5IV8B

The lps transporter lptde from klebsiella pneumoniae, core complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
146
Chain Sequence
GWHLRVPTTMKTMILQSSDPNGPLSRAVRNQLRLNGVDLIDASTLRKDVPSLRLDGSSIQKDTASVFQDGRTAEYQMVMTVHASVLIPGHDIYPITTKVYRSFFDNPQAALAKDAEQDMIIQEMYDKAAEQLIRKLPSVQVADVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS biosynthesis protein
publication title Structural and Functional Characterization of the LPS Transporter LptDE from Gram-Negative Pathogens.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transport protein
total genus 37
structure length 146
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5iv8B00
3BF2A 4RHBB 5IXMB 4N4RB 2JXPA 4KWYA 4NHRA 4Q35B 2R76A 4RH8A 5TSEA 5IV8B 2N8XA
chains in the Genus database with same CATH superfamily
4X62E 3HXLA 1WXRA 1QNTA 2MC6A 4LTYA 1WHNA 4M9VC 3VHTB 2G7HA 1T4OA 2V85A 3C4BA 4F9AB 1J26A 1A1HA 2RPCA 2EM5A 1B69A 2JOXA 3VYYA 5ADZA 1NEIA 4DMIA 1XNQE 5KL3A 4JI8E 4JYAE 1ZAAC 2EQ3A 4BCAA 4DV6E 5A6AA 2HC5A 4GKKE 1BBGA 2YT4A 2JWOA 3VYXA 4WXCA 1FKAE 2EM0A 4NHRA 2YTGA 2UU9E 4P78A 3FIGA 2M9AA 2LJUA 2YPNA 4DR4E 2EMGA 3RMPA 4LF5E 1A1JA 4WSGA 2M1SA 4R2SA 4WPYA 4HEIA 1PKPA 2EOEA 2YTEA 1N3GA 5T6JA 2DMIA 3HQ1A 3KZZA 2LBSB 4IS1C 2RS6A 2MKDA 3DF6A 2GPIA 4MLVA 1T4NA 2EM3A 2DLQA 3LMLA 4ZYEA 5KL7A 1YZ9A 2YTIA 2NABA 2YU5A 1HR0E 2L6MA 2I13A 1F2IG 4LFBE 1ZBTA 2HJJA 2JR1A 3HPZA 2N3HA 3VK6A 4R2DA 5AASA 4DV5E 1YPNA 4HTGA 1UBDC 2ADRA 5A6BA 2F4VE 1WJPA 2MDGA 4DV7E 2UXDE 1X47A 2A25A 3EPKA 1NCSA 5IT9C 2WBSA 4X65E 3AUZA 1N36E 1XMQE 2EPAA 1TN9A 4O5GA 1PJSA 4M30A 2V88A 3J80C 2MKNA 5TSEA 2DMYA 1AAYA 2EMHA 5AC5A 4X64E 1EH6A 2BB8A 4P7DA 2E72A 5LMNE 2R76A 2M7QA 2VF1A 4BC9A 4YY3E 3OMLA 4X9JA 2YTPA 3BF2A 4R2CA 2B3TB 4BS9A 2CT1A 2EOFA 2EPLX 2KOUA 4LF7E 2ODRC 4GEQB 2EZ6A 1L4SA 1PJTA 3LLHA 1IBKE 1G2DC 4RHBB 2EQ0A 4N4RB 2EE8A 3M99B 4DR3E 2EMWA 3AV0A 2EMZA 1YYWA 2EPKX 2LMZA 2VQFE 2UUAE 3OTOE 4JI3E 2NUGA 4WX9A 1IQSA 2JP9A 1PDAA 2EORA 2IHR1 4F54A 5AE1A 3JAMC 2LE2A 2LUPB 4GKJE 2L2MA 2ENAA 4LFCE 1TF6A 4R2AA 3J7AG 2B7VA 2E1MA 2LJHA 2EPRA 1YYOA 2EMBA 2EOXA 2ELZA 1GZ6A 4NXNE 1MEYC 1A1FA 1X48A 2HHHE 1PJQA 2V8QB 2YTNA 1JK2A 4JI2E 2DSYA 1WHQA 2YTDA 4R03A 1KJKA 5IXMB 1ZR9A 2EN8A 2EOMA 2EOHA 2DGCA 2GHFA 2N3GA 2EOIA 4TUIA 4KZSA 2YSOA 4DV2E 3T1YE 4F9CB 4ZYDA 4R2EA 4DV0E 2EM9A 3QG5C 2V83A 4JV5E 3MSWA 4LFAE 2LT7A 2GLIA 3C6KA 2RTXA 3C6MA 5A6KA 4DKKA 4LF8E 4X66E 1XMOE 5FLXC 2L2NA 2EM6A 1XNRE 2DRPA 2EOOA 1J5EE 2LCEA 2V89A 3IWBA 1SFEA 2DIXA 5AE3A 2EMCA 2PRTA 2F8BA 2EPNA 1YFHA 1SR9A 4AQYE 2VRDA 2LUQA 4DR7E 4RH8A 4ZYHA 1TF3A 4LU9A 5A69A 2EN7A 2LVHA 2RS7A 1HNXE 1STUA 2NUEA 2YRMA 1YUIA 2E5LE 2EOZA 4M0VA 4DR2E 3EPHA 2K7IA 5IWAE 2YTOA 1GQEA 1IQOA 1ZBQA 4JI4E 4O4KA 2EMAA 1RQ0A 2D9HA 4MLQA 3ADIA 4GZNC 5CFFE 4WSPA 2B9DA 2EM4A 1X5WA 2N8XA 1G2FC 3HTXA 4ZYGA 2L3CA 5LL6R 4BHCA 1BB8A 2EN1A 4NZVA 2CPNA 1A1KA 4R2QA 2K4VA 2EMXA 2JOBA 1IBME 2WZOA 2EOQA 2EM7A 2HGHA 2RSIA 2V87A 4F2JC 4WYQB 2WCC3 3ADJA 2ELYA 1YUJA 3C4TA 4M2ZA 2WBUA 3EQ1A 2KONA 4O24A 3L00A 2CTDA 2NA2A 2DB2A 2JVAA 2EP3A 2NUFA 3EPLA 2ZM6E 4BMJA 5KL4A 1JK1A 2LRSA 5A6JA 4L8NA 2FGGA 4B3RE 5KL6A 2CSHA 4BBYA 2L8TA 2EN3A 2EMYA 2JPAA 2EPZA 3K6QA 1T4LB 1RMDA 4WFTA 3MHHC 2JY9A 4JI6E 2LO3A 1X3CA 4DV3E 1P47A 2I9IA 1I94E 2KHXA 3IWCA 2UUBE 4X8WA 2EWLA 1IMUA 4KWYA 5A2QC 2EL5A 2V86A 3F6GA 1HNWE 1YSAC 2LV2A 2UXCE 4B3ME 5LMUE 1UN6B 4R2PA 3P1XA 4Q28A 3BGHA 1X6FA 2EN6A 2J7JA 1LLMC 2L33A 4WXDA 1A1GA 2EM2A 5KL2A 1AH5A 2L3JA 2FTXB 2EPUA 2ODRD 4J8ZA 4DUYE 2EL6A 1FJGE 1N33E 2EN4A 2YTJA 4JI5E 2YTFA 2EOYA 3JTZA 2MC5A 2JXPA 2YTQA 4JI1E 1A1IA 4NXME 4B3SE 3F6HA 1KYQA 4IJDA 4BHBA 4YHHE 1RC7A 2RSMA 4DUZE 2VQEE 2EPPA 4Q35B 4B3TE 4KHPE 1EKZA 2M4IA 3THOB 3UK3C 1Z1BA 1GTKA 2YZTA 2UUCE 2EMFA 1T39A 5DNYA 4L5NC 1T38A 3ECRA 3KWRA 3JU0A 2VE7C 2ENHA 2RQLA 5IV8B 1O0WA 4DV4E 4F9BB 4LF4E 4DR6E 2EMLA 4JI0E 2EPXA 5BR8E 1DQ3A 2EOJA 4F6NA 3J7Yp 5AE2A 2R1FA 3BIDA 2UXBE 4DR5E 3ADLA 2EQ1A 2MDRA 3ADGA 4FK5C 2H36X 3T1HE 1WRJA 1HNZE 2EMKA 3TQMA 2LTRA 2EPOA 3H09A 1UHZA 4R2RA 2YRHA 3HPSA 5AC4A 4F6MA 1UILA 2EOSA 2BBGA 2LTSA 1DI2A 2EPCA 2YSPA 2YU8A 2EJ4A 2EMIA 4JI7E 1X6HA 2EL4A 2FV4B 2WBTA 5A6BD 2EN2A 3DJWA 1N32E 2L2KB 5LLQA 1YYKA 1EH7A 3EPJA 1A1LA 2DLKA 1DGCA 4K0KE 4OX9E 4LF9E 1BBOA 2YWQA 4R8OA 2Q8UA 3BBGA 2EM8A 3J81C 4O43A 2YRKA 2L92A 4DR1E 3MHSC 1N34E 4BC7A 1X49A 1MGTA 4DV1E 2EPMX 4TUGA 1EH8A 2ENCA 5KL5A 2JYAA 3ZOQB 5F3WA 3IWDA 4LF6E 4OOGC 3THNA 1QU6A 2B7TA 1ZU1A 3KZYA 4I8OA 1IBLE 1X6EA
chains in the Genus database with same CATH topology
3BF2A 4RHBB 5IXMB 4N4RB 2JXPA 4KWYA 4NHRA 4Q35B 2R76A 4RH8A 5TSEA 5IV8B 2N8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF2 A;  4RHB B;  5IXM B;  4N4R B;  2JXP A;  4KWY A;  4NHR A;  4Q35 B;  2R76 A;  4RH8 A;  5TSE A;  5IV8 B;  2N8X A; 
#chains in the Genus database with same CATH topology
 4X62 E;  3HXL A;  1WXR A;  1QNT A;  2MC6 A;  4LTY A;  1WHN A;  4M9V C;  3VHT B;  2G7H A;  1T4O A;  2V85 A;  3C4B A;  4F9A B;  1J26 A;  1A1H A;  2RPC A;  2EM5 A;  1B69 A;  2JOX A;  3VYY A;  5ADZ A;  1NEI A;  4DMI A;  1XNQ E;  5KL3 A;  4JI8 E;  4JYA E;  1ZAA C;  2EQ3 A;  4BCA A;  4DV6 E;  5A6A A;  2HC5 A;  4GKK E;  1BBG A;  2YT4 A;  2JWO A;  3VYX A;  4WXC A;  1FKA E;  2EM0 A;  4NHR A;  2YTG A;  2UU9 E;  4P78 A;  3FIG A;  2M9A A;  2LJU A;  2YPN A;  4DR4 E;  2EMG A;  3RMP A;  4LF5 E;  1A1J A;  4WSG A;  2M1S A;  4R2S A;  4WPY A;  4HEI A;  1PKP A;  2EOE A;  2YTE A;  1N3G A;  5T6J A;  2DMI A;  3HQ1 A;  3KZZ A;  2LBS B;  4IS1 C;  2RS6 A;  2MKD A;  3DF6 A;  2GPI A;  4MLV A;  1T4N A;  2EM3 A;  2DLQ A;  3LML A;  4ZYE A;  5KL7 A;  1YZ9 A;  2YTI A;  2NAB A;  2YU5 A;  1HR0 E;  2L6M A;  2I13 A;  1F2I G;  4LFB E;  1ZBT A;  2HJJ A;  2JR1 A;  3HPZ A;  2N3H A;  3VK6 A;  4R2D A;  5AAS A;  4DV5 E;  1YPN A;  4HTG A;  1UBD C;  2ADR A;  5A6B A;  2F4V E;  1WJP A;  2MDG A;  4DV7 E;  2UXD E;  1X47 A;  2A25 A;  3EPK A;  1NCS A;  5IT9 C;  2WBS A;  4X65 E;  3AUZ A;  1N36 E;  1XMQ E;  2EPA A;  1TN9 A;  4O5G A;  1PJS A;  4M30 A;  2V88 A;  3J80 C;  2MKN A;  5TSE A;  2DMY A;  1AAY A;  2EMH A;  5AC5 A;  4X64 E;  1EH6 A;  2BB8 A;  4P7D A;  2E72 A;  5LMN E;  2R76 A;  2M7Q A;  2VF1 A;  4BC9 A;  4YY3 E;  3OML A;  4X9J A;  2YTP A;  3BF2 A;  4R2C A;  2B3T B;  4BS9 A;  2CT1 A;  2EOF A;  2EPL X;  2KOU A;  4LF7 E;  2ODR C;  4GEQ B;  2EZ6 A;  1L4S A;  1PJT A;  3LLH A;  1IBK E;  1G2D C;  4RHB B;  2EQ0 A;  4N4R B;  2EE8 A;  3M99 B;  4DR3 E;  2EMW A;  3AV0 A;  2EMZ A;  1YYW A;  2EPK X;  2LMZ A;  2VQF E;  2UUA E;  3OTO E;  4JI3 E;  2NUG A;  4WX9 A;  1IQS A;  2JP9 A;  1PDA A;  2EOR A;  2IHR 1;  4F54 A;  5AE1 A;  3JAM C;  2LE2 A;  2LUP B;  4GKJ E;  2L2M A;  2ENA A;  4LFC E;  1TF6 A;  4R2A A;  3J7A G;  2B7V A;  2E1M A;  2LJH A;  2EPR A;  1YYO A;  2EMB A;  2EOX A;  2ELZ A;  1GZ6 A;  4NXN E;  1MEY C;  1A1F A;  1X48 A;  2HHH E;  1PJQ A;  2V8Q B;  2YTN A;  1JK2 A;  4JI2 E;  2DSY A;  1WHQ A;  2YTD A;  4R03 A;  1KJK A;  5IXM B;  1ZR9 A;  2EN8 A;  2EOM A;  2EOH A;  2DGC A;  2GHF A;  2N3G A;  2EOI A;  4TUI A;  4KZS A;  2YSO A;  4DV2 E;  3T1Y E;  4F9C B;  4ZYD A;  4R2E A;  4DV0 E;  2EM9 A;  3QG5 C;  2V83 A;  4JV5 E;  3MSW A;  4LFA E;  2LT7 A;  2GLI A;  3C6K A;  2RTX A;  3C6M A;  5A6K A;  4DKK A;  4LF8 E;  4X66 E;  1XMO E;  5FLX C;  2L2N A;  2EM6 A;  1XNR E;  2DRP A;  2EOO A;  1J5E E;  2LCE A;  2V89 A;  3IWB A;  1SFE A;  2DIX A;  5AE3 A;  2EMC A;  2PRT A;  2F8B A;  2EPN A;  1YFH A;  1SR9 A;  4AQY E;  2VRD A;  2LUQ A;  4DR7 E;  4RH8 A;  4ZYH A;  1TF3 A;  4LU9 A;  5A69 A;  2EN7 A;  2LVH A;  2RS7 A;  1HNX E;  1STU A;  2NUE A;  2YRM A;  1YUI A;  2E5L E;  2EOZ A;  4M0V A;  4DR2 E;  3EPH A;  2K7I A;  5IWA E;  2YTO A;  1GQE A;  1IQO A;  1ZBQ A;  4JI4 E;  4O4K A;  2EMA A;  1RQ0 A;  2D9H A;  4MLQ A;  3ADI A;  4GZN C;  5CFF E;  4WSP A;  2B9D A;  2EM4 A;  1X5W A;  2N8X A;  1G2F C;  3HTX A;  4ZYG A;  2L3C A;  5LL6 R;  4BHC A;  1BB8 A;  2EN1 A;  4NZV A;  2CPN A;  1A1K A;  4R2Q A;  2K4V A;  2EMX A;  2JOB A;  1IBM E;  2WZO A;  2EOQ A;  2EM7 A;  2HGH A;  2RSI A;  2V87 A;  4F2J C;  4WYQ B;  2WCC 3;  3ADJ A;  2ELY A;  1YUJ A;  3C4T A;  4M2Z A;  2WBU A;  3EQ1 A;  2KON A;  4O24 A;  3L00 A;  2CTD A;  2NA2 A;  2DB2 A;  2JVA A;  2EP3 A;  2NUF A;  3EPL A;  2ZM6 E;  4BMJ A;  5KL4 A;  1JK1 A;  2LRS A;  5A6J A;  4L8N A;  2FGG A;  4B3R E;  5KL6 A;  2CSH A;  4BBY A;  2L8T A;  2EN3 A;  2EMY A;  2JPA A;  2EPZ A;  3K6Q A;  1T4L B;  1RMD A;  4WFT A;  3MHH C;  2JY9 A;  4JI6 E;  2LO3 A;  1X3C A;  4DV3 E;  1P47 A;  2I9I A;  1I94 E;  2KHX A;  3IWC A;  2UUB E;  4X8W A;  2EWL A;  1IMU A;  4KWY A;  5A2Q C;  2EL5 A;  2V86 A;  3F6G A;  1HNW E;  1YSA C;  2LV2 A;  2UXC E;  4B3M E;  5LMU E;  1UN6 B;  4R2P A;  3P1X A;  4Q28 A;  3BGH A;  1X6F A;  2EN6 A;  2J7J A;  1LLM C;  2L33 A;  4WXD A;  1A1G A;  2EM2 A;  5KL2 A;  1AH5 A;  2L3J A;  2FTX B;  2EPU A;  2ODR D;  4J8Z A;  4DUY E;  2EL6 A;  1FJG E;  1N33 E;  2EN4 A;  2YTJ A;  4JI5 E;  2YTF A;  2EOY A;  3JTZ A;  2MC5 A;  2JXP A;  2YTQ A;  4JI1 E;  1A1I A;  4NXM E;  4B3S E;  3F6H A;  1KYQ A;  4IJD A;  4BHB A;  4YHH E;  1RC7 A;  2RSM A;  4DUZ E;  2VQE E;  2EPP A;  4Q35 B;  4B3T E;  4KHP E;  1EKZ A;  2M4I A;  3THO B;  3UK3 C;  1Z1B A;  1GTK A;  2YZT A;  2UUC E;  2EMF A;  1T39 A;  5DNY A;  4L5N C;  1T38 A;  3ECR A;  3KWR A;  3JU0 A;  2VE7 C;  2ENH A;  2RQL A;  5IV8 B;  1O0W A;  4DV4 E;  4F9B B;  4LF4 E;  4DR6 E;  2EML A;  4JI0 E;  2EPX A;  5BR8 E;  1DQ3 A;  2EOJ A;  4F6N A;  3J7Y p;  5AE2 A;  2R1F A;  3BID A;  2UXB E;  4DR5 E;  3ADL A;  2EQ1 A;  2MDR A;  3ADG A;  4FK5 C;  2H36 X;  3T1H E;  1WRJ A;  1HNZ E;  2EMK A;  3TQM A;  2LTR A;  2EPO A;  3H09 A;  1UHZ A;  4R2R A;  2YRH A;  3HPS A;  5AC4 A;  4F6M A;  1UIL A;  2EOS A;  2BBG A;  2LTS A;  1DI2 A;  2EPC A;  2YSP A;  2YU8 A;  2EJ4 A;  2EMI A;  4JI7 E;  1X6H A;  2EL4 A;  2FV4 B;  2WBT A;  5A6B D;  2EN2 A;  3DJW A;  1N32 E;  2L2K B;  5LLQ A;  1YYK A;  1EH7 A;  3EPJ A;  1A1L A;  2DLK A;  1DGC A;  4K0K E;  4OX9 E;  4LF9 E;  1BBO A;  2YWQ A;  4R8O A;  2Q8U A;  3BBG A;  2EM8 A;  3J81 C;  4O43 A;  2YRK A;  2L92 A;  4DR1 E;  3MHS C;  1N34 E;  4BC7 A;  1X49 A;  1MGT A;  4DV1 E;  2EPM X;  4TUG A;  1EH8 A;  2ENC A;  5KL5 A;  2JYA A;  3ZOQ B;  5F3W A;  3IWD A;  4LF6 E;  4OOG C;  3THN A;  1QU6 A;  2B7T A;  1ZU1 A;  3KZY A;  4I8O A;  1IBL E;  1X6E A; 
#chains in the Genus database with same CATH homology
 3BF2 A;  4RHB B;  5IXM B;  4N4R B;  2JXP A;  4KWY A;  4NHR A;  4Q35 B;  2R76 A;  4RH8 A;  5TSE A;  5IV8 B;  2N8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...