4V A;  4LF7 E;  3KZY A;  4TUI A;  1Z1B A;  2LTS A;  1X6F A;  1N3G A;  4WPY A;  4LF8 E;  4N4R B;  4LU9 A;  2EPL X;  3HPS A;  4R2Q A;  5KL3 A;  4DR5 E;  1YFH A;  1RC7 A;  3OTO E;  2ELZ A;  2VQF E;  2B7V A;  2EMG A;  5LMN E;  1FKA E;  2LJH A;  2KON A;  2RPC A;  1IQS A;  2L8T A;  2EMY A;  1A1G A;  4AQY E;  3K6Q A;  2UXB E;  2EPC A;  1YYO A;  1AAY A;  5AE2 A;  2EOH A;  2ENH A;  2EOF A;  2EPA A;  2YTE A;  2MC5 A;  4Q28 A;  4X66 E;  5KL2 A;  4LFC E;  4DKK A;  2WBT A;  1X49 A;  4MLQ A;  1YZ9 A;  2UUB E;  4X62 E;  1XMQ E;  2EN6 A;  2EN4 A;  2MDG A;  1TN9 A;  2F4V E;  4JI2 E;  4JI5 E;  2ZM6 E;  4DR6 E;  4L5N C;  1A1K A;  3T1Y E;  4M9V C;  4OOG C;  4DR1 E;  2VRD A;  4BMJ A;  1UHZ A;  4F9A B;  2EMX A;  4DV4 E;  4GZN C;  2GHF A;  2EOQ A;  3BGH A;  2MDR A;  2D9H A;  2YRM A;  2GPI A;  2LV2 A;  1PJQ A;  4YY3 E;  1X5W A;  2YTI A;  4JYA E;  2E1M A;  2EJ4 A;  2EN8 A;  2YTP A;  1DGC A;  4HEI A;  1B69 A;  3MHS C;  3VYX A;  4P78 A;  3EPL A;  1FJG E;  5IWA E;  3THN A;  1JK2 A;  2LUP B;  2L33 A;  2JP9 A;  4KWY A;  2YSO A;  3OML A;  4DV1 E;  1J26 A;  3H09 A;  2MKD A;  1UN6 B;  1N36 E;  1DI2 A;  2RS7 A;  2EPK X;  4DV6 E;  2HC5 A;  2PRT A;  1GQE A;  1ZU1 A;  4BC7 A;  3KWR A;  1UIL A;  2NAB A;  4WXD A;  4DV7 E;  4JI8 E;  2FTX B;  4BC9 A;  3ADI A;  5AAS A;  2N3G A;  4R2C A;  2L3C A;  4DMI A;  4F54 A;  4F6N A;  2A25 A;  2LJU A;  1G2D C;  2I9I A;  2ADR A;  3TQM A;  1YSA C;  2F8B A;  2MKN A;  1MEY C;  3ADG A;  2CPN A;  4O24 A;  2EN1 A;  2WZO A;  3BF2 A;  2B3T B;  4ZYG A;  2L2K B;  4R2E A;  1X48 A;  2EPM X;  3THO B;  4F9C B;  4LF6 E;  5A6B A;  4J8Z A;  2DGC A;  3MHH C;  4M30 A;  4WX9 A;  1IBL E;  1XMO E;  2ENA A;  4R2R A;  4DR3 E;  2NUE A;  1KJK A;  4IJD A;  2HJJ A;  2JY9 A;  2EOO A;  4X8W A;  1WXR A;  2L6M A;  3J80 C;  4DV0 E;  2EP3 A;  2DMI A;  2CSH A;  4NXM E;  4B3S E;  5A6K A;  4JI6 E;  2L92 A;  2EOR A;  4JV5 E;  2EOM A;  4DV3 E;  1YUI A;  5AC5 A;  2EMK A;  5LMU E;  3UK3 C;  1J5E E;  2EOJ A;  1N34 E;  2WCC 3;  4IS1 C;  4JI0 E;  1T4L B;  2EN7 A;  4F9B B;  1BBG A;  2EE8 A;  5F3W A;  1G2F C;  1KYQ A;  2YTO A;  2L3J A;  1SFE A;  2EMH A;  2M7Q A;  1RQ0 A;  4O43 A;  1XNR E;  5AE3 A;  3ADL A;  1MGT A;  1ZBQ A;  2EQ3 A;  2UU9 E;  1PJT A;  2EOS A;  2EM0 A;  5A2Q C;  1ZR9 A;  1WRJ A;  4P7D A;  1YYK A;  2EQ0 A;  1O0W A;  3VYY A;  1X47 A;  3EPH A;  2M1S A;  3C6M A;  2HGH A;  4F2J C;  4BBY A;  2NUG A;  2UXC E;  1SR9 A;  5KL7 A;  1LLM C;  2V86 A;  2UUC E;  4WSG A;  1WJP A;  2LRS A;  2N8X A;  3C4B A;  2ODR C;  2EM5 A;  2V87 A;  2VF1 A;  2EPU A;  2DB2 A;  3EPK A;  4ZYD A;  2WBS A;  1X6E A;  5DNY A;  2JXP A;  4M0V A;  1N32 E;  1NCS A;  2RQL A;  1YYW A;  2RTX A;  2EMF A;  3AUZ A;  2V85 A;  2EPO A;  4BHB A;  4O4K A;  4X9J A;  5ADZ A;  1YUJ A;  2JOB A;  3DF6 A;  5IV8 B;  1A1L A;  2V83 A;  3ECR A;  2CT1 A;  2I13 A;  4F6M A;  3EPJ A;  4M2Z A;  2EM9 A;  2EPN A;  2YWQ A;  4GKK E;  3LLH A;  1I94 E;  4TUG A;  4DR2 E;  2EM4 A;  4WSP A;  4DV5 E;  1TF3 A;  4BCA A;  1EH7 A;  1ZAA C;  1QNT A;  4LFA E;  5LL6 R;  3F6H A;  2EOX A;  2V89 A;  2CTD A;  2EPZ A;  4OX9 E;  2BBG A;  2DLK A;  2HHH E;  4R03 A;  1L4S A;  4GEQ B;  2EMZ A;  2N3H A;  2DSY A;  4B3M E;  4FK5 C;  2VQE E;  2EPP A;  2EL6 A;  3J81 C;  2YT4 A;  2ENC A;  1N33 E;  3BBG A;  3HQ1 A;  1T38 A;  2YZT A;  2EOZ A;  4LTY A;  5IT9 C;  3HTX A;  2RSI A;  2EMB A;  4NZV A;  2JWO A;  2YTF A;  5A6J A;  1UBD C;  1T39 A;  2YU8 A;  2LE2 A;  1JK1 A;  2EMW A;  3JU0 A;  2BB8 A;  2LT7 A;  3M99 B;  4Q35 B;  5AE1 A;  1T4N A;  1GTK A;  3VK6 A;  2JPA A;  2VE7 C;  1IBK E;  3C4T A;  3RMP A;  2YTN A;  4O5G A;  2EM2 A;  2EMA A;  2B7T A;  2DIX A;  1X3C A;  2M9A A;  4MLV A;  5TSE A;  4DR4 E;  4X65 E;  1BB8 A;  5CFF E;  2JYA A;  2YTD A;  2EL5 A;  5FLX C;  1A1H A;  3J7A G;  4LF9 E;  1HNW E;  2K7I A;  3JAM C;  5AC4 A;  3MSW A;  3BID A;  2ODR D;  4YHH E;  1PDA A;  4LF4 E;  1IBM E;  1WHN A;  1PJS A;  3T1H E;  4DUY E;  2ELY A;  1XNQ E;  3ZOQ B;  2DLQ A;  1X6H A;  2YRK A;  4RHB B;  2JOX A;  2NA2 A;  1NEI A;  2RSM A;  2UUA E;  2LUQ A;  4B3T E;  1EH8 A;  1EH6 A;  5IXM B;  3LML A;  2UXD E;  1TF6 A;  2EOE A;  4WXC A;  1A1F A;  4R2D A;  2V8Q B;  4GKJ E;  2M4I A;  4NXN E;  2EPR A;  4ZYH A;  5KL5 A;  1A1I A;  4R2P A;  1F2I G;  4K0K E;  2L2M A;  4KHP E;  2JVA A;  2EM3 A;  1STU A;  2E72 A;  1QU6 A;  4I8O A;  3IWC A;  2YPN A;  4KZS A;  2DRP A;  1WHQ A;  3IWB A;  4BHC A;  2R1F A; 
#chains in the Genus database with same CATH homology
 4NHR A;  4N4R B;  4RH8 A;  5IV8 B;  5TSE A;  2JXP A;  2N8X A;  4KWY A;  4Q35 B;  2R76 A;  3BF2 A;  4RHB B;  5IXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...