5IV8B

The lps transporter lptde from klebsiella pneumoniae, core complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
146
Chain Sequence
GWHLRVPTTMKTMILQSSDPNGPLSRAVRNQLRLNGVDLIDASTLRKDVPSLRLDGSSIQKDTASVFQDGRTAEYQMVMTVHASVLIPGHDIYPITTKVYRSFFDNPQAALAKDAEQDMIIQEMYDKAAEQLIRKLPSVQVADVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the LPS Transporter LptDE from Gram-Negative Pathogens.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
molecule keywords LPS biosynthesis protein
total genus 37
structure length 146
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5iv8B00
4KWYA 2N8XA 4N4RB 5TSEA 3BF2A 2JXPA 4RH8A 5IXMB 4NHRA 4Q35B 4RHBB 2R76A 5IV8B
chains in the Genus database with same CATH superfamily
5KL6A 2CT1A 2DSYA 1T4LB 2KONA 4Q35B 4BHBA 4LF4E 3ZOQB 1X6HA 3AV0A 2EN7A 4LF8E 2N3GA 2RQLA 2EM5A 2EOEA 2EOMA 2K4VA 4MLQA 2EM2A 1WHQA 4P78A 1Z1BA 4IJDA 2NUGA 1WRJA 1A1KA 5KL2A 2FTXB 2VRDA 2EPZA 4M30A 2EN3A 1ZR9A 2EMZA 2LUPB 4B3TE 1T39A 4R2RA 4ZYHA 2BBGA 4LF7E 1ZBQA 4BCAA 1O0WA 4WX9A 1LLMC 3P1XA 1IMUA 3F6GA 1J26A 2WCC3 2L33A 3JAMC 2Q8UA 2PRTA 2EPMX 3KZZA 2NABA 1STUA 2YPNA 4P7DA 2E72A 2B7TA 4YY3E 1UBDC 2YTJA 4L8NA 5KL3A 2L2NA 5A6BA 3ECRA 1TF3A 2B7VA 4DV1E 2J7JA 2V89A 3BBGA 2L92A 4OX9E 2N3HA 2DIXA 1MGTA 2I13A 4JI8E 2EE8A 2YZTA 1SR9A 2GHFA 2L8TA 4ZYDA 4WYQB 4ZYEA 4X62E 5A69A 2LO3A 2G7HA 2LTRA 3J7AG 3ADGA 4DR3E 4HEIA 1XMQE 4LFAE 2WBUA 3THNA 4WPYA 4DR2E 4GKJE 2EPRA 5AE1A 2VQEE 2ODRD 1YPNA 1HNZE 2JOBA 2YTNA 3EPKA 1N34E 5DNYA 2EPPA 5FLXC 1RC7A 3J80C 4RHBB 3IWDA 4LFCE 2L3CA 4F9CB 2VF1A 3TQMA 2FV4B 1IQSA 1RMDA 4R03A 2V86A 4F9BB 4K0KE 1T38A 2EP3A 2YTFA 3AUZA 2JYAA 1X6FA 5LLQA 2LV2A 4M9VC 1GZ6A 3J81C 1ZU1A 3F6HA 2YU5A 3KWRA 4DKKA 2NUEA 5AASA 2LJUA 4JI4E 2M7QA 1G2FC 2EN2A 3EPHA 2DLKA 1J5EE 1X6EA 4LF6E 2EMHA 3DF6A 2EM7A 2YWQA 4L5NC 2MC6A 5A6BD 4KHPE 2LTSA 2EMCA 2YSOA 4WSPA 4R2CA 2CPNA 4FK5C 2EOZA 1XNRE 3EPJA 2EMXA 2F4VE 2NUFA 3VYXA 1QNTA 1HR0E 2EJ4A 5A6AA 2UU9E 2YT4A 2EQ1A 3BF2A 4LF9E 1UHZA 1YUIA 2LJHA 2EM3A 4JI6E 2EL6A 2ENHA 2EOYA 1BB8A 4DUZE 2M9AA 3THOB 2RSMA 2WZOA 5ADZA 2EMYA 1UN6B 2DB2A 4LF5E 2EPKX 2EM9A 4JI0E 2EL5A 1MEYC 3C6MA 1DI2A 2JR1A 2DGCA 2EN6A 2EOIA 3HQ1A 1AAYA 4WXDA 4R2QA 4JV5E 4M2ZA 2EOSA 5IT9C 1A1FA 3MHHC 1A1IA 2L3JA 2IHR1 2ELYA 4R2SA 5TSEA 2ELZA 1A1GA 2EPOA 2B3TB 2YTIA 4MLVA 2HGHA 1N36E 1SFEA 2K7IA 1I94E 2GPIA 2M1SA 2JWOA 2R1FA 1N33E 2EPCA 4WFTA 2FGGA 2RS6A 2HHHE 4F54A 5F3WA 1XMOE 2EN8A 4NXME 2DLQA 3T1YE 2EL4A 1G2DC 2ADRA 2E1MA 2MDGA 3ADIA 1NEIA 2ZM6E 2DRPA 2JP9A 2YU8A 1PKPA 4DR7E 3BIDA 1GQEA 2UUAE 4AQYE 4IS1C 1F2IG 1X5WA 3OMLA 2N8XA 4R2AA 2LCEA 3HXLA 1N32E 1A1LA 2DMIA 4B3ME 3FIGA 4X9JA 2KOUA 1RQ0A 4YHHE 5AE2A 1A1JA 3EQ1A 2EM0A 3K6QA 2EQ0A 3VHTB 4F6NA 2EM4A 4JI1E 1WHNA 3JTZA 3ADJA 3LMLA 4GEQB 3J7Yp 2EPAA 3HPZA 2V83A 2UXDE 1PJQA 2DMYA 2M4IA 2EOFA 3T1HE 2LE2A 4WSGA 2VE7C 4J8ZA 2YSPA 4N4RB 4R2EA 5BR8E 1T4OA 3L00A 1ZBTA 3JU0A 2RPCA 4O43A 4F6MA 1AH5A 1PJSA 4F9AB 4JI7E 1TF6A 2EWLA 2JPAA 4BHCA 2YTDA 4JI3E 2L2KB 2YTPA 4ZYGA 5IWAE 4X65E 4OOGC 3LLHA 4LTYA 1EH7A 2UUCE 1XNQE 1NCSA 4I8OA 4DV4E 1QU6A 2LVHA 2YRMA 4O5GA 2GLIA 2KHXA 2HC5A 4TUGA 2CTDA 1YFHA 5AC5A 2ODRC 3C4TA 4DR4E 4DV2E 2CSHA 4R2DA 1HNWE 3IWCA 4WXCA 4NXNE 2B9DA 4BC7A 2HJJA 4DR5E 2WBTA 1IBKE 2EMIA 3QG5C 4BMJA 4KWYA 2EPXA 1EH6A 1YYKA 5IV8B 2EMLA 2EZ6A 4X66E 2EOJA 5A2QC 2WBSA 2EMAA 1BBOA 2UUBE 3UK3C 4Q28A 2LBSB 4M0VA 1UILA 4DV0E 4DUYE 2EQ3A 2RS7A 2LRSA 3C4BA 2MDRA 1IBLE 1HNXE 4DV6E 1PDAA 2RTXA 3ADLA 1YYWA 3VK6A 2ENAA 4JYAE 4BS9A 4NHRA 2EOQA 3VYYA 5CFFE 4O4KA 5KL4A 1IQOA 2EMGA 5AE3A 4X64E 1FJGE 2UXBE 4R8OA 2NA2A 2A25A 2V85A 4RH8A 4F2JC 4O24A 1WJPA 2YRHA 5LMNE 3BGHA 2EM8A 2MKNA 1FKAE 2V88A 5LMUE 3EPLA 2LMZA 1P47A 2LT7A 3IWBA 1YZ9A 1DQ3A 1PJTA 2BB8A 1YUJA 4DMIA 5AC4A 1GTKA 2EN4A 2EOOA 2LUQA 2D9HA 1EH8A 4BBYA 4HTGA 5KL7A 2E5LE 1B69A 5T6JA 5A6JA 2F8BA 1TN9A 2RSIA 4DV3E 2JXPA 1KJKA 2MC5A 5IXMB 1L4SA 1IBME 2EMWA 2JVAA 2EMBA 4KZSA 4DV7E 3DJWA 2JOXA 1BBGA 2EORA 2H36X 2EPLX 2L2MA 2MKDA 5KL5A 3RMPA 1KYQA 4JI5E 1WXRA 1YSAC 2YTOA 3MSWA 2EN1A 2VQFE 4DR6E 2YTQA 5A6KA 4X8WA 4GKKE 2EPNA 3H09A 2EMFA 1EKZA 1ZAAC 1X49A 2L6MA 4JI2E 2EMKA 4NZVA 4DR1E 4GZNC 1JK1A 3MHSC 2V8QB 2EM6A 2EOHA 1X48A 1A1HA 2EOXA 3HPSA 1X47A 4LFBE 3C6KA 2I9IA 2JY9A 4DV5E 3KZYA 3HTXA 5LL6R 2UXCE 4B3SE 3M99B 2R76A 4LU9A 4R2PA 1N3GA 2ENCA 1JK2A 4TUIA 3OTOE 1T4NA 2YTEA 1DGCA 4B3RE 2EPUA 2V87A 2YTGA 4BC9A 1YYOA 1X3CA 2YRKA
chains in the Genus database with same CATH topology
4KWYA 2N8XA 4N4RB 5TSEA 3BF2A 2JXPA 4RH8A 5IXMB 4NHRA 4Q35B 4RHBB 2R76A 5IV8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KWY A;  2N8X A;  4N4R B;  5TSE A;  3BF2 A;  2JXP A;  4RH8 A;  5IXM B;  4NHR A;  4Q35 B;  4RHB B;  2R76 A;  5IV8 B; 
#chains in the Genus database with same CATH topology
 5KL6 A;  2CT1 A;  2DSY A;  1T4L B;  2KON A;  4Q35 B;  4BHB A;  4LF4 E;  3ZOQ B;  1X6H A;  3AV0 A;  2EN7 A;  4LF8 E;  2N3G A;  2RQL A;  2EM5 A;  2EOE A;  2EOM A;  2K4V A;  4MLQ A;  2EM2 A;  1WHQ A;  4P78 A;  1Z1B A;  4IJD A;  2NUG A;  1WRJ A;  1A1K A;  5KL2 A;  2FTX B;  2VRD A;  2EPZ A;  4M30 A;  2EN3 A;  1ZR9 A;  2EMZ A;  2LUP B;  4B3T E;  1T39 A;  4R2R A;  4ZYH A;  2BBG A;  4LF7 E;  1ZBQ A;  4BCA A;  1O0W A;  4WX9 A;  1LLM C;  3P1X A;  1IMU A;  3F6G A;  1J26 A;  2WCC 3;  2L33 A;  3JAM C;  2Q8U A;  2PRT A;  2EPM X;  3KZZ A;  2NAB A;  1STU A;  2YPN A;  4P7D A;  2E72 A;  2B7T A;  4YY3 E;  1UBD C;  2YTJ A;  4L8N A;  5KL3 A;  2L2N A;  5A6B A;  3ECR A;  1TF3 A;  2B7V A;  4DV1 E;  2J7J A;  2V89 A;  3BBG A;  2L92 A;  4OX9 E;  2N3H A;  2DIX A;  1MGT A;  2I13 A;  4JI8 E;  2EE8 A;  2YZT A;  1SR9 A;  2GHF A;  2L8T A;  4ZYD A;  4WYQ B;  4ZYE A;  4X62 E;  5A69 A;  2LO3 A;  2G7H A;  2LTR A;  3J7A G;  3ADG A;  4DR3 E;  4HEI A;  1XMQ E;  4LFA E;  2WBU A;  3THN A;  4WPY A;  4DR2 E;  4GKJ E;  2EPR A;  5AE1 A;  2VQE E;  2ODR D;  1YPN A;  1HNZ E;  2JOB A;  2YTN A;  3EPK A;  1N34 E;  5DNY A;  2EPP A;  5FLX C;  1RC7 A;  3J80 C;  4RHB B;  3IWD A;  4LFC E;  2L3C A;  4F9C B;  2VF1 A;  3TQM A;  2FV4 B;  1IQS A;  1RMD A;  4R03 A;  2V86 A;  4F9B B;  4K0K E;  1T38 A;  2EP3 A;  2YTF A;  3AUZ A;  2JYA A;  1X6F A;  5LLQ A;  2LV2 A;  4M9V C;  1GZ6 A;  3J81 C;  1ZU1 A;  3F6H A;  2YU5 A;  3KWR A;  4DKK A;  2NUE A;  5AAS A;  2LJU A;  4JI4 E;  2M7Q A;  1G2F C;  2EN2 A;  3EPH A;  2DLK A;  1J5E E;  1X6E A;  4LF6 E;  2EMH A;  3DF6 A;  2EM7 A;  2YWQ A;  4L5N C;  2MC6 A;  5A6B D;  4KHP E;  2LTS A;  2EMC A;  2YSO A;  4WSP A;  4R2C A;  2CPN A;  4FK5 C;  2EOZ A;  1XNR E;  3EPJ A;  2EMX A;  2F4V E;  2NUF A;  3VYX A;  1QNT A;  1HR0 E;  2EJ4 A;  5A6A A;  2UU9 E;  2YT4 A;  2EQ1 A;  3BF2 A;  4LF9 E;  1UHZ A;  1YUI A;  2LJH A;  2EM3 A;  4JI6 E;  2EL6 A;  2ENH A;  2EOY A;  1BB8 A;  4DUZ E;  2M9A A;  3THO B;  2RSM A;  2WZO A;  5ADZ A;  2EMY A;  1UN6 B;  2DB2 A;  4LF5 E;  2EPK X;  2EM9 A;  4JI0 E;  2EL5 A;  1MEY C;  3C6M A;  1DI2 A;  2JR1 A;  2DGC A;  2EN6 A;  2EOI A;  3HQ1 A;  1AAY A;  4WXD A;  4R2Q A;  4JV5 E;  4M2Z A;  2EOS A;  5IT9 C;  1A1F A;  3MHH C;  1A1I A;  2L3J A;  2IHR 1;  2ELY A;  4R2S A;  5TSE A;  2ELZ A;  1A1G A;  2EPO A;  2B3T B;  2YTI A;  4MLV A;  2HGH A;  1N36 E;  1SFE A;  2K7I A;  1I94 E;  2GPI A;  2M1S A;  2JWO A;  2R1F A;  1N33 E;  2EPC A;  4WFT A;  2FGG A;  2RS6 A;  2HHH E;  4F54 A;  5F3W A;  1XMO E;  2EN8 A;  4NXM E;  2DLQ A;  3T1Y E;  2EL4 A;  1G2D C;  2ADR A;  2E1M A;  2MDG A;  3ADI A;  1NEI A;  2ZM6 E;  2DRP A;  2JP9 A;  2YU8 A;  1PKP A;  4DR7 E;  3BID A;  1GQE A;  2UUA E;  4AQY E;  4IS1 C;  1F2I G;  1X5W A;  3OML A;  2N8X A;  4R2A A;  2LCE A;  3HXL A;  1N32 E;  1A1L A;  2DMI A;  4B3M E;  3FIG A;  4X9J A;  2KOU A;  1RQ0 A;  4YHH E;  5AE2 A;  1A1J A;  3EQ1 A;  2EM0 A;  3K6Q A;  2EQ0 A;  3VHT B;  4F6N A;  2EM4 A;  4JI1 E;  1WHN A;  3JTZ A;  3ADJ A;  3LML A;  4GEQ B;  3J7Y p;  2EPA A;  3HPZ A;  2V83 A;  2UXD E;  1PJQ A;  2DMY A;  2M4I A;  2EOF A;  3T1H E;  2LE2 A;  4WSG A;  2VE7 C;  4J8Z A;  2YSP A;  4N4R B;  4R2E A;  5BR8 E;  1T4O A;  3L00 A;  1ZBT A;  3JU0 A;  2RPC A;  4O43 A;  4F6M A;  1AH5 A;  1PJS A;  4F9A B;  4JI7 E;  1TF6 A;  2EWL A;  2JPA A;  4BHC A;  2YTD A;  4JI3 E;  2L2K B;  2YTP A;  4ZYG A;  5IWA E;  4X65 E;  4OOG C;  3LLH A;  4LTY A;  1EH7 A;  2UUC E;  1XNQ E;  1NCS A;  4I8O A;  4DV4 E;  1QU6 A;  2LVH A;  2YRM A;  4O5G A;  2GLI A;  2KHX A;  2HC5 A;  4TUG A;  2CTD A;  1YFH A;  5AC5 A;  2ODR C;  3C4T A;  4DR4 E;  4DV2 E;  2CSH A;  4R2D A;  1HNW E;  3IWC A;  4WXC A;  4NXN E;  2B9D A;  4BC7 A;  2HJJ A;  4DR5 E;  2WBT A;  1IBK E;  2EMI A;  3QG5 C;  4BMJ A;  4KWY A;  2EPX A;  1EH6 A;  1YYK A;  5IV8 B;  2EML A;  2EZ6 A;  4X66 E;  2EOJ A;  5A2Q C;  2WBS A;  2EMA A;  1BBO A;  2UUB E;  3UK3 C;  4Q28 A;  2LBS B;  4M0V A;  1UIL A;  4DV0 E;  4DUY E;  2EQ3 A;  2RS7 A;  2LRS A;  3C4B A;  2MDR A;  1IBL E;  1HNX E;  4DV6 E;  1PDA A;  2RTX A;  3ADL A;  1YYW A;  3VK6 A;  2ENA A;  4JYA E;  4BS9 A;  4NHR A;  2EOQ A;  3VYY A;  5CFF E;  4O4K A;  5KL4 A;  1IQO A;  2EMG A;  5AE3 A;  4X64 E;  1FJG E;  2UXB E;  4R8O A;  2NA2 A;  2A25 A;  2V85 A;  4RH8 A;  4F2J C;  4O24 A;  1WJP A;  2YRH A;  5LMN E;  3BGH A;  2EM8 A;  2MKN A;  1FKA E;  2V88 A;  5LMU E;  3EPL A;  2LMZ A;  1P47 A;  2LT7 A;  3IWB A;  1YZ9 A;  1DQ3 A;  1PJT A;  2BB8 A;  1YUJ A;  4DMI A;  5AC4 A;  1GTK A;  2EN4 A;  2EOO A;  2LUQ A;  2D9H A;  1EH8 A;  4BBY A;  4HTG A;  5KL7 A;  2E5L E;  1B69 A;  5T6J A;  5A6J A;  2F8B A;  1TN9 A;  2RSI A;  4DV3 E;  2JXP A;  1KJK A;  2MC5 A;  5IXM B;  1L4S A;  1IBM E;  2EMW A;  2JVA A;  2EMB A;  4KZS A;  4DV7 E;  3DJW A;  2JOX A;  1BBG A;  2EOR A;  2H36 X;  2EPL X;  2L2M A;  2MKD A;  5KL5 A;  3RMP A;  1KYQ A;  4JI5 E;  1WXR A;  1YSA C;  2YTO A;  3MSW A;  2EN1 A;  2VQF E;  4DR6 E;  2YTQ A;  5A6K A;  4X8W A;  4GKK E;  2EPN A;  3H09 A;  2EMF A;  1EKZ A;  1ZAA C;  1X49 A;  2L6M A;  4JI2 E;  2EMK A;  4NZV A;  4DR1 E;  4GZN C;  1JK1 A;  3MHS C;  2V8Q B;  2EM6 A;  2EOH A;  1X48 A;  1A1H A;  2EOX A;  3HPS A;  1X47 A;  4LFB E;  3C6K A;  2I9I A;  2JY9 A;  4DV5 E;  3KZY A;  3HTX A;  5LL6 R;  2UXC E;  4B3S E;  3M99 B;  2R76 A;  4LU9 A;  4R2P A;  1N3G A;  2ENC A;  1JK2 A;  4TUI A;  3OTO E;  1T4N A;  2YTE A;  1DGC A;  4B3R E;  2EPU A;  2V87 A;  2YTG A;  4BC9 A;  1YYO A;  1X3C A;  2YRK A; 
#chains in the Genus database with same CATH homology
 4KWY A;  2N8X A;  4N4R B;  5TSE A;  3BF2 A;  2JXP A;  4RH8 A;  5IXM B;  4NHR A;  4Q35 B;  4RHB B;  2R76 A;  5IV8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...