5IV8B

The lps transporter lptde from klebsiella pneumoniae, core complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
146
Chain Sequence
GWHLRVPTTMKTMILQSSDPNGPLSRAVRNQLRLNGVDLIDASTLRKDVPSLRLDGSSIQKDTASVFQDGRTAEYQMVMTVHASVLIPGHDIYPITTKVYRSFFDNPQAALAKDAEQDMIIQEMYDKAAEQLIRKLPSVQVADVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS biosynthesis protein
publication title Structural and Functional Characterization of the LPS Transporter LptDE from Gram-Negative Pathogens.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
total genus 37
structure length 146
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5iv8B00
4RH8A 5TSEA 2R76A 5IV8B 3BF2A 2N8XA 4Q35B 4NHRA 4RHBB 4N4RB 2JXPA 4KWYA 5IXMB
chains in the Genus database with same CATH superfamily
3JTZA 2I13A 2CTDA 2YSPA 2VE7C 4DKKA 4NXME 2YZTA 4Q35B 2YRKA 3P1XA 4JI6E 4N4RB 2YTQA 1X6EA 2DIXA 1BBGA 4KHPE 2EOFA 2HJJA 2EOIA 2L33A 2NABA 4DV6E 2RS6A 1YSAC 5LLQA 1EH6A 2EN6A 3JAMC 4F9AB 5AASA 4DV0E 4X9JA 2A25A 4P7DA 2BBGA 1L4SA 2FTXB 1O0WA 2EN2A 4LF4E 2YTPA 1KYQA 2M4IA 1YPNA 2EP3A 2R1FA 2EZ6A 4BS9A 5KL6A 3THOB 2ENAA 2EORA 3LLHA 2EE8A 2RS7A 1YUIA 4X65E 2YTIA 2F4VE 3HQ1A 3EPJA 4M2ZA 2M7QA 4DMIA 1J5EE 3UK3C 2D9HA 1X3CA 4ZYEA 2L3CA 4DR6E 4FK5C 2MC5A 4JI4E 2YT4A 4LFBE 2BB8A 2UXDE 3AV0A 2PRTA 3ECRA 1GTKA 5KL7A 3T1YE 5T6JA 4DV4E 2M9AA 4R2PA 5IV8B 2E72A 2G7HA 2L92A 3DF6A 2RTXA 1A1IA 3OTOE 2UU9E 2I9IA 1X47A 4BHBA 2L2MA 4WFTA 2DMIA 2LE2A 3VK6A 1FKAE 2EMGA 3LMLA 3QG5C 1RC7A 2EM7A 2JOBA 4YY3E 4DV2E 1XMQE 1XNRE 2JP9A 2EN4A 1UHZA 2ELYA 2R76A 1T38A 4WXDA 2JPAA 1MGTA 2VF1A 1X6FA 1Z1BA 4F2JC 4F6MA 4MLQA 2HHHE 2EQ3A 3K6QA 1XMOE 4R8OA 4DR1E 2JVAA 4O24A 1RMDA 3DJWA 1PJTA 4WXCA 4DV7E 2DB2A 2LT7A 4R2EA 1WHNA 2EPNA 1A1LA 2FGGA 2EQ1A 4ZYGA 1G2FC 2EPLX 2EMHA 5IT9C 2EL4A 4L8NA 2MC6A 2RSMA 1EKZA 3ADGA 1IBKE 1EH8A 4J8ZA 1A1JA 2V87A 2LRSA 4DR2E 4LFCE 2EMWA 4IJDA 4JI2E 3VYXA 4M9VC 1DGCA 3HXLA 1NCSA 1WJPA 4DV5E 2EMYA 3EPHA 2EPRA 4R2QA 2EOXA 2Q8UA 1KJKA 1WRJA 4DUZE 1DI2A 2LTSA 2B9DA 1UBDC 1T39A 5IXMB 4JI3E 2KHXA 1TN9A 1N33E 5A6JA 1X6HA 2F8BA 4RH8A 1ZBQA 2YTDA 4F9BB 2UUCE 2YU5A 1PJQA 2WCC3 1EH7A 5A6BA 2V83A 1A1KA 4TUIA 1N34E 2YPNA 5BR8E 4NHRA 4DV1E 2EMIA 2L6MA 5AE2A 2EOJA 1SFEA 2YTOA 2EM5A 4OOGC 1J26A 2EPXA 2E5LE 3FIGA 3J7AG 2DLKA 1X5WA 2EPKX 2EMKA 2EPOA 1F2IG 2LVHA 2RPCA 1HNWE 2L8TA 4I8OA 2VRDA 1IQOA 4M30A 1MEYC 1HNZE 1IMUA 3EPKA 2EOQA 2EM2A 3IWBA 3ADJA 4R2DA 1BBOA 1A1FA 2GLIA 4HTGA 2RSIA 4DR7E 2EPCA 2EMLA 1YYOA 1A1HA 2RQLA 1IBLE 5IWAE 1G2DC 2EN1A 2LJUA 3HPSA 2V88A 1TF6A 4LF6E 3J81C 1GQEA 4WSPA 3F6GA 4JI7E 2JYAA 4OX9E 4NZVA 2WZOA 3THNA 4BC7A 1WHQA 5A2QC 1LLMC 1N32E 4B3SE 2L3JA 2EOHA 2EPAA 2IHR1 2GPIA 2EMZA 3MHSC 3HTXA 2HC5A 4M0VA 2YRMA 2UUBE 4GZNC 2JXPA 3KZYA 2CT1A 2YSOA 3BIDA 4B3RE 4RHBB 2ODRC 3ZOQB 5KL5A 2FV4B 2LMZA 2EQ0A 2M1SA 5LMNE 1YYWA 3IWCA 1T4NA 2EL5A 4NXNE 2EOSA 2MKNA 2N3HA 1X48A 2EJ4A 2EN7A 4F6NA 4B3ME 5LL6R 4DV3E 2NUEA 2YWQA 1QNTA 2LTRA 2EPPA 4BCAA 4LF5E 3KZZA 5AC5A 2MDRA 4O4KA 4WX9A 4LFAE 2E1MA 4DR5E 4F9CB 1ZAAC 4ZYHA 4LF7E 4L5NC 3KWRA 2V86A 2K7IA 2YU8A 2DSYA 3ADLA 4X64E 2LJHA 2JY9A 3L00A 4X62E 3C6MA 2B7TA 1T4LB 4O5GA 2DLQA 4GKKE 2EM6A 1IBME 2DMYA 2MKDA 1IQSA 2LUQA 4JYAE 2EOMA 3ADIA 2WBUA 5F3WA 2ELZA 1WXRA 2YRHA 2ENHA 1NEIA 5TSEA 2V85A 1UILA 3BF2A 4BMJA 4JI8E 3VHTB 5ADZA 3J80C 1N3GA 2EM9A 4BBYA 1AAYA 4B3TE 1YZ9A 2EOEA 1DQ3A 2EM8A 4WPYA 3MHHC 1I94E 2EL6A 2EOYA 2LBSB 2EM3A 4JV5E 1B69A 1SR9A 5AC4A 3C4TA 2LUPB 3RMPA 1JK2A 1XNQE 3HPZA 1FJGE 4R2AA 2CPNA 5AE3A 1P47A 4F54A 4GEQB 3T1HE 3H09A 1ZBTA 1QU6A 3JU0A 3VYYA 5DNYA 4LF9E 2MDGA 3EPLA 3BBGA 4X8WA 5KL4A 4TUGA 3IWDA 2ZM6E 1PKPA 3M99B 1YYKA 5LMUE 2UUAE 1UN6B 2K4VA 4AQYE 1RQ0A 2N8XA 2JOXA 1A1GA 1YUJA 1N36E 4IS1C 2YTGA 2EN3A 3AUZA 2EMXA 1PDAA 2JWOA 1TF3A 2ODRD 2N3GA 2UXCE 4JI5E 4BC9A 5A6AA 2EMFA 2VQEE 2H36X 2EMCA 2EPUA 2KOUA 5A6BD 5CFFE 4O43A 2NUGA 1BB8A 3F6HA 2WBTA 2B3TB 4KWYA 1AH5A 2WBSA 3C6KA 3J7Yp 4MLVA 2VQFE 4X66E 2YTFA 2EOOA 5KL2A 4P78A 4R2CA 3EQ1A 2EN8A 4DR3E 1ZU1A 2B7VA 2EMAA 2EPMX 2EMBA 5KL3A 2DRPA 4JI0E 4BHCA 5A69A 4Q28A 4KZSA 2JR1A 4R03A 1ZR9A 2UXBE 4K0KE 5FLXC 2V89A 4LF8E 5AE1A 1PJSA 2LV2A 3C4BA 4LTYA 3BGHA 2CSHA 3MSWA 4DR4E 4R2RA 2L2KB 2J7JA 2LO3A 4WYQB 1GZ6A 4YHHE 1X49A 2GHFA 1HR0E 4LU9A 1STUA 2ADRA 1JK1A 2NA2A 4R2SA 5A6KA 4GKJE 2NUFA 2LCEA 4HEIA 2HGHA 2EWLA 4WSGA 2EPZA 3OMLA 2ENCA 3TQMA 2EM4A 4DUYE 2V8QB 2KONA 2YTJA 2YTEA 2EOZA 1YFHA 4JI1E 2EM0A 2YTNA 2L2NA 1T4OA 1HNXE 4ZYDA 2DGCA
chains in the Genus database with same CATH topology
4RH8A 5TSEA 2R76A 5IV8B 3BF2A 2N8XA 4Q35B 4NHRA 4RHBB 4N4RB 2JXPA 4KWYA 5IXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RH8 A;  5TSE A;  2R76 A;  5IV8 B;  3BF2 A;  2N8X A;  4Q35 B;  4NHR A;  4RHB B;  4N4R B;  2JXP A;  4KWY A;  5IXM B; 
#chains in the Genus database with same CATH topology
 3JTZ A;  2I13 A;  2CTD A;  2YSP A;  2VE7 C;  4DKK A;  4NXM E;  2YZT A;  4Q35 B;  2YRK A;  3P1X A;  4JI6 E;  4N4R B;  2YTQ A;  1X6E A;  2DIX A;  1BBG A;  4KHP E;  2EOF A;  2HJJ A;  2EOI A;  2L33 A;  2NAB A;  4DV6 E;  2RS6 A;  1YSA C;  5LLQ A;  1EH6 A;  2EN6 A;  3JAM C;  4F9A B;  5AAS A;  4DV0 E;  4X9J A;  2A25 A;  4P7D A;  2BBG A;  1L4S A;  2FTX B;  1O0W A;  2EN2 A;  4LF4 E;  2YTP A;  1KYQ A;  2M4I A;  1YPN A;  2EP3 A;  2R1F A;  2EZ6 A;  4BS9 A;  5KL6 A;  3THO B;  2ENA A;  2EOR A;  3LLH A;  2EE8 A;  2RS7 A;  1YUI A;  4X65 E;  2YTI A;  2F4V E;  3HQ1 A;  3EPJ A;  4M2Z A;  2M7Q A;  4DMI A;  1J5E E;  3UK3 C;  2D9H A;  1X3C A;  4ZYE A;  2L3C A;  4DR6 E;  4FK5 C;  2MC5 A;  4JI4 E;  2YT4 A;  4LFB E;  2BB8 A;  2UXD E;  3AV0 A;  2PRT A;  3ECR A;  1GTK A;  5KL7 A;  3T1Y E;  5T6J A;  4DV4 E;  2M9A A;  4R2P A;  5IV8 B;  2E72 A;  2G7H A;  2L92 A;  3DF6 A;  2RTX A;  1A1I A;  3OTO E;  2UU9 E;  2I9I A;  1X47 A;  4BHB A;  2L2M A;  4WFT A;  2DMI A;  2LE2 A;  3VK6 A;  1FKA E;  2EMG A;  3LML A;  3QG5 C;  1RC7 A;  2EM7 A;  2JOB A;  4YY3 E;  4DV2 E;  1XMQ E;  1XNR E;  2JP9 A;  2EN4 A;  1UHZ A;  2ELY A;  2R76 A;  1T38 A;  4WXD A;  2JPA A;  1MGT A;  2VF1 A;  1X6F A;  1Z1B A;  4F2J C;  4F6M A;  4MLQ A;  2HHH E;  2EQ3 A;  3K6Q A;  1XMO E;  4R8O A;  4DR1 E;  2JVA A;  4O24 A;  1RMD A;  3DJW A;  1PJT A;  4WXC A;  4DV7 E;  2DB2 A;  2LT7 A;  4R2E A;  1WHN A;  2EPN A;  1A1L A;  2FGG A;  2EQ1 A;  4ZYG A;  1G2F C;  2EPL X;  2EMH A;  5IT9 C;  2EL4 A;  4L8N A;  2MC6 A;  2RSM A;  1EKZ A;  3ADG A;  1IBK E;  1EH8 A;  4J8Z A;  1A1J A;  2V87 A;  2LRS A;  4DR2 E;  4LFC E;  2EMW A;  4IJD A;  4JI2 E;  3VYX A;  4M9V C;  1DGC A;  3HXL A;  1NCS A;  1WJP A;  4DV5 E;  2EMY A;  3EPH A;  2EPR A;  4R2Q A;  2EOX A;  2Q8U A;  1KJK A;  1WRJ A;  4DUZ E;  1DI2 A;  2LTS A;  2B9D A;  1UBD C;  1T39 A;  5IXM B;  4JI3 E;  2KHX A;  1TN9 A;  1N33 E;  5A6J A;  1X6H A;  2F8B A;  4RH8 A;  1ZBQ A;  2YTD A;  4F9B B;  2UUC E;  2YU5 A;  1PJQ A;  2WCC 3;  1EH7 A;  5A6B A;  2V83 A;  1A1K A;  4TUI A;  1N34 E;  2YPN A;  5BR8 E;  4NHR A;  4DV1 E;  2EMI A;  2L6M A;  5AE2 A;  2EOJ A;  1SFE A;  2YTO A;  2EM5 A;  4OOG C;  1J26 A;  2EPX A;  2E5L E;  3FIG A;  3J7A G;  2DLK A;  1X5W A;  2EPK X;  2EMK A;  2EPO A;  1F2I G;  2LVH A;  2RPC A;  1HNW E;  2L8T A;  4I8O A;  2VRD A;  1IQO A;  4M30 A;  1MEY C;  1HNZ E;  1IMU A;  3EPK A;  2EOQ A;  2EM2 A;  3IWB A;  3ADJ A;  4R2D A;  1BBO A;  1A1F A;  2GLI A;  4HTG A;  2RSI A;  4DR7 E;  2EPC A;  2EML A;  1YYO A;  1A1H A;  2RQL A;  1IBL E;  5IWA E;  1G2D C;  2EN1 A;  2LJU A;  3HPS A;  2V88 A;  1TF6 A;  4LF6 E;  3J81 C;  1GQE A;  4WSP A;  3F6G A;  4JI7 E;  2JYA A;  4OX9 E;  4NZV A;  2WZO A;  3THN A;  4BC7 A;  1WHQ A;  5A2Q C;  1LLM C;  1N32 E;  4B3S E;  2L3J A;  2EOH A;  2EPA A;  2IHR 1;  2GPI A;  2EMZ A;  3MHS C;  3HTX A;  2HC5 A;  4M0V A;  2YRM A;  2UUB E;  4GZN C;  2JXP A;  3KZY A;  2CT1 A;  2YSO A;  3BID A;  4B3R E;  4RHB B;  2ODR C;  3ZOQ B;  5KL5 A;  2FV4 B;  2LMZ A;  2EQ0 A;  2M1S A;  5LMN E;  1YYW A;  3IWC A;  1T4N A;  2EL5 A;  4NXN E;  2EOS A;  2MKN A;  2N3H A;  1X48 A;  2EJ4 A;  2EN7 A;  4F6N A;  4B3M E;  5LL6 R;  4DV3 E;  2NUE A;  2YWQ A;  1QNT A;  2LTR A;  2EPP A;  4BCA A;  4LF5 E;  3KZZ A;  5AC5 A;  2MDR A;  4O4K A;  4WX9 A;  4LFA E;  2E1M A;  4DR5 E;  4F9C B;  1ZAA C;  4ZYH A;  4LF7 E;  4L5N C;  3KWR A;  2V86 A;  2K7I A;  2YU8 A;  2DSY A;  3ADL A;  4X64 E;  2LJH A;  2JY9 A;  3L00 A;  4X62 E;  3C6M A;  2B7T A;  1T4L B;  4O5G A;  2DLQ A;  4GKK E;  2EM6 A;  1IBM E;  2DMY A;  2MKD A;  1IQS A;  2LUQ A;  4JYA E;  2EOM A;  3ADI A;  2WBU A;  5F3W A;  2ELZ A;  1WXR A;  2YRH A;  2ENH A;  1NEI A;  5TSE A;  2V85 A;  1UIL A;  3BF2 A;  4BMJ A;  4JI8 E;  3VHT B;  5ADZ A;  3J80 C;  1N3G A;  2EM9 A;  4BBY A;  1AAY A;  4B3T E;  1YZ9 A;  2EOE A;  1DQ3 A;  2EM8 A;  4WPY A;  3MHH C;  1I94 E;  2EL6 A;  2EOY A;  2LBS B;  2EM3 A;  4JV5 E;  1B69 A;  1SR9 A;  5AC4 A;  3C4T A;  2LUP B;  3RMP A;  1JK2 A;  1XNQ E;  3HPZ A;  1FJG E;  4R2A A;  2CPN A;  5AE3 A;  1P47 A;  4F54 A;  4GEQ B;  3T1H E;  3H09 A;  1ZBT A;  1QU6 A;  3JU0 A;  3VYY A;  5DNY A;  4LF9 E;  2MDG A;  3EPL A;  3BBG A;  4X8W A;  5KL4 A;  4TUG A;  3IWD A;  2ZM6 E;  1PKP A;  3M99 B;  1YYK A;  5LMU E;  2UUA E;  1UN6 B;  2K4V A;  4AQY E;  1RQ0 A;  2N8X A;  2JOX A;  1A1G A;  1YUJ A;  1N36 E;  4IS1 C;  2YTG A;  2EN3 A;  3AUZ A;  2EMX A;  1PDA A;  2JWO A;  1TF3 A;  2ODR D;  2N3G A;  2UXC E;  4JI5 E;  4BC9 A;  5A6A A;  2EMF A;  2VQE E;  2H36 X;  2EMC A;  2EPU A;  2KOU A;  5A6B D;  5CFF E;  4O43 A;  2NUG A;  1BB8 A;  3F6H A;  2WBT A;  2B3T B;  4KWY A;  1AH5 A;  2WBS A;  3C6K A;  3J7Y p;  4MLV A;  2VQF E;  4X66 E;  2YTF A;  2EOO A;  5KL2 A;  4P78 A;  4R2C A;  3EQ1 A;  2EN8 A;  4DR3 E;  1ZU1 A;  2B7V A;  2EMA A;  2EPM X;  2EMB A;  5KL3 A;  2DRP A;  4JI0 E;  4BHC A;  5A69 A;  4Q28 A;  4KZS A;  2JR1 A;  4R03 A;  1ZR9 A;  2UXB E;  4K0K E;  5FLX C;  2V89 A;  4LF8 E;  5AE1 A;  1PJS A;  2LV2 A;  3C4B A;  4LTY A;  3BGH A;  2CSH A;  3MSW A;  4DR4 E;  4R2R A;  2L2K B;  2J7J A;  2LO3 A;  4WYQ B;  1GZ6 A;  4YHH E;  1X49 A;  2GHF A;  1HR0 E;  4LU9 A;  1STU A;  2ADR A;  1JK1 A;  2NA2 A;  4R2S A;  5A6K A;  4GKJ E;  2NUF A;  2LCE A;  4HEI A;  2HGH A;  2EWL A;  4WSG A;  2EPZ A;  3OML A;  2ENC A;  3TQM A;  2EM4 A;  4DUY E;  2V8Q B;  2KON A;  2YTJ A;  2YTE A;  2EOZ A;  1YFH A;  4JI1 E;  2EM0 A;  2YTN A;  2L2N A;  1T4O A;  1HNX E;  4ZYD A;  2DGC A; 
#chains in the Genus database with same CATH homology
 4RH8 A;  5TSE A;  2R76 A;  5IV8 B;  3BF2 A;  2N8X A;  4Q35 B;  4NHR A;  4RHB B;  4N4R B;  2JXP A;  4KWY A;  5IXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...