1EH6A

Human o6-alkylguanine-dna alkyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
177
structure length
168
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 168
sequence length 177
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh6A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh6A01
3KLOA 3ABUA 2WTEA 2O6GE 3HOSA 1V3FA 2EFWA 3OV8A 2PI0A 1O3QA 3FXQA 3R0AA 4HLXA 5IT9K 4CICA 1WSUA 4CO8A 3SXYA 3CDHA 4O6JA 3LA3A 3BP8A 4S04A 1D3YA 2BBYA 1OYWA 2DQRA 3F23A 4HLYA 2DLLA 1KGSA 1I27A 1STZA 4P96A 4UV8A 4OMZA 5KVRA 3L9FA 3F21A 4BAYA 2C6YA 3E5UA 3MEXA 3NQOA 5DCFA 4FHTA 2Q2EA 5CVUA 1HKSA 4KNYA 2FBIA 1CF7A 2RVCA 4R8HA 2AS5F 1MDMB 5CVJA 4HX7A 5DCMB 2DAOA 5FLXK 1FSHA 4AD9A 2MA3A 4UUVA 3FM5A 2M1BA 2STTA 3ABTA 5IT3A 1MD0A 4M72A 1USTA 1QBJA 2PJPA 3E5QA 1I5ZA 1RIOH 1BI2A 3QPTA 5IT9Z 3D0SA 4UVBA 3RYPA 2VC0A 4HZFA 5L3FA 4AVPA 1FBSA 1MGTA 2PMUA 3HRTA 3KP7A 3ELKA 1ZRDA 1L3LA 3DXJF 3LWFA 1BI3A 2A5YB 3DPTA 4WXDA 4HQEA 3GFJA 2A68F 1OMIA 2PFBA 3KEOA 1R1VA 4EJVA 2IRFG 1WKMA 2OD5A 1FPQA 5LHGA 2FQ3A 5E18F 1TW3A 5CVIA 1QPMA 2LNBA 4ZYHA 4LB5A 4H0EA 4EJTA 5DUIA 3GFIA 4N9IA 4KUMA 5JR3A 5FLXZ 3FX3A 2RNJA 1O7LA 4RB1A 4KYWA 3WTVC 4N9HA 2DK5A 2W57A 1PP8F 1XDUA 1O7FA 2K27A 6PAXA 3U1DA 3KZYA 3GX4X 2YX4A 4YFNF 5K5RA 3BROA 3ZMDA 3M7GA 4A0YA 4EJUA 1U5TC 3S2WA 2Y48A 4EJOA 3P9KA 5FB2A 1U78A 4YIFA 2YR2A 3U2RA 2MH2A 5DD4A 3LA7A 2OQRA 1WQ2A 2R7FA 2IVMA 3L7WA 4RGSA 1T2KA 3EDPA 2MH9A 1PDNC 2QBYB 5J8FA 1XB4A 1YW8A 1YW9A 1U3EM 4M6XA 4FX4A 1C0WA 2KRFA 1O3RA 3LFKA 2KIMA 1R1TA 3KP5A 1W7PA 5LHIA 1RI7A 4Y17A 4OMYA 4OIRF 3IHUA 4A6DA 3MZHA 1MKMA 3SZTA 4WX9A 1R23A 2EFQA 2HTSA 4EM1A 1I1SA 1B9NA 4L0ZB 4M74A 3WODF 2IA0A 2VN2A 5F6FA 2Z9OA 2A61A 1QZZA 2P6TA 1GXQA 2XROA 2GWRA 3F8NA 3ECOA 4XBFA 2FNAA 1ZYRF 3FMQA 4EVIA 1QO0D 3TGNA 5LLQA 1REPC 1ZRFA 1DUXC 3HRUA 3D5LA 4IPAA 2RV8A 2CSOA 3I71A 1DP7P 1FX7A 5K5OA 1BBYA 2A6HF 5LGTA 3R0JA 4U7BA 2OBPA 3GW2A 1J75A 4RGUA 1BIBA 4LG0A 2G7UA 4L5IA 5E1ZB 1YQAA 1DPUA 1XMAA 3GO5A 4ENKA 3M8EA 1SMYF 3WTYC 5LGUA 2NAZA 4PDKA 3DEUA 4CHUA 1JGSA 1KU7A 3GZ6A 1OKRA 1S6LA 1QZYA 1RUNA 2VBYA 1F4KA 2DU9A 3HTSB 3MCZA 1BIAA 2PN6A 5FD5A 3CJNA 4PZJA 2GXGA 2P5KA 3KCCA 4CGZA 4LJZF 3FMRA 4JQFA 1FT9A 4U0YA 4YFKF 3C1DA 1AWCA 3F6VA 4MGRA 3SZPA 2CG4A 2A69F 3K0LA 3LSTA 1ZN2A 1SD4A 2O3FA 5ILVA 2MLKA 4DNCA 1ZHFA 2H6BA 2HR3A 1YTYA 3F22A 2BEOA 4CDGA 2E1CA 3K1PA 2VBXA 4MEXF 4KDPA 1R7JA 5EEHA 2W25A 4I0AA 4A6EA 1X3UA 2EK5A 4I2OA 3KEQA 1TNSA 2QWWA 4KIFA 2VT2A 5ILUA 2HZTA 3BY6A 4ENNA 3BJ6A 2X4HA 1HBXG 1V4RA 4OU0A 2DPUA 5BMZA 1RNLA 4MNUA 1XSDA 2PMHA 2V6CA 2PLYA 3IC7A 4ZZDA 3FXRA 3G73A 2XASA 3JSOA 5TRDA 1UCRA 1EH8A 2HDCA 2P7CB 4B8XA 1OYYA 5ILSA 4GO1A 4DQ2A 2BYVE 5LEKA 3I0TA 4G94A 2F5EA 3P9IA 2XVCA 1FP1D 4I09A 3BPVA 5LRSA 3BJOA 5FO5A 3T8RA 1K78B 1TQIA 1T38A 3PQKA 2DPDA 1KU3A 3CO7C 4ASNA 2A6EF 3LAJA 3KE2A 3WU1B 5D8LB 5E8GA 1FNNA 3AAFA 3DPLC 1UFMA 4WF2A 2ADUA 1H9GA 4ZH4F 4LD5A 4UHTA 4ON0A 4LLLA 2D45A 3ML6A 4QWQA 4EMSA 2DW4A 4EJWA 4CZZA 4Y13A 2OQGA 1IW7F 1IXRC 3SHFA 3TO6A 5HLHA 2VBZA 3V7CA 1XD7A 4JK1X 2RKHA 2M30A 4GCVA 2D1VA 2DBBA 5D4SA 4RGXA 2XHKA 2PQ8A 5HS8A 2M8EA 2K02A 4OIOF 3C3WA 5D5XB 1IN5A 2J5PA 4OOIA 1GXPA 3EYYA 4XLPF 4HV5A 3N97A 1LNWA 4LMYA 3HOTA 3I53A 2EB7A 2XKPA 3RKWA 4A0ZA 4IF4A 3HIFA 3RJPA 1XCVA 3I58A 2V1DA 3CO6C 3J7AO 2L4AA 4QLCU 4LK1F 2KKOA 1R1UA 4MTDA 3IRQA 4Y15A 1CF7B 4WK8F 1ZG1A 3R4KA 1XGMA 1ZREA 4AIHA 3K1MA 1EV7A 1YO5C 2UXXA 2Y75A 5LEJA 4P5OA 4UVCA 3REOA 1IRFA 4AIKA 4A5NA 4MEYF 2L54A 4E70A 3QAHA 4FT8A 2FSWA 3GWZA 2ETHA 2DI3A 2VE8A 3WE3A 5CVVA 3TO9A 3VODA 3TOAA 1D8JA 2V79A 5HS7A 4L9TA 2OU2A 1F1ZA 1UB9A 2EV5A 2JPBA 2KJCA 2DQLA 3V8LA 1WI9A 4IRHA 2ZMEB 4R79A 1TQMA 2XAJA 4ENJA 3ZMUA 1QGPA 1SFXA 3ISPA 2Z99A 4BXUA 2W24A 3L2CA 2B0LA 4G6QA 1U5TA 3B02A 3GFMA 2QM3A 1R58A 2IA2A 3K1NA 4G9YA 2FE3A 5HDGA 3LAPA 2EFPA 4XSXF 3EUHA 4G6DA 4RB0A 3E6DA 2V1XA 4D0PA 3DF8A 4BYYA 5DYMA 1XGSA 3I4PA 1IUYA 4M9XA 2O8XA 3T1BA 2JT1A 1LEBA 4Q48A 2V9VA 1ZH5A 1RZ4A 1K6OA 3C7JA 1T6SA 5AIQA 3JTHA 3TDUC 5J6XA 1LVAA 2HEOA 1MJ9A 2XUBA 3J80K 2R3SA 4HYEA 4LB6B 5FD6A 5L3GA 1KU2A 4KIGA 1HSJA 2RDPA 4ESJA 2BE5F 3M9AA 1HSTA 4A2UA 1LDDA 1FP2A 3FM3A 3MFKA 2P6SA 1Z6RA 5LRRA 3QP6A 2LKPA 4MQ9F 2GXBA 4IHSA 2NRAC 5CLSA 1K7AA 4G7ZF 1W7PD 1W7PB 2ZNZA 4I7HA 4HF1A 3F72A 3ZMZA 1MDMA 2HKXA 4LGWA 4A12A 2XIGA 3BDDA 5DCMA 3BOQA 5HOOA 4HX8A 1XN7A 1B9MA 3ZQ7A 2EA4A 2QQ9A 5BPIA 1P92A 1G6NA 3V8JA 2K7LA 4I02A 5A2QK 2D1HA 2K4BA 3T8TA 5ICFA 3F3XA 5H6QA 3I5UA 4HBLA 1OPCA 2QLZA 3RKXA 2ZBKA 4RB2C 5D8KB 2VC1A 3KLNA 2P7VB 2W84A 4IHTA 4LFUA 1KQ8A 1FWZA 3QU6A 3OOPA 4RB3C 4LG0B 2DK8A 4I98B 2W85A 4BQAA 4AIJA 4I0BA 1XSXA 1Z91A 2GZWA 4WCGA 1PP7U 5HVQC 5HLIA 1YS6A 4BNCA 1ON2A 1HQCA 1W4MA 1XGOA 5D5WB 3CUQB 3TO7A 2XV4S 1XMKA 4GGGA 5A2QZ 2CGPA 1ZG5A 3HTUA 1BC8C 3F8BA 4OINF 1ODDA 1A04A 5LHHA 1HKQA 1SMTA 3JSPA 3JW4A 1DPRA 1H9TA 1KQ0A 2Z3YA 3GLXA 3W6JB 3RTRA 3GYHX 5E17F 1E17A 2QBYA 3IWFA 1D8KA 4YFXF 3WG9A 1ZGJA 4IRIA 3B73A 5FGMA 1R5HA 2ZKZA 2JSCA 3Q9SA 1SD6A 2OZ6A 2ZCWA 2UXNA 3I64A 3F6OA 4ESFA 5KK1A 2F5CA 2VODA 2Z33A 3ZMVA 1S7AA 1B6AA 1HW5A 2HGCA 5D6FA 1CGPA 3TQNA 5DUKA 3HSFA 4MQVA 1TBXA 2NNYA 4EQQA 1ULYA 4PCQA 1I1GA 4P9UA 4RS8A 5DDGA 2GA2A 5H6RA 2TDXA 4F7ZA 1SD7A 1Z9CA 3WGIA 3FF5A 2M87A 1EH6A 3R6SA 3GEZA 4IRGA 2FMYA 4FX0A 2MBFA 4JBAA 3FMSA 4M6YA 1S29A 3V7RA 1T0FA 4U0WA 2FBHA 4KA4A 4UV9A 3K9TA 5E20A 4Q47A 1BM9A 2HQRA 5D5VB 4BH9A 2XAGA 3F8CA 1B4AA 3P7NA 1JXSA 1KQ9A 4O5VA 5AONA 5DV5A 5DEQA 1R22A 4WXHA 4IXAA 1FC3A 5ED4A 2CFXA 3O2PE 1P4XA 1ZLKA 5HDKA 2HFHA 3J81K 1UHWA 3H92A 3CLOA 2GA1A 4NQWA 2CWEA 2FMLA 3KFWX 2COMA 2L02A 2CYYA 4A0XA 2MD5A 1U6GA 4U0VA 3DP7A 3WGGA 3RPUA 5FFXA 2GIVA 2G7HA 3E6BA 3CUQC 3HRSA 5J8CA 1JHHA 3TKYA 3ZN0A 1KYZA 3ZMSA 2E7XA 2FEZA 3Q5FA 3K69A 2D2WA 1TNTA 3ULQB 1IXSB 2FBKA 4I01A 1J59A 1FBUA 3MZYA 2Q0OA 4MTEA 3QRFF 3KETA 2PEXA 1S8NA 2HTJA 3BJAA 2FNPA 4MHGA 3HSRA 4UNOA 5LGNA 2K86A 1O57A 3J81Z 2ZO4A 1GHCA 2IA1A 3IRRA 3IL2A 3H3UA 3RDIA 3FHZA 1F9NA 1SFEA 1BOAA 2F5FA 3QPHA 2VE9A 3HYIA 3VEPA 5L3CA 5D4RA 1J0RA 1I6XA 2P8TA 4O3MA 3LQRA 2EV0A 4HV6A 3DFGA 2EV6A 1Q1HA 3BPXA 2WWYA 3DV8A 4HQMA 2VOOA 4GYIA 4S05A 5ICCA 3PFIA 4L5JA 2JPCA 1Z7UA 2YSRA 1YIOA 1XGNA 2HOEA 1EH7A 2PBIA 1IF1A 1FYKA 1IN4A 3SFZA 3O6BB 4M9ZA 5HS9A 3GFLA 2R7DA 3VOEA 3QP5A 2EWNA 4BHPA 4G7OF 4L18B 5JHUA 2JTVA 4TV7A 2ZXJA 2O61A 2UZKA 2OA4A 4ZYGA 4ZZLA 2WC2A 4BHBA 2CO5A 5K5QA 3HUGA 3WE2A 5HDNA 1L0OC 1R36A 1Z1DA 1BJAA 4EV0A 1MZBA 3I59A 1HW2A 1IZ1A 2NS0A 3RI4A 3FZVA 4KFCA 2FXAA 1JE8A 3T5XA 2E1NA 1KU9A 3IWZA 2ISZA 2LDUA 3H3ZA 4G8XA 2A3SA 2QQAA 2ESNA 3KP2A 3R60A 3EYIA 2HYGD 2QZ8A 4XSZF 2M45A 2L01A 1S3JA 3Q9VA 1USSA 1MJBA 3E5XA 4HOBA 2FOKA 2HYFA 4HX4A 5JVTA 3U9GA 3JTGA 1KA8A 2IP2A 4RGRA 5ICGA 2FA5A 3E6CC 1SFUA 1AOYA 3WGHA 4LLGF 3PQJA 4ETSA 3FWEA 5E8IA 1YLFA 5L3EA 4U7DA 4NHJA 4KICA 3WTTC 3DKWA 1NHAA 4CXFA 3GF2A 2FF4A 2XAQA 3DQVC 2ESHA 2Z5UA 2LF7A 2ZFWA 4L9JA 4EGZA 1UHMA 1YFHA 3P9CA 4OIQF 3F8MA 5EEGA 1MJAA 4KN7X 4L9VA 1QNTA 3MQ0A 1B1BA 4P55A 1KYWA 3I54A 4KIBA 1G3SA 1J7KA 2DFIA 1BC7C 2AXLA 3KP3A 5ICEA 4HDVA 3M1EA 1YYVA 2IW5A 1J5YA 1GVJA 4NB5A 1YS7A 4KN4X 1P4AA 2XAHA 3WTZA 2JZYA 1IXCA 4EGYA 2QVOA 1XDSA 1ONVA 1R5GA 1BN5A 2ZMEA 5BS6A 2VXZA 2DTRA 1G4DA 3N4MA 1LJ9A 2BGCA 1SD5A 2L3DA 5FFZA 3WTUC 3QU3A 3EETA 4KT5C 3GZ5A 5E1XA 4Z2YA 2YPRA 5TJJA 1TLHB 1E2XA 3QOPA 2HS5A 3RKYA 3J80Z 1LDKB 1RUOA 4UVAA 3EQLF 3V8KA 3WTWC 4YIIA 2H94A 2O0YA 3HHHA 4AWXB 2HWVA 2P4WA 3KP4A 4ZYEA 4HA8A 3K2ZA 1T98A 3ZP5A 3COAC 1ZAOA 3BZ6A 2CW0F 1U2WA 1O3SA 4HAMA 2Y0MA 2H09A 3BWGA 4IVNA 4GXOA 4YG2F 3T0YA 1XCBA 2GAUA 3HSEA 2F2EA 2WV0A 2HKOA 4KMFA 2LSOA 4PGHA 1W5SA 1HKTA 2XRNA 1OR7A 2P5LC 3ZN1A 2XAFA 1U8RA 5E1WA 3TOBA 4BHCA 2EA2A 1OYIA 4CYDA 1H0MA 1ZG3A 2DO7A 2KIFA 2XKOA 2EJRA 1IRGA 1FSEA 4ENMA 4WWCA 1BI0A 2ZNYA 4IJAA 3NRVA 4A5MA 3ECHA 2E7WA 5CJ9A 2IPQX 3KZZA 1FY7A 1P6RA 2ELHA 4KMUX 4RAYA 5D5UB 1IAWA 1XSVA 2IJLA 3ZPLA 3O3KA 3CTAA 3LA2A 2O03A 2OAZA 2QENA 4XLNF 5CYVA 5CVRA 3RYRA 1LB2A 3V7SA 3ZMTA 1IN8A 1ZGAA 1BI1A 1T39A 1FBQA 1WRJA 4HW0A 2VOPA 2QYOA 3HRMA 2VT3A 3CUQA 1G3YA 4M71A 2VBWA 1G3TA 1J9IA 2PG4A 4Q5SF 3TDZC 2NYXA 4XRFA 2KIUA 4L9NA 2DT5A 1Z6TA 3WTXC 1Y0UA 2RC4A 1K79A 1ZRCA 1R00A 3E6MA 2FU4A 1FOKA 4HF0A 3SQNA 5ERIA 5DD8A 5BOXA 3ROUA 1YG2A 2LF8A 1PUEE 3NEUA 3IKVA 4LK0F 5JFRA 2RQPA 1IN7A 2CQKA 2QUFA 5L3DA 3E97A 2OZUA 2YU3A 3FXUA 5H20A 5HLGA 4K2EA 2G9WA 3LQQA 3F8FA 4ESBA 1FLIA 2IT0A 1DDNA 2NNNA 3MAJA 5F1RA 4R1HA 3V4GA 4HF2A 4OIPF 4M73A 1O3TA 2ACJA 2UWMA 1ZLJA 1TW2A 2ISYA 3L09A 2A07F 2VONA 4Q4ZF 3CUOA 4B09A 3RIRA 2ZJ2A 1B59A 3E3VA 2V1UA 3W6KB 1ZARA 3ERED 4GYGA 3MWMA 2FRHA 1G3WA 5JI6A 1WWXA 2MC3A 3JAMK 1FYMA 1FZPB 4M9SA 1P4WA 2MLGA 4EM2A 5L3BA 3VFZA 3KP6A 2F5DA 2STWA 2M5WA 4L0YB 3WU0A 3GUDA 4LLNA 3M8FA 4RAZA 1LQ1A 3I59B 4ZYDA 5AIPA 1F5TA 5BPDA 2RN7A 4WXCA 3RPQA 2H27A 2GQQA 1VTNC 3C18A 4P9FA 4UXNA 2EFOA 4EM0B 5F64A 1LDJA 1SAXA 1YW7A 4HDUA 3R61A 3IKTA 2X0LA 2Q8KA 3GXOA 3L00A 4PGGA 1LEAA 1HW1A 5BQTA 2K4JA 1W5TA 2J5OA 2KJBA 3JAMZ 3VB2A 5D6EA 1IN6A 1D5VA 2QQBA 1K78A 2EFNA 1Z05A 2L4MA 1FYLA 2YX7A 2XGXA 2H6CA 1U5TB 2JRTA 4U88A 5LBQA 1S7OA 1TQPA 1P2FA 5K1YA 3HHGA 1TTYA 1QQIA 2BV6A 2HQNA 4G7HF 3G3ZA 2P5VA 1HXDA 1J2XA 3WTSC 2RGVA 1ON1A 1JHFA 4N0BA 3GVAA
chains in the Genus database with same CATH superfamily
2XDVA 1ZELA 3KLOA 3THOB 2IGNA 3ABUA 4LF7E 2WTEA 1K4TA 1R6RA 2O6GE 3HOSA 1HLVA 2O9LA 4GFBA 1V3FA 3OYLA 2EFWA 1I3QJ 1T8IA 3OV8A 3SFIA 1O3QA 2PI0A 5F3WA 2CQXA 3FXQA 1P47A 3R0AA 4RHBB 4HLXA 5IT9K 3EUKL 3A01A 2EN3A 4PFPA 2CJJA 3CMEI 4CICA 3BTLA 1WSUA 1VQKI 1JI8A 2E71A 4CO8A 3SXYA 3CDHA 1YJWI 4O6JA 3LA3A 2DT7B 3BP8A 2BXYA 2ODRD 2R7TA 2UUCE 2DMTA 5DM6F 4S04A 1D3YA 2BBYA 2V6EA 4IHWA 2VXDA 2HQ5A 2AXTC 1GVDA 5E3OA 1OYWA 1B8IA 3K10A 2DQRA 3OS1A 5EJCA 3F23A 4HLYA 2DLLA 1KGSA 5HNFA 1I27A 2CQ7A 4DYCA 4UUTA 2GPIA 1STZA 4P96A 4XRSG 2R4GA 2HOSA 4ITVA 4E4HA 2L2MA 4UV8A 4OMZA 1FOWA 5KVRA 3L9FA 3G6EI 4BAYA 3F21A 1NK3P 3E5UA 2C6YA 2NVXJ 1HR0E 3MEXA 3NQOA 3OYGA 1R9TJ 1A1FA 2V26A 2WBTA 1Z0XA 2GBYA 5DCFA 4IKFA 2DA2A 2EOXA 3RMPA 4DR7E 4FHTA 2Q2EA 5CVUA 1ZGWA 1QPIA 2E34A 1HKSA 2L7MP 4KNYA 2FJ1A 1GQEA 2FBIA 1LFBA 2Y69H 1CF7A 2RVCA 4R8HA 2AS5F 1MDMB 2LTSA 5CVJA 4HX7A 5DCMB 4LTYA 4DV0E 2DAOA 2WAQN 2R7VA 5FLXK 1FSHA 3FIWA 4AD9A 2L6MA 4DR2E 2KHXA 1ETXA 2MA3A 4GDFA 3VSLA 4UUVA 3FM5A 3BC8A 2M1BA 2STTA 3ABTA 5IT3A 3OYIA 1ETWA 1MD0A 4M72A 1USTA 3G4SI 1QBJA 4I6ZA 2PJPA 4R2EA 1YSAC 3E5QA 1I5ZA 1RIOH 4X62E 1BI2A 3QPTA 5IT9Z 3VHTB 3D0SA 4UVBA 3RYPA 2VC0A 2WY7Q 4HZFA 4IO9F 5L3FA 3FISA 4AVPA 1FBSA 1MGTA 2PMUA 3BZKA 2AQEA 2XPWA 1IQSA 4A3KJ 3HRTA 3FHNA 2XF5A 2R5YA 3BT9A 5FKOA 4DIQA 1WJEA 3KP7A 3ELKA 4D7MA 1ZRDA 1T4NA 1L3LA 3D5RC 3H5NA 3DXJF 3LWFA 1BI3A 5LMNE 2A5YB 3DPTA 4WXDA 2QGUA 4HQEA 3GFJA 2A68F 1OMIA 3LOCA 2PFBA 3KEOA 2LRDA 4JI7E 2CQNA 1VZ0A 2FV4B 1R1VA 2YTQA 1UBDC 3ADIA 4EJVA 2IRFG 1WKMA 2OD5A 3SEZA 3Q0UA 2CUJA 1FPQA 5LHGA 2FQ3A 2WAQA 3SDBA 5E18F 1TW3A 5CVIA 4IL6C 5M3MJ 1QPMA 4FTHA 3OYJA 1Y8RB 4N4OB 4AC0A 2LNBA 4ZYHA 1VQNI 4LB5A 2EPFA 2VJJA 4H0EA 1YE9A 2ZM6E 1BW6A 4EJTA 2W1OA 1D1BA 5IP9J 4XMYA 5DUIA 3HOZJ 3H9JA 3GFIA 2NS7A 2W48A 4MLOA 1JUMA 1RKTA 3BTCA 1T4OA 2EM3A 3ZQLA 4N9IA 4C3JJ 4ZTFA 4KUMA 1QVUA 2K9SA 2KZGA 5JR3A 1FJLA 5FLXZ 1D5YA 4UUSA 3A0BC 4DV5E 3FX3A 4L5NC 3PIOF 2RNJA 1O7LA 4NDLA 5IP7J 4RB1A 3JR9A 1ZR2A 5FKMA 4KYWA 3WTVC 4N9HA 2DK5A 2W57A 2Z16A 3OY9A 1PP8F 1XDUA 5EZHA 1O7FA 1WJBA 2K27A 5H2FC 6PAXA 3U1DA 3KZYA 3GX4X 4KT6A 2VQLA 2WV1A 2EOFA 1T33A 2YX4A 4YFNF 4L8NA 4XM3A 2EZIA 5K5RA 3BROA 1FOXA 3ZMDA 3M7GA 4A0YA 4EJUA 5J47A 1U5TC 3S2WA 3TP3A 2Y48A 1RPWA 4EJOA 1ZBQA 2IEKA 2XSJC 3P9KA 4YIFA 5FB2A 1U78A 2L0KA 2V83A 4V2FA 3S1MJ 1BBGA 4R2SA 2E60A 2YR2A 3OS0A 3U2RA 2MH2A 2QF7A 2ELZA 5DD4A 3EUHC 2DDAA 1W0TA 1WHNA 2JVHA 3CCQI 3LA7A 4R2AA 2OQRA 2JA7J 1V5GA 1WQ2A 3CCRI 2VQEE 2R7FA 2IVMA 1DQ3A 2AO9A 3L7WA 3BR1A 2EMHA 3H9QA 4EATA 4B3RE 4RGSA 2GIZA 3KPHA 4XK4A 3JRIA 3M8JA 4XNFA 2V89A 3QQAA 4BY7J 1T2KA 5EF6A 3EDPA 3LMMA 1SVOA 3LSRA 1YX5A 4D1QA 2RS7A 2Q1ZB 1Z21A 2IAIA 2KRCA 2QKLB 5IYCJ 2MH9A 1PDNC 2QBYB 3CD6I 2R7UA 4CCOA 2BW3B 3JRDA 5J8FA 1XB4A 1X58A 1YW8A 1YW9A 1U3EM 4M6XA 4F91B 4FX4A 1GDTA 2ZB9A 1C0WA 4Z6YA 3KYCB 2K4VA 2KRFA 1O3RA 3I4MJ 4A3GJ 3LFKA 5EEAA 4NZVA 2KIMA 1R1TA 3KP5A 1R49A 2X6YA 2XGCA 2E72A 3CC7I 2N8XA 3G1LA 1JKRC 2YSPA 1W7PA 5LHIA 2IGOA 4JI3E 5KCMA 3CCEI 4B47A 1RI7A 4Y17A 4OMYA 4OIRF 4E7HA 1A1KA 1WJDA 1PKPA 3IHUA 1TWHJ 3CMYA 3BQYA 4A6DA 4UY8I 3MZHA 2EN6A 1MKMA 3ZQQA 3SZTA 4WX9A 1R23A 1BBOA 2EFQA 2HTSA 2MDRA 4F9AB 4EM1A 3VDXA 1I1SA 1PVEA 1B9NA 4L0ZB 4M74A 1K61A 2KLOA 4XRSA 3BR6A 2HDWA 4A3CJ 5CPRB 5IYBJ 3WODF 3PNTA 2IGKA 2R92J 1YYWA 4X64E 2IA0A 4L5EA 4HNUA 2VN2A 5F6FA 1SEUA 4HTGA 2Z9OA 2EOQA 2A61A 2E1OA 3QPSA 1QZZA 2P6TA 5FROA 4P7DA 4DBRA 1GXQA 2XROA 2GWRA 3F8NA 3ECOA 4XBFA 1BB8A 2CW7A 2MGQA 2FNAA 1VQ5I 4OAYA 5C4JJ 1ZYRF 3FMQA 1NK2P 4EVIA 3PNVA 5FLVA 2LY2A 3BG3A 1QO0D 4A3MJ 3TGNA 1K6YA 5IOZA 5LLQA 4A3BJ 1T56A 2EM0A 3AKZA 1REPC 1ERDA 1ZRFA 2XB5A 3MHHC 1G8XA 1DUXC 4A3IJ 3HRUA 1AKHB 2WA0A 4FISA 3D5LA 4IPAA 1W1WE 2RV8A 2CSOA 3I71A 1DP7P 1A6IA 1FX7A 5K5OA 1BBYA 2A6HF 4YRVA 2GHFA 5LGTA 3A4CA 3R0JA 2YTJA 4BJTA 4U7BA 2GOXB 2OBPA 4ZTJA 3GW2A 1J75A 1MBHA 3LLHA 3RKQA 2KMUA 3DKXA 4NC6A 4RGUA 4CSWA 1BIBA 4LG0A 2EM4A 4JI6E 2G7UA 5IV8B 2V7FA 4L5IA 2L92A 2B63J 5E1ZB 1SVMA 1YQAA 4WPYA 1STUA 1DPUA 2WAEA 2HHHE 2R7RA 1IBKE 1XMAA 3GO5A 4ENKA 2KDZA 3M8EA 1SMYF 3WTYC 3G71I 4YIRX 5LGUA 1P7JA 2NAZA 1X2NA 5B1BH 4PDKA 1UHZA 3DEUA 1X4PA 1ZQ3P 3ONQA 4CHUA 3EPKA 1APLC 3F6HA 1JGSA 1KU7A 3GZ6A 1OKRA 1YJ9I 2F5VA 1ETYA 4QPOA 1S6LA 1QZYA 1RUNA 2VBYA 3TEDA 1MMNA 1F4KA 2DJIA 2DN0A 2V9PA 2ECCA 4FCYA 2DU9A 3HTSB 2VUMJ 2WAFA 1BIAA 3I3LA 2HU9A 3MCZA 1UN6B 1S9HA 4A93J 2PN6A 4Y3OA 5FD5A 1TL8A 3CJNA 3HOVJ 3DPUA 4XOPA 4PZJA 2GXGA 3E0JB 2P5KA 3KCCA 4CGZA 4LJZF 3FMRA 3GCMA 3JRHA 4JQFA 1FT9A 4U0YA 4KZSA 2FTXB 5IP6A 4YFKF 3C1DA 2B7TA 2JA6J 1AWCA 3F6VA 4MGRA 1Z3XA 3SZPA 2CG4A 2VKEA 1MBJA 3ZOQB 2CRGA 2A69F 3FXLA 2D5VA 3K0LA 1IUFA 3LSTA 1ZN2A 3IWBA 1SD4A 2O3FA 5ILVA 1WHUA 4X0GA 2MLKA 2EOJA 4OX9E 4DNCA 2JK3A 1ZHFA 2H6BA 2KPMA 1VF9A 5J1UA 2HR3A 2LVSA 1YTYA 2YTEA 1MH3A 3F22A 2BEOA 1XG1A 5A6BA 3EPJA 2L8TA 1LUJB 2MYSA 4CDGA 2G0EA 3K1PA 2E1CA 2VBXA 2EPXA 4MEXF 4KDPA 1R7JA 5EEHA 2P0WA 2L3JA 2K5CA 2YTFA 4BDYA 2W25A 2EPCA 4I0AA 4Y4RA 2JY9A 2YRMA 2Q8UA 3C2GA 4A6EA 2JP9A 2NUFA 2H36X 3PUFA 1YJNI 1X3UA 2EK5A 1WJ5A 2M0CA 2DLKA 4XRMA 3HBLA 4I2OA 3KEQA 3FXOA 4M6VA 1TNSA 2QWWA 3UNGC 5CQEA 4QPQA 2L2KB 5M3FJ 4KIFA 3J80C 3GTPJ 2VT2A 5ILUA 4PJJA 2X6WA 2QCOA 2HZTA 3BY6A 2LMDA 1YOVB 2JSPA 4DV1E 4ZYAA 4ENNA 2I9IA 5A6JA 1SANA 2VKHA 1MMSA 1X3ZB 3BJ6A 2E1MB 2X4HA 1HBXG 1V4RA 3MMYB 3DF6A 4OU0A 4G12A 2DPUA 2DFEA 3QG5C 4C9YA 5BMZA 2LH9A 1RNLA 4MNUA 1XSDA 1XPXA 2PMHA 2V6CA 2PLYA 4AUXA 3ASOH 2DXIA 3DEWA 3IC7A 4I76A 4II2A 3CCLI 2YTIA 4ZZDA 1E0EA 3FXRA 2RTXA 4YHHE 3G73A 2XASA 2CT1A 2JYAA 4JI2E 3JSOA 5TRDA 1UCRA 1JGGA 4BEHB 2PX9A 1EH8A 4E7KA 2HDCA 4B8XA 2P7CB 2VRDA 1OYYA 2LOOA 5ILSA 4GO1A 2EN4A 4DQ2A 4PJ0C 2BVMA 2BYVE 3BR0A 2LE2A 5LEKA 2EPZA 2M4IA 2L9VA 1KYQA 3I0TA 1EJ9A 4G94A 4WYQB 3HPSA 2F5EA 2JUGA 4C30A 4IS1C 3P9IA 2XVCA 1F43A 1FP1D 4I09A 3BPVA 1UHSA 5LRSA 2ECBA 1MMAA 3CCJI 1PJRA 3BJOA 2BY0A 2JJ7A 5FO5A 3T8RA 3MSWA 3J7ZI 4I8OA 2MG4A 2F4VE 4ABZA 1ORKA 2NS8A 1K78B 5JLWA 1TQIA 2V9KA 2EPRA 1D0ZA 1T38A 1Q1VA 3PQKA 2DPDA 4LOCA 1X1AA 4LF4E 1KU3A 3CO7C 4ASNA 2HOTA 2A6EF 3LAJA 3KE2A 3WU1B 5D8LB 2I10A 5E8GA 1FNNA 2UUZA 1FIAA 3AAFA 3DPLC 1XNQE 1UFMA 4B48A 2MC6A 2N3HA 2A6TA 1T0FC 4WF2A 2ADUA 2ENCA 1H9GA 2DFFA 4ZH4F 2KISA 2DMIA 4LD5A 3H35A 2IBDA 3MKLA 4UHTA 4ON0A 3H0DA 4LLLA 4S0HB 2D45A 1IBLE 9ANTA 1W36C 1CQTA 3ML6A 4QWQA 3DKYA 3AG1H 2DW4A 4AVZA 4EJWA 4EMSA 2ZXWH 4CZZA 3H3VK 4Y13A 1J26A 1OCCH 2OQGA 4XIDA 1IW7F 1IDYA 4GRIA 1IXRC 1R4NB 3VYTB 2LJUA 4BBYA 3SHFA 4DKKA 4DV2E 1TF6A 3TO6A 4GKJE 5HLTA 3AL0B 2VKDA 2F4OB 2WADA 5HLHA 4P1WA 3CC2I 2LTRA 2LY1A 2VBZA 1YHQI 1IJWC 1F2IG 5KL2A 3V7CA 2LY9A 3LSPA 3A01B 3OTOE 2PJRA 1XD7A 4JK1X 2EWLA 4PJNA 2RKHA 2M30A 2EOHA 3JRFA 4GCVA 2D1VA 2DBBA 4RGXA 5D4SA 2XHKA 2PQ8A 5HS8A 3L1PA 1VQ6I 2M8EA 2K02A 4OIOF 3C3WA 2XF7A 2QSHX 2H1KA 1KONA 1GV2A 1LPQA 2FUG2 4XICA 5D5XB 1IN5A 1N25A 3AG3H 2BXZA 2J5PA 4OOIA 3EYYA 1GXPA 2YRHA 4XLPF 4HV5A 4JV5E 3JU0A 3DEEA 2HZDA 3N97A 2BBGA 1LNWA 4LMYA 3HOTA 3SJMA 2VQFE 4BE2A 2VQGA 3OR1C 3ADJA 3I53A 2AHQA 2EB7A 2NOJB 2XKPA 3RKWA 1U9OA 4B3SE 1VQPI 4A0ZA 3E7LA 2LKSA 2AQFA 1PUFA 3HC7A 4IF4A 3C4TA 3HIFA 3RJPA 3S1QJ 2JWOA 1XCVA 3I58A 2ZSHB 2V1DA 3MKZA 4DR4E 4NUBA 2VKVA 2JXPA 1IBME 3CO6C 1GUUA 3HTXA 3J7AO 2L4AA 3O8GA 5KL6A 3KZIC 2Q2EB 4QLCU 4LK1F 2KKOA 1R1UA 2NABA 4AIDA 2KIQA 2Y0SN 4MTDA 3W2AA 2IS6A 2DB2A 2UU9E 3IRQA 2XC7A 2CW8A 4Y15A 2WCC3 1CF7B 4WK8F 1ZG1A 1Z3YA 3R4KA 2KP6A 1XGMA 2X6OA 4XQFA 1ZREA 4AIHA 4N4RB 3K1MA 1EV7A 3DU5A 1YO5C 2UXXA 2Y75A 3DLAA 4XN3A 2M9AA 1O0WA 2CUEA 3C2BA 3C6MA 2DMYA 5LEJA 4P5OA 4UVCA 3REOA 1IRFA 4AIKA 2EZKA 4A5NA 4MEYF 2L54A 4E70A 4YY3E 3OOUA 1I3AA 1LE8A 3QAHA 4FT8A 2FSWA 1TC3C 1E3PA 3GWZA 5K7FA 4M3DA 2ETHA 1R5ID 1GT0C 2DI3A 2VE8A 3WE3A 5CVVA 3FBNB 3KYDB 2DA5A 3TQMA 2EPMX 1Y8QB 3TO9A 3HOYJ 4BGDA 4BC7A 5KL3A 3VODA 3TOAA 2O7OA 1D8JA 3DU6A 2V79A 1MBGA 2L3CA 3VPRA 3GTQJ 5HS7A 1WH5A 4L9TA 4XORA 2EN8A 2OCCH 2OU2A 1F1ZA 2X1EA 1UB9A 2EV5A 2I13A 3ZXSA 1ZTRA 2JPBA 4D7NA 2RREA 2R7WA 4JI4E 2Y0SA 2KJCA 2MDGA 1JTYA 5AE3A 4C3IJ 1OFCX 3BBGA 4PJMA 2LBSB 3Q0VA 4U87A 3W2VA 2DQLA 3IWDA 2L5QA 3V8LA 1WI9A 2EP3A 3LSGA 3CF2A 1ZAAC 2XB0X 4B3XA 4IRHA 2ZMEB 3S1RJ 4R79A 4B3TE 1TQMA 2XAJA 3ZOBA 3RZOJ 4ENJA 1V5EA 1QGPA 3ZMUA 5DS9A 1SFXA 2R5ZB 4F92B 4J8ZA 3ISPA 4LIUA 4LF9E 2Z99A 2DMPA 4C2UA 4BXUA 1KZHA 1JT0A 2MABA 2E35A 2W24A 3L2CA 3PJRA 2JN6A 2B0LA 4G6QA 4IX7A 1U5TA 3CP2A 2EM7A 3VYYA 3B02A 2UXBE 3GFMA 4B3AA 2QM3A 1R58A 1GLNA 2E5NA 2IA2A 3K1NA 4G9YA 2FE3A 4LIVA 3FK6A 4CCLA 5HDGA 3LAPA 3G1MA 2EFPA 3IP4B 4XSXF 3EUHA 2XGEA 4A3DJ 1PDAA 4G6DA 4RB0A 2EOSA 3E6DA 1BR4A 4TUIA 3MZ8A 2V1XA 4AYBN 4D0PA 3DF8A 4BYYA 5DYMA 1XGSA 3I4PA 1IUYA 2A05A 4M9XA 3U1KA 5DNYA 2O8XA 3T1BA 4V2GA 2OJED 2JT1A 1LEBA 3L2QA 4Q48A 2V9VA 1ZH5A 1RZ4A 2E2HJ 4F6MA 1XMOE 2DA3A 1T95A 1JJ8C 4PSWA 4LF6E 1BW5A 1K6OA 1UELB 3RCOA 4OOGC 4R2DA 3C7JA 1T6SA 2OPTA 2WB1N 5AIQA 2KFDA 3JTHA 3TDUC 5J6XA 1LVAA 2HEOA 2RSMA 1DU6A 3CCSI 5CKTA 1MJ9A 2XUBA 4JX5A 3J80K 5F1JA 4R2RA 1YYKA 3QOEA 1H88C 4MO7A 1X19A 3C2HA 3EUAA 2R3SA 1MBEA 4HYEA 2JR1A 4LB6B 5FD6A 5L3GA 1KU2A 2EORA 2KONA 4JI0E 4IQ4A 4KIGA 1HSJA 1VQ9I 1ZU1A 5CQGA 5EG0A 2RDPA 4CUGA 4IQJA 4ESJA 2BE5F 3J81C 4AYBA 1UZCA 3M9AA 1HSTA 1MH4A 4BQOA 4FK5C 3BR2A 4A2UA 2WBUA 1LDDA 1FP2A 3FM3A 3MKYB 1AH5A 3B6CA 2EPOA 3MFKA 1FEXA 2P6SA 4DV3E 4R2PA 2UUBE 1Z6RA 2X1DA 5LRRA 3O8HA 3QP6A 2LKPA 4MQ9F 3S2HJ 2GXBA 4IHSA 4R03A 2Y9YA 1DI2A 5KHDA 4J01A 3PL8A 1LLMC 4XKCA 2L9SA 4B4CA 2NRAC 2EPKX 2F6CA 4RBOA 2YPNA 3EPHA 4A3FJ 1X1PA 1QRYA 3ZR8X 2WB1A 3GTOJ 2EINH 5CLSA 1YRNB 3FKIJ 3HOWJ 1LFUP 1K7AA 3OIOA 4G7ZF 3DTKA 1A1GA 4E7SA 1W7PD 1W7PB 2ZNZA 2M3AA 4I7HA 4HF1A 3RSNA 3F72A 5K7HA 5E3NA 3ZMZA 1MDMA 3VWBA 3ABLH 2HDDA 2HKXA 4LGWA 1YYOA 4A12A 3CMAI 2XIGA 3BDDA 5DCMA 3HOXJ 3OYBA 4YEJA 2VLAA 1Z1BA 4RLFA 1A31A 3BOQA 2IS2A 5HOOA 3S14J 2E36A 4HSRA 1A36A 5J3LA 5GADJ 3HGGA 3V42A 4HX8A 1XN7A 1B9MA 3H09A 2BOLA 3ZQ7A 2EA4A 2QQ9A 5BPIA 1P92A 1G6NA 1HNXE 2LR8A 2DYSH 5KAIC 1HC8A 2N3GA 3JAMC 2RPCA 3V8JA 2RS6A 1LKXA 3D1NI 3WU2C 2K7LA 4I02A 4MLQA 3MKWB 5A2QK 2D1HA 2K4BA 3T8TA 4BY1J 5ICFA 1Z77A 4IHXA 3F3XA 1B72A 4BQQA 4P78A 1G59A 2L2NA 1SAUA 2WBSA 4EEFG 4A3EJ 2DA1A 3NWSA 5H6QA 3EQ1A 4M3GA 1KJKA 4BBSJ 2XPVA 3I5UA 4HBLA 4JYAE 1OPCA 2QLZA 2EMWA 3FKJA 4AQYE 4RH8A 2YU5A 2ZXIA 1XNRE 3GTJJ 3RKXA 2ZBKA 2JUCA 5E3LA 4RB2C 4QIWN 5KAFC 3G1OA 5D8KB 1ZR4A 2GXAA 2VC1A 5JHFA 2LT7A 3KLNA 1YX3A 2P7VB 2W84A 2JRMA 2DTZA 2ODRC 4IHTA 4LFUA 1KQ8A 3AUZA 4FETA 4HEIA 1FWZA 4IOCF 3QU6A 1MEYC 3OOPA 2VE7C 4RB3C 4B43A 4LG0B 4LG3A 2DK8A 4I98B 2W85A 4BQAA 5GAHJ 5HODA 4AIJA 2LUPB 4I0BA 3KIOA 2NOGA 3CJQB 2LRSA 3SDGA 3K70D 1XSXA 4OWRB 4C2MJ 4AU7A 2CPNA 1HNZE 1E3HA 2F48A 2YTDA 1Z91A 2M7BA 2WY8Q 2EMXA 2Y31A 2GZWA 2EJ4A 4WCGA 1PP7U 1UG2A 5AC5A 1VQ7I 1F36A 5HVQC 5HLIA 3T1YE 1YS6A 4BNCA 4KHPE 1TN9A 1ETVA 1ON2A 3VYSB 2B7VA 5F27A 2ZC2A 1T4LB 1HQCA 1W4MA 1XGOA 3CC4I 5D5WB 3CUQB 3TO7A 1N34E 4IHVA 2XV4S 4MFDA 1N75A 1P9QC 1XMKA 3X2QH 3C4BA 4GGGA 5A2QZ 1FMWA 2CGPA 1ZBTA 1EF4A 1ZG5A 1YITI 4NC8A 5KNLA 2RAEA 2EPUA 3HTUA 2X9DA 1BC8C 3DJWA 2B7EA 3NAUA 4DV7E 3F8BA 1VQMI 3S3MA 4OINF 4Q28A 4HNTA 1ODDA 1A04A 2WZOA 5LHHA 1HKQA 2JA2A 1SMTA 2EMYA 1IO2A 1VI0A 2DA6A 3IH2A 3JSPA 1FTTA 1WXRA 2TCTA 3HZJA 3JW4A 1QU6A 1DPRA 1T08B 1GTKA 1H9TA 4F6NA 2YU8A 1KQ0A 2NVTJ 2ADRA 2Z3YA 1K83J 3GLXA 4BJ5C 4BUPA 3I4NJ 3U21A 3W6JB 3RTRA 3GYHX 5E17F 1PJSA 2XRLA 1WFXA 1E17A 2QBYA 3IWFA 3AG2H 1D8KA 3ABKH 1GZ6A 2BW3A 5AC4A 4YFXF 2EPNA 4II3A 5A6BD 3WG9A 1ZGJA 4E7LA 5AASA 4IRIA 1VNDA 2BZTA 3B73A 1L4SA 5FGMA 4B44A 1R5HA 2ZKZA 2JSCA 2EL5A 1JKQC 2UUAE 2DT6A 3Q9SA 3FXJA 1SD6A 4GEQB 1UJ8A 2OZ6A 2ZCWA 2DIXA 1IRZA 3D5SC 2UXNA 3I64A 2X1CA 2VQHA 1TWCJ 3F6OA 3HXLA 5DTDA 4ESFA 1QA6A 5KK1A 2BVLA 2MC4A 4HG2A 2NUEA 2F5CA 4MFEA 2VODA 2Z33A 2B9DA 3OS2A 2H8WA 2E2JJ 2F8BA 4Q35B 3ZMVA 1S7AA 4JI1E 1B6AA 1HW5A 2HGCA 5D6FA 3ZCOA 1CGPA 1WHQA 1WJCA 3TQNA 5DUKA 2EZ6A 2E5LE 2DA4A 1N36E 2OV7A 3HSFA 2CMPA 4MQVA 4B1RA 4WSPA 3I56I 3TBIA 4F55A 1TBXA 2NNYA 4EQQA 2W00A 2MW8A 1TZLA 2EPAA 1P7IA 1ULYA 1WJPA 3CESA 4PCQA 1I1GA 4P9UA 3JRGA 1MBKA 4RS8A 5DDGA 1RQ0A 1Y0NA 3OL3A 2GA2A 2O5RA 1ZR9A 5H6RA 2EMCA 1JK2A 2TDXA 4BMJA 2A5WA 5M5WJ 2JA8J 4F7ZA 1SD7A 1Z9CA 3WGIA 2LMZA 3FF5A 2DODA 4ZC3A 2HNHA 1X1CA 3HEFA 2J7JA 2EOYA 4O5GA 1I6HJ 2M87A 1EH6A 3R6SA 2DCEA 1OR7C 3GEZA 4IRGA 2VPRA 5FKNA 1AKHA 1G2FC 2FMYA 4FX0A 2MBFA 4JBAA 2E2IJ 3FMSA 1LFPA 3CJRB 4M6YA 4DR5E 1S29A 3V7RA 3CLQA 1T0FA 3LNQA 4U0WA 4XLCA 4KJZA 2COBA 3L2RA 1JK1A 1IC8A 3JREA 2FBHA 1DGCA 2LBFA 3OYFA 2UV1A 3G2BA 4KA4A 4UV9A 3K9TA 2LKXA 3BCBA 5E20A 4Q47A 3ADLA 1BM9A 1DU0A 5A69A 2HQRA 5D5VB 4BH9A 4NHRA 2HVRA 2M7AA 2XAGA 3Q0WA 3F8CA 1B4AA 3P7NA 1EA3A 1JKOC 1JXSA 2R7ZJ 4FE4A 1KQ9A 1WZ2A 1X49A 2R7SA 4CCKA 3OYAA 4O5VA 5AONA 2D9HA 3OSGA 4BXXJ 5DV5A 5DEQA 1R22A 4WXHA 4IXAA 4BJ6C 1FC3A 5ED4A 3KX2A 2CFXA 3O2PE 1P4XA 1ZLKA 1I50J 5HDKA 4IZZA 2HFHA 3J81K 2OTJI 3K2AA 1UHWA 1A1JA 1OCPA 4LFBE 4D9JA 3H92A 1IMUA 3AG4H 3GTLJ 3CLOA 2GA1A 2K9LA 4NQWA 5LD2C 2EM6A 2EQ3A 2NA2A 2CWEA 1WCMJ 2FMLA 4ANJA 3MHSC 3KFWX 1BJZA 2GM4A 2COMA 2L02A 4F54A 2CYYA 4A0XA 2MD5A 1U6GA 5M5YJ 4U0VA 3DP7A 5IY5H 1HDPA 1WJAA 2DYRH 3QYBA 1RR7A 4XLEA 3WGGA 4NXME 2EZHA 1EKZA 3RPUA 2JA5J 4X9JA 1TF3A 4I99C 5FFXA 3KWRA 2M34A 4B3ME 2GIVA 2EQ0A 4CCNA 2G7HA 3E6BA 2L9RA 2FQ4A 3K4KA 3L2UA 2PJRB 3F6GA 3S1NJ 4JP0A 1A1HA 3DTIA 3CUQC 3HRSA 3OYMA 5J8CA 1JHHA 3TKYA 4Y52J 3PM1A 3ZN0A 3QODA 5FJ8J 1KYZA 2DMNA 3ZMSA 4FE7A 2E7XA 2FEZA 3Q5FA 3S32A 2KOUA 3K69A 2D2WA 1TNTA 3ULQB 1IXSB 2FBKA 4I01A 2Y9ZA 1FIPA 1HA8A 5IYDJ 1J59A 1FBUA 3MZYA 2Q0OA 4MTEA 1A1LA 1O4XA 1TWFJ 2EIKH 3QRFF 1PJQA 3DTEA 3KETA 1N78A 3K6QA 3P1XA 3JRAA 2LD5A 2PEXA 1NCSA 1S8NA 2HTJA 3BJAA 3MVPA 1N32E 3UKGA 1IRXA 1W0UA 2FNPA 4MHGA 3ASNH 3HSRA 4BBRJ 2CTDA 4UNOA 3IUOA 1A5JA 1JUPA 5LGNA 2K86A 3K4JA 3RZDJ 4DR1E 1O57A 3JRBA 3J81Z 3NWTA 4CYCA 1OCOH 2ZO4A 3H1CA 1GHCA 2IA1A 3IRRA 3BR5A 3IL2A 3H3UA 3RDIA 4DUZE 3FHZA 1F9NA 1SFEA 1BOAA 2EBIA 2F5FA 3GTMJ 3QPHA 3S93A 2NXNB 1E3OC 2FGGA 1VFCA 1OCRH 2VE9A 3FDYA 3GLLA 3HYIA 3VEPA 3CMMA 2VL8A 5L3CA 5EYRA 5D4RA 1JKPC 5IPAA 1J0RA 1I6XA 2P8TA 4O3MA 3LQRA 2I8DA 2EV0A 4HV6A 3DFGA 2EV6A 1Q1HA 3M1CA 4RM3A 2M9HA 2CS3A 3BPXA 2WWYA 2HJJA 3DV8A 4R8OA 4HQMA 2VOOA 3HL2A 2HC5A 4GYIA 2EE8A 2LG4A 1UG0A 3BGHA 2K3FA 4S05A 5ICCA 2M4KA 3HM5A 3OIQA 2LV2A 4F52A 3PFIA 4L5JA 2JPCA 2DA7A 3KEYA 1Z7UA 2YSRA 1YIOA 5J40A 1XGNA 2HOEA 2JVGA 3JTZA 1EH7A 2L2OA 2PBIA 3CCYA 2EOOA 1U0JA 1ZK8A 1IF1A 4F3QA 2LUQA 1FYKA 1TWAJ 1MNEA 1IN4A 1IQOA 2QSFX 3SFZA 2QQ8A 2HPMA 1B8IB 3O6BB 3OIPA 4M0VA 4M9ZA 3ZQFA 3TW6A 5HS9A 3GFLA 2VQCA 2R7DA 1OLTA 3VOEA 3QP5A 3I9V2 3H5AA 4PSXA 3K4MA 2EWNA 4BHPA 4G7OF 4AM3A 4L18B 2YS9A 5JHUA 2JTVA 4TV7A 2ZXJA 2O61A 3J7AY 2UZKA 4PFOA 5K7ZA 2OA4A 3MN2A 1WH7A 2ENHA 4XKWA 3J7YJ 1MSFC 1TP4A 3PO2J 3WHCA 2Z2SB 4ZYGA 4ZZLA 2WBMA 4K0KE 2X48A 1X5WA 2WC2A 2R7XA 4BHBA 2CO5A 2VASA 2CV2A 5K5QA 3PUBA 3HUGA 1WVRA 1RR8C 3WE2A 5HDNA 2JOXA 2YSOA 3LL7A 1L0OC 4BS9A 2W7NA 2NVQJ 1R36A 1Z1DA 2ZXHA 1BJAA 2VJ4A 3W6VA 4EV0A 1MZBA 1X1BA 3I59A 1HW2A 1IZ1A 4JX6A 1MNDA 2R0QC 2CU7A 1IG7A 2NS0A 3BTIA 3J7Yp 3RI4A 5JLXA 3FZVA 4KFCA 2ELJA 2FXAA 2MKNA 1JE8A 3T5XA 2E1NA 1KU9A 4X66E 3IWZA 4UB8C 3GBGA 4QTRA 5C4XJ 4DR6E 1XC5A 2ISZA 5EGOA 3LSMA 2LDUA 3H3ZA 4G8XA 4JI5E 3L2VA 2A3SA 2QQAA 2ESNA 3KP2A 2L9NA 3BTJA 3R60A 3EYIA 4O4KA 2RNGA 4XLFA 2R5YB 2HYGD 2YRKA 2E1MC 2QZ8A 4DOZA 1WI3A 2MSYA 4XSZF 4QSHA 2HVQA 5DM7F 3OYDA 4R2QA 2M45A 5A6AA 2L01A 2HVSA 1S3JA 3OMYA 1RETA 3E1SA 2FD5A 3H36A 4M3FA 1U9NA 2VI6A 3Q9VA 3BF2A 4HRIA 1USSA 2LTPA 1IGNA 1MJBA 3E5XA 4HOBA 2FOKA 3HKZN 1RC9A 2HYFA 4HX4A 3BZCA 5JVTA 3U9GA 1X48A 4CA0A 1Z67A 2IS4A 5EG0B 2LFBA 2HYJA 2KT0A 3JTGA 2K9NA 3VYUB 3DBLB 4F2JC 3ECRA 3IWCA 1KA8A 2EMBA 5F08A 4XKBA 3PO3J 2IP2A 2KHMA 3VK6A 4R2CA 4RGRA 5ICGA 2FA5A 4HNVA 3E6CC 1AHDP 2CUZA 1SFUA 1AOYA 3S2DJ 2EMGA 1G2HA 2K40A 4NC7A 3WGHA 1LVKA 4LLGF 4UUSB 3PQJA 3S16J 2X51A 4ETSA 3OSFA 2EM8A 1R71A 3FWEA 1RESA 5E8IA 1YLFA 1MW7A 5L3EA 1YIJI 4U7DA 4NHJA 2OCEA 4KICA 3DKWA 3WTTC 4A3LJ 1NHAA 4CXFA 1DGRM 3JRCA 3GF2A 2FF4A 2XAQA 3AFHA 4DGWB 2DOFA 2FOWA 2ESHA 3DQVC 5T6JA 2LLKA 5C3EJ 1S5LC 3BG5A 4NBQA 3ZGKA 2Z5UA 2R7OA 2LF7A 2ZFWA 3HKZA 4L9JA 2BB8A 4EGZA 1UHMA 1YFHA 2EOMA 1JT6A 1I39A 2EPLX 3P9CA 1N3GA 2V87A 4OIQF 2ZJRF 2XF6A 3F8MA 1J09A 5EEGA 4M30A 1MJAA 1BR2A 2KRHA 2B9SA 2FX0A 4KN7X 4L9VA 1QNTA 4NNJA 2P81A 5J1RA 2ME0A 5FRNA 3MQ0A 1B1BA 2M2EA 4P55A 5GPCA 4RDUA 1NG6A 3RQIA 1KYWA 4LITA 3I54A 4KIBA 3K7AJ 4HEA2 1G3SA 4KISA 2YTNA 2IXSA 3CCMI 1J7KA 2DFIA 4C2TA 1QHGA 1A1IA 1BC7C 2AXLA 3KP3A 5ICEA 2O8KA 2K85A 3M1EA 4HDVA 1B72B 1YYVA 1K4SA 2EMAA 2IW5A 2BHZA 2JPAA 2HI3A 1J5EE 3OWTA 2LCEA 3SYTA 1J5YA 1GVJA 2EN2A 4NB5A 1YS7A 3AL0C 4KN4X 1QVTA 5GP9A 4O43A 1XTAA 1P4AA 2XAHA 3WTZA 2V8QB 1RC7A 2JQ7A 2JZYA 1IXCA 4EGYA 2DJNA 2QVOA 1XDSA 1ONVA 1R5GA 1BN5A 4V19K 4M3BA 2ZMEA 5BS6A 2VXZA 3ADGA 2ZFUA 3HG9A 3BG7A 2DMQA 3N05A 2CV1A 4JOMA 1X6HA 2DTRA 1G4DA 2L33A 2R5ZA 3F9KA 2M1SA 3GZNB 3N4MA 1OCZH 1MMGA 4KITB 1SVLA 3LMLA 2ID6A 1LJ9A 3CZ6A 2BGCA 1Y6IA 2KZVA 1NG7A 3OYCA 4LFAE 3DLLF 1SD5A 2L3DA 2JOBA 2MC5A 3THNA 5FFZA 3M4OJ 2A25A 3WTUC 1WPKA 4JI8E 3QU3A 3EETA 4KT5C 4PUSA 3Q3SA 1YUJA 2V1NA 3GZ5A 1ETKA 5E1XA 2VPLA 4Z2YA 4M2ZA 2YPRA 4BDZA 1RKWA 4J19A 5TJJA 4DYRA 4PK4A 4LFCE 1ETOA 1TLHB 1E2XA 3QOPA 4KWYA 2HS5A 3HPHA 4XR6A 3RKYA 1RRJA 2MD0A 5GTHC 1MIJA 2V85A 3J80Z 3A1YA 1HCRA 1YZ9A 3DBRB 1LDKB 2YTGA 2UXDE 4DW6A 1RUOA 2KQRA 3TW7A 1ACIA 1JTXA 5HNHA 4BXFA 5EZGA 5LL6R 4UVAA 1D1AA 2E5ZA 1BA5A 2W82A 3PSFA 3VYXA 3EQLF 4IOAF 3V8KA 2BY3A 4DYQA 3WTWC 3CDIA 2QA4I 4YIIA 2H94A 2N8GA 2O0YA 1XMXA 3K4CA 3DCFA 3OYEA 3FIGA 3J7AG 2JMWA 1ETQA 3HHHA 2EIJH 3OYNA 4AWXB 1A6QA 2CUFA 2HWVA 2P4WA 3KP4A 3LSIA 4ZYEA 4HA8A 2YTOA 3IH3A 2ELKA 3LSJA 3K2ZA 2QSGX 1T98A 2F4MB 4H4KC 1TT0A 2ICWG 1G2DC 3ZP5A 5F0FA 3COAC 1ZAOA 4F9BB 3SZGA 3K6GA 3OYKA 1RMDA 3BZ6A 2CW0F 5F04A 1U2WA 1O3SA 2EMLA 2M4GA 1HOMA 4E7JA 4HAMA 4ZJZA 2Y0MA 2QKMB 3UR3C 2H09A 4XLAA 5F0HA 2ZMEC 3BWGA 1YRNA 4BCAA 1AAYA 4IVNA 2HOAA 4GXOA 3WG7H 3T0YA 2EQRA 4YG2F 1HDDC 1XCBA 2GAUA 4M9VC 1V54H 1TWGJ 2EILH 3HSEA 2F2EA 2LJHA 4MIMA 1BL0A 3HGYA 3PSIA 2IGMA 2WV0A 3K4LA 4WSGA 2Y30A 1FMVA 2HKOA 2NVUB 1SFKA 4KMFA 2LSOA 2IS1A 4TUGA 4PGHA 4JYKA 3HDDA 1W5SA 3OMLA 1ZKGA 3BG9A 3T1HE 1HKTA 2XRNA 2EOIA 3FBIB 1OR7A 2EZLA 5JVGF 4WFTA 2P5LC 3ZN1A 3C6KA 2H8RA 2XAFA 1U8RA 2ELYA 5AE1A 2LREA 2DMUA 5E1WA 3TOBA 2L7FP 4BHCA 2EMKA 3RQ4A 5KL7A 4HSTA 2EA2A 1ITYA 2GLOA 2HXOA 1OYIA 3M07A 4CYDA 1H0MA 1VQLI 1ZG3A 2DO7A 2KIFA 3L2WA 2XKOA 2EJRA 2BY1A 1X3WB 4CZCA 5GTIC 2LVHA 1IRGA 4DZPA 3A2KA 1FSEA 4ENMA 3QPLA 4WWCA 1XS9A 3AV0A 1BI0A 2ZNYA 3A03A 4IJAA 3NRVA 4A5MA 3IAM2 1I94E 4BE0A 2BY2A 2LP0A 3QYFA 3ECHA 2E7WA 5CJ9A 2OUMA 3DBHB 2OC6A 1A35A 1NEIA 2EL4A 1V55H 2KDOA 2IPQX 4IHYA 2DGCA 3KZZA 1FY7A 1P6RA 2ELHA 3HOUJ 4PJLA 4HPQA 3IAS2 2LC2A 4KMUX 4RA2A 2RQLA 5J4YA 1SC7A 3QWLA 4RAYA 1M1EB 5D5UB 1MBFA 2LK2A 2V88A 2VB6A 1IAWA 4N4NB 1XSVA 2IJLA 2LBFB 1DP3A 1VQ4I 1X1DA 2F4IA 5C44J 1HF0A 3ZPLA 5E79C 1W36D 4GZNC 3O3KA 3CTAA 3LA2A 5IT9C 4BC9A 2O03A 2K3PA 3CDLA 2OAZA 1IDZA 2QENA 3H5RA 1QZEA 1MSEC 3H0GJ 2KL4A 4XLNF 4IEJA 5KL4A 4ZDPA 5CYVA 4RLQA 5CVRA 5LFAA 5CFFE 3RYRA 1BOBA 4BU2A 1LB2A 1PJTA 1NTCA 4DZJA 2CV0A 1QU3A 3HPGA 3V7SA 3ZMTA 5J4VA 1IN8A 1ENHA 1ZGAA 1BI1A 3VSKA 1AU7A 1T39A 3M99B 2HGHA 3B6AA 1FBQA 1WRJA 1AA7A 4DUYE 4HW0A 4DR3E 2VOPA 2ID3A 2QYOA 3HRMA 2MKDA 2VJIA 2VT3A 3OR2C 4XKVA 3CUQA 1G3YA 3JCUC 4M71A 3ZQIA 2VBWA 1H8AC 1G3TA 3CCVI 1J9IA 2V86A 2PG4A 4BACA 4Q5SF 2UXCE 1FOYA 3TDZC 4D5CA 2X85A 5J1YA 5GAEJ 2NYXA 4XRFA 2KIUA 4NQWB 2EOEA 2ZSIB 4L9NA 1Y56A 3BQZA 2IHR1 2DT5A 4OAZA 1R4MB 4J00A 2YUSA 1DGWY 1POGA 1Z6TA 4MLVA 2YU9J 1IV8A 2DLQA 3K4NA 3F0CA 1YI2I 2E19A 2XGDA 3NARA 3WTXC 2LYCA 3RPUD 1Y0UA 2RC4A 3OYHA 1K79A 1ZRCA 2EIMH 3LSHA 1R00A 2HXIA 3E6MA 1BR1A 5B3SH 5IOYA 2FU4A 1FOKA 4HF0A 2GOMA 4FASD 1FTZA 5FKLA 3SQNA 1EKEA 2DRPA 1OISA 3S17J 5FLXC 2EPPA 5ERIA 4XN0A 3HJEA 5DD8A 4BL0B 2Z1DA 3ROUA 4DBQA 5BOXA 1YG2A 1D0YA 2K9QA 2LF8A 2L7KA 3K4BA 1PUEE 1X47A 3NEUA 1HNWE 3IKVA 3SEQA 5IXMB 2HQAA 4LK0F 4W1UA 5JFRA 2RQPA 3CCUI 4A3JJ 2DOEA 4ZDOA 1IN7A 2PMZN 2PRTA 2EQ1A 2CQKA 2QUFA 1QHHD 1UAAA 4ZDLA 4E7ZA 1OJLA 2DDBA 2ME6A 5L3DA 3E97A 4BE1A 2YWQA 2OZUA 2YU3A 3TP0A 3LSKA 3FXUA 3ESWB 4RMNA 5H20A 3ZQGA 5HLGA 5KL5A 3GMEA 3ZQHA 4K2EA 2G9WA 3LQQA 4IJDA 3BR3A 1WJFA 3F8FA 1WGXA 5LMUE 5BNGA 4ESBA 1FLIA 3MD2A 2IT0A 1DDNA 2R93J 2NNNA 4CYCB 3MAJA 2JWTA 4YELA 3FK7A 4DMIA 5F1RA 5FLMJ 4R1HA 2B3TB 1D1CA 3V4GA 2XSDC 4HF2A 4OIPF 4M73A 3K70C 4BQNA 1O3TA 2HPIA 2ACJA 2RQQA 3PIPF 4O24A 2UWMA 3I55I 2VJ5A 2JVAA 2YTPA 1ZLJA 3HQ1A 1TW2A 2MFZA 2ISYA 5F0CA 1PYVA 2ZJQF 3L09A 2A07F 3VYRB 3ZQCA 1VQOI 4Q4ZF 2VONA 3CUOA 4B09A 1OQYA 5GPAA 3CQZJ 2NVYJ 3RIRA 4XONA 2CFOA 2ZJ2A 3PFYA 1B59A 3E3VA 4G6TB 2CH0A 1X6FA 2PMZA 2V1UA 5IWAE 1MMDA 2L7ZA 1ZARA 3W6KB 2BHYA 4A69C 3ERED 5E3MA 4GYGA 3BCAA 1X4OA 2M8GX 2EMZA 3MWMA 1IV6A 1Z7LA 3UK3C 4UB6C 2EMIA 4F9CB 2FRHA 2M0MA 2EMFA 2CQQA 1G3WA 2XPUA 4F93B 5B1AH 3TL4X 1B69A 5JI6A 4XL9A 2RSIA 1SR9A 5GAGJ 1TT5B 4DV4E 4C3HJ 1WWXA 5AE2A 5FKKA 2MC3A 3JAMK 5TGTA 1FYMA 4E6KG 5TISC 5EDNA 1FZPB 4M9SA 1YPNA 1P4WA 2XAUA 3QYEA 4CCMA 2MLGA 1PUFB 2OTLI 3HB9A 4EM2A 3W3CA 5L3BA 3VFZA 3S15J 2Y2ZA 1S72I 3KP6A 1D0XA 2F5DA 3DWLE 2STWA 2VIXA 3EPZA 2M5WA 4L0YB 5FRMA 2EM9A 2R1FA 3WU0A 3GUDA 1JJ6C 4LF8E 3HUGB 1S7EA 5A2QC 1JUSA 4LLNA 2H1LA 3M8FA 4X1EA 3S3OA 1SFOJ 1MNMC 2E1MA 3ABMH 2W4SA 3TMOA 3GTGJ 2DOAA 3A0HC 4RAZA 1LQ1A 1GV5A 3I59B 2K7IA 2LO3A 4ZYDA 1X2MA 5AIPA 1F5TA 3FXKA 1FJGE 5BPDA 1LE8B 5M5XJ 3M3YJ 2RN7A 2ENAA 3WHBA 4WXCA 3RPQA 2H27A 4LF5E 3BLYA 2GQQA 4D5FA 3HPZA 1VTNC 1H89C 3C18A 5EGOB 2TRTA 1N77A 4P9FA 4UXNA 4BEHA 2EFOA 5B5EC 4RAGA 4RM2A 5F64A 4EM0B 1LDJA 1XMQE 5A6KA 3CP8A 2V4JC 2EOZA 1SAXA 1UILA 1YW7A 2EL6A 1YUIA 4HDUA 3R61A 3IKTA 2X0LA 2R7QA 2Q8KA 4DJAA 1Y39A 3GXOA 2DSYA 2QEXI 1X3CA 3L00A 4XLHA 4JX4A 4PGGA 3BG6A 4M3EA 1Y1WJ 1LEAA 1HW1A 2VF1A 5BQTA 4BKXA 1X6EA 2K4JA 1OCTC 2CSHA 1W5TA 2EH3A 1U8BA 2YT4A 2J5OA 2KJBA 3JAMZ 3PNYA 3VB2A 1N33E 4X65E 5D6EA 3H9GA 1IN6A 1D5VA 1NH3A 2QQBA 1K78A 4X8WA 1V5FA 4CH7A 3IV5A 2EFNA 1Z05A 3KYLA 2L4MA 1FYLA 4NXNE 4E7IA 1VQ8I 3CF5F 2EM2A 2YX7A 1DQUA 3S8PA 2R76A 2XGXA 3ERMA 2H6CA 3CJTB 3ZRGA 4GKKE 2OF7A 1U5TB 5B66C 3W2WA 2JRTA 3IH4A 4U88A 4XOTA 4Y33A 5LBQA 3GTKJ 2NUGA 1XX5A 1S7OA 1TQPA 2YZTA 4LU9A 1P2FA 3BIDA 5K1YA 5TSEA 3HHGA 5ADZA 1TTYA 3FXMA 1QQIA 3A02A 2BV6A 2K9MA 3S3NA 5BR8E 2HQNA 3P5JA 4W97A 4G7HF 3LFUA 3G3ZA 4X6AJ 2P5VA 1HXDA 4DV6E 4CCJA 2ZJPF 2EN7A 4FQGA 1W5CC 4RAFA 2M7QA 2I5UA 3OL4A 1J2XA 3WTSC 1UMQA 2RGVA 2DFHA 2X6XA 4Y7NJ 1FKAE 1Y1VJ 2GLIA 1ON1A 2EN1A 2EM5A 3EPLA 1JHFA 4N0BA 3GVAA
chains in the Genus database with same CATH topology
3KLOA 3ABUA 2WTEA 2O6GE 3HOSA 1V3FA 2EFWA 3OV8A 2PI0A 1O3QA 3FXQA 3R0AA 4HLXA 5IT9K 4CICA 1WSUA 4CO8A 3SXYA 3CDHA 4O6JA 3LA3A 3BP8A 4S04A 1D3YA 2BBYA 1OYWA 2DQRA 3F23A 4HLYA 2DLLA 1KGSA 1I27A 1STZA 4P96A 4UV8A 4OMZA 5KVRA 3L9FA 3F21A 4BAYA 2C6YA 3E5UA 3MEXA 3NQOA 5DCFA 4FHTA 2Q2EA 5CVUA 1HKSA 4KNYA 2FBIA 1CF7A 2RVCA 4R8HA 2AS5F 1MDMB 5CVJA 4HX7A 5DCMB 2DAOA 5FLXK 1FSHA 4AD9A 2MA3A 4UUVA 3FM5A 2M1BA 2STTA 3ABTA 5IT3A 1MD0A 4M72A 1USTA 1QBJA 2PJPA 3E5QA 1I5ZA 1RIOH 1BI2A 3QPTA 5IT9Z 3D0SA 4UVBA 3RYPA 2VC0A 4HZFA 5L3FA 4AVPA 1FBSA 1MGTA 2PMUA 3HRTA 3KP7A 3ELKA 1ZRDA 1L3LA 3DXJF 3LWFA 1BI3A 2A5YB 3DPTA 4WXDA 4HQEA 3GFJA 2A68F 1OMIA 2PFBA 3KEOA 1R1VA 4EJVA 2IRFG 1WKMA 2OD5A 1FPQA 5LHGA 2FQ3A 5E18F 1TW3A 5CVIA 1QPMA 2LNBA 4ZYHA 4LB5A 4H0EA 4EJTA 5DUIA 3GFIA 4N9IA 4KUMA 5JR3A 5FLXZ 3FX3A 2RNJA 1O7LA 4RB1A 4KYWA 3WTVC 4N9HA 2DK5A 2W57A 1PP8F 1XDUA 1O7FA 2K27A 6PAXA 3U1DA 3KZYA 3GX4X 2YX4A 4YFNF 5K5RA 3BROA 3ZMDA 3M7GA 4A0YA 4EJUA 1U5TC 3S2WA 2Y48A 4EJOA 3P9KA 5FB2A 1U78A 4YIFA 2YR2A 3U2RA 2MH2A 5DD4A 3LA7A 2OQRA 1WQ2A 2R7FA 2IVMA 3L7WA 4RGSA 1T2KA 3EDPA 2MH9A 1PDNC 2QBYB 5J8FA 1XB4A 1YW8A 1YW9A 1U3EM 4M6XA 4FX4A 1C0WA 2KRFA 1O3RA 3LFKA 2KIMA 1R1TA 3KP5A 1W7PA 5LHIA 1RI7A 4Y17A 4OMYA 4OIRF 3IHUA 4A6DA 3MZHA 1MKMA 3SZTA 4WX9A 1R23A 2EFQA 2HTSA 4EM1A 1I1SA 1B9NA 4L0ZB 4M74A 3WODF 2IA0A 2VN2A 5F6FA 2Z9OA 2A61A 1QZZA 2P6TA 1GXQA 2XROA 2GWRA 3F8NA 3ECOA 4XBFA 2FNAA 1ZYRF 3FMQA 4EVIA 1QO0D 3TGNA 5LLQA 1REPC 1ZRFA 1DUXC 3HRUA 3D5LA 4IPAA 2RV8A 2CSOA 3I71A 1DP7P 1FX7A 5K5OA 1BBYA 2A6HF 5LGTA 3R0JA 4U7BA 2OBPA 3GW2A 1J75A 4RGUA 1BIBA 4LG0A 2G7UA 4L5IA 5E1ZB 1YQAA 1DPUA 1XMAA 3GO5A 4ENKA 3M8EA 1SMYF 3WTYC 5LGUA 2NAZA 4PDKA 3DEUA 4CHUA 1JGSA 1KU7A 3GZ6A 1OKRA 1S6LA 1QZYA 1RUNA 2VBYA 1F4KA 2DU9A 3HTSB 3MCZA 1BIAA 2PN6A 5FD5A 3CJNA 4PZJA 2GXGA 2P5KA 3KCCA 4CGZA 4LJZF 3FMRA 4JQFA 1FT9A 4U0YA 4YFKF 3C1DA 1AWCA 3F6VA 4MGRA 3SZPA 2CG4A 2A69F 3K0LA 3LSTA 1ZN2A 1SD4A 2O3FA 5ILVA 2MLKA 4DNCA 1ZHFA 2H6BA 2HR3A 1YTYA 3F22A 2BEOA 4CDGA 2E1CA 3K1PA 2VBXA 4MEXF 4KDPA 1R7JA 5EEHA 2W25A 4I0AA 4A6EA 1X3UA 2EK5A 4I2OA 3KEQA 1TNSA 2QWWA 4KIFA 2VT2A 5ILUA 2HZTA 3BY6A 4ENNA 3BJ6A 2X4HA 1HBXG 1V4RA 4OU0A 2DPUA 5BMZA 1RNLA 4MNUA 1XSDA 2PMHA 2V6CA 2PLYA 3IC7A 4ZZDA 3FXRA 3G73A 2XASA 3JSOA 5TRDA 1UCRA 1EH8A 2HDCA 2P7CB 4B8XA 1OYYA 5ILSA 4GO1A 4DQ2A 2BYVE 5LEKA 3I0TA 4G94A 2F5EA 3P9IA 2XVCA 1FP1D 4I09A 3BPVA 5LRSA 3BJOA 5FO5A 3T8RA 1K78B 1TQIA 1T38A 3PQKA 2DPDA 1KU3A 3CO7C 4ASNA 2A6EF 3LAJA 3KE2A 3WU1B 5D8LB 5E8GA 1FNNA 3AAFA 3DPLC 1UFMA 4WF2A 2ADUA 1H9GA 4ZH4F 4LD5A 4UHTA 4ON0A 4LLLA 2D45A 3ML6A 4QWQA 4EMSA 2DW4A 4EJWA 4CZZA 4Y13A 2OQGA 1IW7F 1IXRC 3SHFA 3TO6A 5HLHA 2VBZA 3V7CA 1XD7A 4JK1X 2RKHA 2M30A 4GCVA 2D1VA 2DBBA 5D4SA 4RGXA 2XHKA 2PQ8A 5HS8A 2M8EA 2K02A 4OIOF 3C3WA 5D5XB 1IN5A 2J5PA 4OOIA 1GXPA 3EYYA 4XLPF 4HV5A 3N97A 1LNWA 4LMYA 3HOTA 3I53A 2EB7A 2XKPA 3RKWA 4A0ZA 4IF4A 3HIFA 3RJPA 1XCVA 3I58A 2V1DA 3CO6C 3J7AO 2L4AA 4QLCU 4LK1F 2KKOA 1R1UA 4MTDA 3IRQA 4Y15A 1CF7B 4WK8F 1ZG1A 3R4KA 1XGMA 1ZREA 4AIHA 3K1MA 1EV7A 1YO5C 2UXXA 2Y75A 5LEJA 4P5OA 4UVCA 3REOA 1IRFA 4AIKA 4A5NA 4MEYF 2L54A 4E70A 3QAHA 4FT8A 2FSWA 3GWZA 2ETHA 2DI3A 2VE8A 3WE3A 5CVVA 3TO9A 3VODA 3TOAA 1D8JA 2V79A 5HS7A 4L9TA 2OU2A 1F1ZA 1UB9A 2EV5A 2JPBA 2KJCA 2DQLA 3V8LA 1WI9A 4IRHA 2ZMEB 4R79A 1TQMA 2XAJA 4ENJA 3ZMUA 1QGPA 1SFXA 3ISPA 2Z99A 4BXUA 2W24A 3L2CA 2B0LA 4G6QA 1U5TA 3B02A 3GFMA 2QM3A 1R58A 2IA2A 3K1NA 4G9YA 2FE3A 5HDGA 3LAPA 2EFPA 4XSXF 3EUHA 4G6DA 4RB0A 3E6DA 2V1XA 4D0PA 3DF8A 4BYYA 5DYMA 1XGSA 3I4PA 1IUYA 4M9XA 2O8XA 3T1BA 2JT1A 1LEBA 4Q48A 2V9VA 1ZH5A 1RZ4A 1K6OA 3C7JA 1T6SA 5AIQA 3JTHA 3TDUC 5J6XA 1LVAA 2HEOA 1MJ9A 2XUBA 3J80K 2R3SA 4HYEA 4LB6B 5FD6A 5L3GA 1KU2A 4KIGA 1HSJA 2RDPA 4ESJA 2BE5F 3M9AA 1HSTA 4A2UA 1LDDA 1FP2A 3FM3A 3MFKA 2P6SA 1Z6RA 5LRRA 3QP6A 2LKPA 4MQ9F 2GXBA 4IHSA 2NRAC 5CLSA 1K7AA 4G7ZF 1W7PD 1W7PB 2ZNZA 4I7HA 4HF1A 3F72A 3ZMZA 1MDMA 2HKXA 4LGWA 4A12A 2XIGA 3BDDA 5DCMA 3BOQA 5HOOA 4HX8A 1XN7A 1B9MA 3ZQ7A 2EA4A 2QQ9A 5BPIA 1P92A 1G6NA 3V8JA 2K7LA 4I02A 5A2QK 2D1HA 2K4BA 3T8TA 5ICFA 3F3XA 5H6QA 3I5UA 4HBLA 1OPCA 2QLZA 3RKXA 2ZBKA 4RB2C 5D8KB 2VC1A 3KLNA 2P7VB 2W84A 4IHTA 4LFUA 1KQ8A 1FWZA 3QU6A 3OOPA 4RB3C 4LG0B 2DK8A 4I98B 2W85A 4BQAA 4AIJA 4I0BA 1XSXA 1Z91A 2GZWA 4WCGA 1PP7U 5HVQC 5HLIA 1YS6A 4BNCA 1ON2A 1HQCA 1W4MA 1XGOA 5D5WB 3CUQB 3TO7A 2XV4S 1XMKA 4GGGA 5A2QZ 2CGPA 1ZG5A 3HTUA 1BC8C 3F8BA 4OINF 1ODDA 1A04A 5LHHA 1HKQA 1SMTA 3JSPA 3JW4A 1DPRA 1H9TA 1KQ0A 2Z3YA 3GLXA 3W6JB 3RTRA 3GYHX 5E17F 1E17A 2QBYA 3IWFA 1D8KA 4YFXF 3WG9A 1ZGJA 4IRIA 3B73A 5FGMA 1R5HA 2ZKZA 2JSCA 3Q9SA 1SD6A 2OZ6A 2ZCWA 2UXNA 3I64A 3F6OA 4ESFA 5KK1A 2F5CA 2VODA 2Z33A 3ZMVA 1S7AA 1B6AA 1HW5A 2HGCA 5D6FA 1CGPA 3TQNA 5DUKA 3HSFA 4MQVA 1TBXA 2NNYA 4EQQA 1ULYA 4PCQA 1I1GA 4P9UA 4RS8A 5DDGA 2GA2A 5H6RA 2TDXA 4F7ZA 1SD7A 1Z9CA 3WGIA 3FF5A 2M87A 1EH6A 3R6SA 3GEZA 4IRGA 2FMYA 4FX0A 2MBFA 4JBAA 3FMSA 4M6YA 1S29A 3V7RA 1T0FA 4U0WA 2FBHA 4KA4A 4UV9A 3K9TA 5E20A 4Q47A 1BM9A 2HQRA 5D5VB 4BH9A 2XAGA 3F8CA 1B4AA 3P7NA 1JXSA 1KQ9A 4O5VA 5AONA 5DV5A 5DEQA 1R22A 4WXHA 4IXAA 1FC3A 5ED4A 2CFXA 3O2PE 1P4XA 1ZLKA 5HDKA 2HFHA 3J81K 1UHWA 3H92A 3CLOA 2GA1A 4NQWA 2CWEA 2FMLA 3KFWX 2COMA 2L02A 2CYYA 4A0XA 2MD5A 1U6GA 4U0VA 3DP7A 3WGGA 3RPUA 5FFXA 2GIVA 2G7HA 3E6BA 3CUQC 3HRSA 5J8CA 1JHHA 3TKYA 3ZN0A 1KYZA 3ZMSA 2E7XA 2FEZA 3Q5FA 3K69A 2D2WA 1TNTA 3ULQB 1IXSB 2FBKA 4I01A 1J59A 1FBUA 3MZYA 2Q0OA 4MTEA 3QRFF 3KETA 2PEXA 1S8NA 2HTJA 3BJAA 2FNPA 4MHGA 3HSRA 4UNOA 5LGNA 2K86A 1O57A 3J81Z 2ZO4A 1GHCA 2IA1A 3IRRA 3IL2A 3H3UA 3RDIA 3FHZA 1F9NA 1SFEA 1BOAA 2F5FA 3QPHA 2VE9A 3HYIA 3VEPA 5L3CA 5D4RA 1J0RA 1I6XA 2P8TA 4O3MA 3LQRA 2EV0A 4HV6A 3DFGA 2EV6A 1Q1HA 3BPXA 2WWYA 3DV8A 4HQMA 2VOOA 4GYIA 4S05A 5ICCA 3PFIA 4L5JA 2JPCA 1Z7UA 2YSRA 1YIOA 1XGNA 2HOEA 1EH7A 2PBIA 1IF1A 1FYKA 1IN4A 3SFZA 3O6BB 4M9ZA 5HS9A 3GFLA 2R7DA 3VOEA 3QP5A 2EWNA 4BHPA 4G7OF 4L18B 5JHUA 2JTVA 4TV7A 2ZXJA 2O61A 2UZKA 2OA4A 4ZYGA 4ZZLA 2WC2A 4BHBA 2CO5A 5K5QA 3HUGA 3WE2A 5HDNA 1L0OC 1R36A 1Z1DA 1BJAA 4EV0A 1MZBA 3I59A 1HW2A 1IZ1A 2NS0A 3RI4A 3FZVA 4KFCA 2FXAA 1JE8A 3T5XA 2E1NA 1KU9A 3IWZA 2ISZA 2LDUA 3H3ZA 4G8XA 2A3SA 2QQAA 2ESNA 3KP2A 3R60A 3EYIA 2HYGD 2QZ8A 4XSZF 2M45A 2L01A 1S3JA 3Q9VA 1USSA 1MJBA 3E5XA 4HOBA 2FOKA 2HYFA 4HX4A 5JVTA 3U9GA 3JTGA 1KA8A 2IP2A 4RGRA 5ICGA 2FA5A 3E6CC 1SFUA 1AOYA 3WGHA 4LLGF 3PQJA 4ETSA 3FWEA 5E8IA 1YLFA 5L3EA 4U7DA 4NHJA 4KICA 3WTTC 3DKWA 1NHAA 4CXFA 3GF2A 2FF4A 2XAQA 3DQVC 2ESHA 2Z5UA 2LF7A 2ZFWA 4L9JA 4EGZA 1UHMA 1YFHA 3P9CA 4OIQF 3F8MA 5EEGA 1MJAA 4KN7X 4L9VA 1QNTA 3MQ0A 1B1BA 4P55A 1KYWA 3I54A 4KIBA 1G3SA 1J7KA 2DFIA 1BC7C 2AXLA 3KP3A 5ICEA 4HDVA 3M1EA 1YYVA 2IW5A 1J5YA 1GVJA 4NB5A 1YS7A 4KN4X 1P4AA 2XAHA 3WTZA 2JZYA 1IXCA 4EGYA 2QVOA 1XDSA 1ONVA 1R5GA 1BN5A 2ZMEA 5BS6A 2VXZA 2DTRA 1G4DA 3N4MA 1LJ9A 2BGCA 1SD5A 2L3DA 5FFZA 3WTUC 3QU3A 3EETA 4KT5C 3GZ5A 5E1XA 4Z2YA 2YPRA 5TJJA 1TLHB 1E2XA 3QOPA 2HS5A 3RKYA 3J80Z 1LDKB 1RUOA 4UVAA 3EQLF 3V8KA 3WTWC 4YIIA 2H94A 2O0YA 3HHHA 4AWXB 2HWVA 2P4WA 3KP4A 4ZYEA 4HA8A 3K2ZA 1T98A 3ZP5A 3COAC 1ZAOA 3BZ6A 2CW0F 1U2WA 1O3SA 4HAMA 2Y0MA 2H09A 3BWGA 4IVNA 4GXOA 4YG2F 3T0YA 1XCBA 2GAUA 3HSEA 2F2EA 2WV0A 2HKOA 4KMFA 2LSOA 4PGHA 1W5SA 1HKTA 2XRNA 1OR7A 2P5LC 3ZN1A 2XAFA 1U8RA 5E1WA 3TOBA 4BHCA 2EA2A 1OYIA 4CYDA 1H0MA 1ZG3A 2DO7A 2KIFA 2XKOA 2EJRA 1IRGA 1FSEA 4ENMA 4WWCA 1BI0A 2ZNYA 4IJAA 3NRVA 4A5MA 3ECHA 2E7WA 5CJ9A 2IPQX 3KZZA 1FY7A 1P6RA 2ELHA 4KMUX 4RAYA 5D5UB 1IAWA 1XSVA 2IJLA 3ZPLA 3O3KA 3CTAA 3LA2A 2O03A 2OAZA 2QENA 4XLNF 5CYVA 5CVRA 3RYRA 1LB2A 3V7SA 3ZMTA 1IN8A 1ZGAA 1BI1A 1T39A 1FBQA 1WRJA 4HW0A 2VOPA 2QYOA 3HRMA 2VT3A 3CUQA 1G3YA 4M71A 2VBWA 1G3TA 1J9IA 2PG4A 4Q5SF 3TDZC 2NYXA 4XRFA 2KIUA 4L9NA 2DT5A 1Z6TA 3WTXC 1Y0UA 2RC4A 1K79A 1ZRCA 1R00A 3E6MA 2FU4A 1FOKA 4HF0A 3SQNA 5ERIA 5DD8A 5BOXA 3ROUA 1YG2A 2LF8A 1PUEE 3NEUA 3IKVA 4LK0F 5JFRA 2RQPA 1IN7A 2CQKA 2QUFA 5L3DA 3E97A 2OZUA 2YU3A 3FXUA 5H20A 5HLGA 4K2EA 2G9WA 3LQQA 3F8FA 4ESBA 1FLIA 2IT0A 1DDNA 2NNNA 3MAJA 5F1RA 4R1HA 3V4GA 4HF2A 4OIPF 4M73A 1O3TA 2ACJA 2UWMA 1ZLJA 1TW2A 2ISYA 3L09A 2A07F 2VONA 4Q4ZF 3CUOA 4B09A 3RIRA 2ZJ2A 1B59A 3E3VA 2V1UA 3W6KB 1ZARA 3ERED 4GYGA 3MWMA 2FRHA 1G3WA 5JI6A 1WWXA 2MC3A 3JAMK 1FYMA 1FZPB 4M9SA 1P4WA 2MLGA 4EM2A 5L3BA 3VFZA 3KP6A 2F5DA 2STWA 2M5WA 4L0YB 3WU0A 3GUDA 4LLNA 3M8FA 4RAZA 1LQ1A 3I59B 4ZYDA 5AIPA 1F5TA 5BPDA 2RN7A 4WXCA 3RPQA 2H27A 2GQQA 1VTNC 3C18A 4P9FA 4UXNA 2EFOA 4EM0B 5F64A 1LDJA 1SAXA 1YW7A 4HDUA 3R61A 3IKTA 2X0LA 2Q8KA 3GXOA 3L00A 4PGGA 1LEAA