1EH6A

Human o6-alkylguanine-dna alkyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
177
structure length
168
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
total genus 43
structure length 168
sequence length 177
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh6A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh6A01
1IXRC 2H27A 4KFCA 3EETA 3E97A 1K7AA 1ULYA 4UVAA 3L9FA 4LLGF 4BXUA 1J9IA 5EEHA 1FBQA 2DAOA 4ZYEA 3LAJA 1IF1A 3F8NA 4BHPA 1GVJA 1Z7UA 1R1UA 1XCVA 2K4BA 3CUQA 2RQPA 4WK8F 1BIBA 1Z9CA 1VTNC 4LMYA 3P9CA 4M9ZA 5JR3A 1SAXA 3I5UA 1BI0A 2QM3A 5K5OA 1T6SA 2PG4A 2XUBA 1OKRA 2F5FA 2HTJA 5ILUA 3O2PE 4ESBA 3WTUC 2YU3A 4XRFA 2YR2A 1IN6A 1ZG3A 3ISPA 1U5TA 1PP7U 2D1HA 3V8JA 4QLCU 4RB0A 1XDUA 2JRTA 4M71A 5D4RA 3QU6A 2W25A 4B09A 1QQIA 2BE5F 4M72A 2STWA 2M8EA 3F23A 3EYYA 3LWFA 3FMQA 3DF8A 5L3BA 4M6XA 3Q5FA 2R7DA 2VBXA 3MWMA 1H0MA 4H0EA 1MKMA 4AIHA 3GLXA 4A6EA 2Q0OA 5FFZA 2FBKA 1FBUA 1W7PB 3WGIA 3Q9SA 3SHFA 4MQ9F 4PGGA 2XAJA 3FM3A 2J5OA 1TBXA 2Y0MA 2A61A 3M1EA 1ZRDA 3GF2A 1DP7P 2ZCWA 4HF2A 2HTSA 1AWCA 3N97A 4G6QA 4A0YA 1HW2A 2CG4A 1T39A 4RGXA 2Z5UA 2IW5A 1KU9A 1F9NA 4HBLA 5FD5A 2DI3A 2M30A 3FXRA 3U9GA 4ZYHA 1O57A 3BDDA 3KLOA 4LK1F 1QBJA 4IF4A 1RI7A 3DV8A 5DV5A 3LAPA 3F3XA 1XGOA 4PDKA 4HYEA 2D1VA 4U0YA 5K5RA 4L5JA 5E8IA 2F5CA 4HDVA 1U8RA 2W24A 5E8GA 2HYGD 2M1BA 5LBQA 2HQRA 1OPCA 3HHHA 2HWVA 4EV0A 2DFIA 2GXBA 4KNYA 1LEAA 3E6BA 5JVTA 1XCBA 2ELHA 2WTEA 5J6XA 1O3QA 4I02A 1J0RA 2VODA 5L3FA 4HLXA 4WX9A 3FM5A 2MBFA 3FX3A 1KU2A 5CVJA 3WGGA 1RUNA 2Q8KA 2FXAA 3M9AA 4P9FA 5JFRA 3S2WA 1YW8A 1ZGAA 3CDHA 3MQ0A 2MLGA 2AXLA 1WRJA 1IUYA 5BPIA 4R8HA 2RGVA 3QRFF 4OIOF 4RB2C 4MNUA 2OQGA 1IXSB 3CUQB 5D8KB 3T5XA 2K02A 5FO5A 1LJ9A 2E1NA 3WG9A 3BZ6A 3R60A 2Y75A 1U5TC 1JHHA 4HQMA 4IJAA 1GHCA 2E7WA 2X4HA 1ZLKA 4GXOA 2XRNA 4I7HA 4D0PA 4HDUA 3ML6A 1HKQA 4KIFA 1E17A 5F64A 1KU3A 2KJCA 4EJVA 5LHIA 3IRRA 2HGCA 1SFEA 2QVOA 2KRFA 1F5TA 1W5TA 3F6OA 4MTEA 3AAFA 2P5LC 2RKHA 2DW4A 1WI9A 3KEOA 4LG0B 3T0YA 1XGSA 2RC4A 1REPC 1SFXA 3COAC 1IXCA 5FLXZ 4ZH4F 4FHTA 1FPQA 3KFWX 5HDKA 2KIUA 1LVAA 3TQNA 5TJJA 3L7WA 3HOSA 1V3FA 3F6VA 4I09A 4QWQA 3HSRA 4HV5A 3J81K 3EQLF 3V8KA 3Q9VA 2JSCA 4L0YB 2R3SA 2WC2A 2JZYA 2DTRA 2D45A 3WGHA 2PFBA 2EFNA 5ICGA 3N4MA 2BYVE 4MGRA 2ZFWA 2A69F 4UV9A 3TKYA 2DO7A 3E5XA 4IRGA 4LB6B 4AWXB 4K2EA 2P4WA 3KP4A 2FQ3A 5J8FA 3EDPA 6PAXA 2NYXA 4A5NA 1BJAA 5L3DA 2A07F 1QGPA 2UXXA 3KLNA 4ZYDA 4I2OA 1LEBA 4LK0F 2D2WA 4M6YA 1J75A 2LSOA 2QQBA 2VBYA 2EFOA 1J2XA 1YYVA 3FZVA 3H3UA 2XKOA 3NEUA 3IWZA 4RGUA 3QPHA 2EV5A 1S7OA 3IL2A 2BGCA 1FSHA 3K1MA 2STTA 2QWWA 5H6QA 2O6GE 4I0AA 1K78A 1R5HA 1FYLA 3GFLA 1FY7A 1XMKA 3G73A 3HTUA 2EA4A 2LF7A 3L2CA 1ON2A 4ON0A 5LEJA 4Q5SF 1ZRFA 4UNOA 1U5TB 3JW4A 2GA2A 1TW2A 5J8CA 4MEXF 1S8NA 1TW3A 3RYPA 4EVIA 1UB9A 3WE2A 1BC8C 5ILVA 3GWZA 3F8MA 3LQRA 2L3DA 4MHGA 2V6CA 1MJAA 4XSXF 4GYIA 1BIAA 3NQOA 1XSDA 2PQ8A 3KCCA 3TO7A 1P4AA 4OU0A 3KZZA 1TTYA 3RKWA 4G8XA 3JTGA 1I5ZA 2TDXA 1TLHB 2EK5A 2QBYB 3F8CA 1O3TA 5K1YA 4KT5C 5LGTA 3HSEA 2XKPA 5AONA 4BHBA 4R1HA 4Z2YA 2ISZA 3QU3A 4HF0A 2Z33A 3FMSA 2H6CA 2R7FA 5D6EA 3V7CA 3I4PA 3D0SA 2K4JA 2P8TA 3GZ5A 4P5OA 2VBWA 1MDMB 1QZZA 3SFZA 4OIPF 5ICFA 1HW5A 3B73A 3K1PA 5HDNA 2IA0A 2A68F 3GFIA 4GO1A 4BH9A 1USSA 4KMUX 2RN7A 5CVRA 3IKTA 2Z99A 4A2UA 3LA2A 2CYYA 5ILSA 1RUOA 5IT9Z 1FP2A 2L02A 2NNNA 2HKXA 2UZKA 4XLPF 2ADUA 4KIGA 4N9HA 4RB3C 4ESFA 2JTVA 1J5YA 1T98A 3QOPA 3VB2A 1GXQA 3RPUA 3R6SA 1YW7A 1OYWA 4Q48A 1CF7B 2FU4A 5FGMA 3VFZA 1E2XA 2H94A 3SZTA 3BPXA 3E5UA 3ZMDA 1HBXG 3QP6A 2VC0A 1YFHA 1J59A 2PJPA 2HR3A 1MZBA 1LDKB 2ETHA 2CFXA 3U1DA 1TNSA 4S05A 2XV4S 1FC3A 1I27A 3GW2A 3ZMZA 4BYYA 3CTAA 2CSOA 1TQPA 2ZMEA 5H20A 4WCGA 3WTSC 3E3VA 3BROA 2FF4A 3GVAA 5JHUA 5FFXA 3KETA 5D4SA 2CW0F 4U88A 4RAYA 2EV0A 1GXPA 3PQJA 1IN8A 3HRSA 5LRSA 3K9TA 1SFUA 2O61A 3HTSB 1QZYA 4ZYGA 1L0OC 3DEUA 3TO9A 4EGZA 4BHCA 3RKYA 2ZBKA 4HQEA 1FT9A 5HLIA 4HX8A 5AIQA 2V79A 3IHUA 1G3WA 4IPAA 2YX4A 2EJRA 2WV0A 2CO5A 3P9IA 2XVCA 1YLFA 1FYMA 3KP6A 3ELKA 2MH2A 5H6RA 3ECHA 3K2ZA 4AIKA 2A5YB 1B9NA 3R0JA 3F22A 2YX7A 2XHKA 2VBZA 2RVCA 1KA8A 2H6BA 1ODDA 5IT9K 3GXOA 1PDNC 4WF2A 5LEKA 4NB5A 4U0VA 4O6JA 2IP2A 4XLNF 2QYOA 2FRHA 2P5VA 4YG2F 3IRQA 2V1UA 4EM2A 2Y48A 4BQAA 1FNNA 4ZZLA 3DPTA 1ON1A 4CZZA 1L3LA 3GFMA 3RJPA 1IRGA 4G94A 5CJ9A 4Y15A 1EH8A 1UHWA 1ZN2A 4L9TA 4BAYA 4KYWA 1X3UA 2MH9A 4ENMA 4UXNA 2CQKA 1BI2A 4HV6A 2HDCA 1HKTA 1MGTA 5F6FA 2GXGA 2QLZA 4WXCA 3ROUA 1ZAOA 2FMYA 3PQKA 2E7XA 3CUOA 2AS5F 2O0YA 1Z05A 1F1ZA 2JPBA 2GZWA 2PI0A 2E1CA 2QBYA 4XSZF 5FLXK 1R7JA 5HS7A 5D8LB 2FA5A 5DD4A 3M8EA 1IAWA 3TGNA 2A6EF 2M87A 2VT3A 5AIPA 4YFXF 1BI1A 2Z9OA 4OINF 1T0FA 4P55A 3J81Z 3VOEA 2A3SA 4KN7X 3O3KA 3K69A 2NAZA 3V7RA 4EGYA 3J7AO 3M8FA 4LFUA 2DK5A 3I64A 3MEXA 1KYWA 1FYKA 2KIMA 4HOBA 3J80Z 3WTTC 2KKOA 5FD6A 2EFQA 2PEXA 3BOQA 3I59A 1OYIA 2HOEA 4ASNA 1R1VA 5DDGA 1FZPB 4F7ZA 2M45A 2EFWA 4B8XA 3GO5A 2GIVA 2NNYA 1S3JA 3TOBA 2MA3A 3HIFA 1YG2A 3I0TA 5DUIA 3C1DA 4RB1A 2VOOA 4G7OF 3R0AA 3PFIA 4YFKF 2OZ6A 3GEZA 4EM0B 4IXAA 1O7LA 5D6FA 5HLGA 1H9GA 3ZN0A 1IN7A 4Y13A 3TOAA 2JPCA 1OYYA 3I54A 2COMA 2KIFA 3E6MA 4EQQA 1F4KA 1YTYA 2JT1A 2OBPA 3G3ZA 3F8BA 3MFKA 2P7VB 1RZ4A 3FXQA 1P6RA 4CYDA 4A12A 4DQ2A 1ZHFA 3ABUA 1IRFA 1DDNA 4L18B 5CVUA 1DPUA 5A2QZ 5L3GA 4U7DA 5D5UB 1HKSA 2BBYA 4KN4X 2DLLA 3ULQB 3MZHA 3SXYA 5IT3A 1LDJA 1OR7A 5BQTA 4G6DA 4JK1X 3LA3A 3L00A 1U2WA 2FMLA 3SZPA 3I59B 3HRMA 1TQIA 2PBIA 4UVCA 1QPMA 1R23A 3JSOA 2M5WA 2DPDA 3ZP5A 1UCRA 4LJZF 4BNCA 1FBSA 1I6XA 3BJAA 1HSJA 5LGNA 1IN5A 1EH6A 3WODF 5E1ZB 4NHJA 3LA7A 3KP3A 3RI4A 4P96A 4U7BA 1B9MA 1SMYF 1XGMA 2IA1A 3CO7C 3IC7A 5L3EA 3WTXC 2FNPA 4PZJA 3WTVC 2RDPA 1MJ9A 1HXDA 3P7NA 1P4XA 4XBFA 1D8JA 4I01A 5HS9A 5E20A 1RNLA 4RGSA 3REOA 3GX4X 2L01A 5E1XA 4KMFA 3DQVC 2LNBA 1IW7F 2XAGA 3RKXA 2ESNA 3P9KA 5DUKA 1ZRCA 4UUVA 3IWFA 4M9SA 1KGSA 4YFNF 2P7CB 4YIFA 1FLIA 5L3CA 5KVRA 2IA2A 3HRTA 2HS5A 1YO5C 1Z6RA 2IJLA 3J80K 3U2RA 1DPRA 2UWMA 1SMTA 4Y17A 2XGXA 1EV7A 3BWGA 3W6JB 2KJBA 1ZG5A 1WSUA 3B02A 1H9TA 1ZARA 3MZYA 5BMZA 4DNCA 3W6KB 2C6YA 4OIRF 3ZQ7A 1K6OA 2ZKZA 4O5VA 1JHFA 2FBHA 2L4MA 3HYIA 4FT8A 5DD8A 2IT0A 2HZTA 3HRUA 3OOPA 3WU1B 3NRVA 3KEQA 3EYIA 2A6HF 1S29A 3FWEA 1XGNA 1SD7A 2QZ8A 5FB2A 2DPUA 3L09A 4HZFA 1DUXC 1R1TA 4YIIA 3LFKA 2FE3A 2G9WA 3R4KA 2G7HA 1STZA 2W57A 3RYRA 1LB2A 1FX7A 4OMYA 2QQ9A 4ESJA 2VT2A 5D5XB 1O3SA 3D5LA 2VONA 4A0ZA 2FEZA 3ZPLA 1T38A 3ECOA 2OQRA 4HX7A 2GA1A 4G7ZF 3GZ6A 4CICA 1SD5A 2H09A 4OMZA 4M73A 3CLOA 1S7AA 4LGWA 1QO0D 3VEPA 2NRAC 1G6NA 3OV8A 3DXJF 3WE3A 2FNAA 3ZN1A 3QPTA 4LLLA 4NQWA 3FXUA 5LHGA 1I1GA 4WXHA 1LQ1A 3RDIA 2EV6A 4GCVA 2J5PA 3I71A 5HOOA 3V7SA 2P5KA 2LDUA 3DKWA 1YS7A 2BEOA 3C18A 4AVPA 1D3YA 4L0ZB 5TRDA 3HSFA 3HHGA 4G7HF 5E18F 3H3ZA 1YW9A 4Q47A 1LNWA 4GGGA 1V4RA 1W5SA 2QUFA 4HW0A 1FWZA 2GQQA 2K86A 4ZZDA 4O3MA 1SD6A 1A04A 1XSXA 2MC3A 3T8RA 3GUDA 4RGRA 4EJOA 1KYZA 1C0WA 2V1DA 1R36A 1R00A 3K1NA 2ZO4A 1JE8A 1USTA 2V1XA 2P6TA 4PCQA 3RPQA 5CLSA 4N0BA 2ESHA 3ZMUA 1P2FA 2O8XA 3GYHX 3I53A 4I0BA 3IKVA 1K78B 5D5VB 3SQNA 1XB4A 4M74A 3H92A 1P4WA 3ZMTA 1D5VA 1TNTA 1BN5A 4FX0A 5DEQA 5LGUA 1ZYRF 1IZ1A 1XDSA 1WQ2A 3WTWC 1ZLJA 4Q4ZF 1Q1HA 2Z3YA 4IHSA 3BJ6A 5BPDA 1JXSA 5A2QK 1IN4A 5LLQA 2MD5A 4HX4A 3LQQA 3KP7A 2VE9A 4CO8A 3BJOA 4A6DA 2VC1A 2EFPA 1U78A 3BY6A 1SD4A 2XROA 3I58A 3WTZA 3BPVA 2OZUA 2WWYA 2EA2A 3CJNA 1BOAA 5ED4A 3TDUC 4HF1A 3C7JA 4HAMA 3F8FA 4L9JA 1B1BA 5DYMA 4CGZA 5KK1A 2PN6A 2EB7A 5D5WB 1MD0A 2VN2A 2LKPA 2W84A 5JI6A 2FSWA 2HYFA 1G3TA 2OA4A 2NS0A 1I1SA 1TQMA 1D8KA 1XSVA 4ETSA 2XAFA 3JTHA 3E5QA 5K5QA 4WXDA 2FOKA 5ERIA 2ZNYA 1YS6A 4P9UA 2L4AA 2DBBA 2XIGA 1XN7A 1YIOA 1BC7C 1KU7A 1W7PD 2L54A 1CGPA 2DK8A 4OOIA 1B4AA 2ACJA 3O6BB 3FMRA 2G7UA 4UVBA 4EMSA 1ONVA 1R22A 3C3WA 4RS8A 4OIQF 4JQFA 4CDGA 2F5DA 4M9XA 5HS8A 2IVMA 4EM1A 3DP7A 4MEYF 5DCMA 3WU0A 1XMAA 2HQNA 5F1RA 5LHHA 1OMIA 1UHMA 3RTRA 5DCMB 1YQAA 1KQ9A 2VE8A 2XAQA 4CXFA 1HQCA 1Z1DA 2GAUA 1MDMA 1J7KA 1AOYA 4IRIA 2YPRA 2YSRA 1G3SA 1BBYA 1JGSA 1W7PA 1Y0UA 3ZMVA 2V9VA 4IVNA 1B59A 4ENNA 3CO6C 3JAMZ 2PMUA 1BI3A 2CGPA 3T8TA 5EEGA 3JSPA 4UHTA 2DQRA 4HLYA 2W85A 3KE2A 3CUQC 4EJTA 1UFMA 2LF8A 4CHUA 2MLKA 5DCFA 3FF5A 3QAHA 3LSTA 4MQVA 1NHAA 4WWCA 1ZGJA 2QENA 2HKOA 4HA8A 1PUEE 3ZMSA 4IRHA 3F72A 3TO6A 2PLYA 1PP8F 2P6SA 4LD5A 3V4GA 3ABTA 2BV6A 1WWXA 4KIBA 4FX4A 5CVIA 1U3EM 4JBAA 2ISYA 2OD5A 3BP8A 3DPLC 3KP5A 3R61A 2ZXJA 4ENJA 2F2EA 5BS6A 2XASA 3F21A 1LDDA 5ICCA 2HEOA 2ZJ2A 1S6LA 4S04A 2IPQX 4UV8A 3EUHA 3FHZA 4G9YA 1ZH5A 4LB5A 5E1WA 5CVVA 1Z6TA 3T1BA 1ZG1A 1G3YA 2ZMEB 5CYVA 2OU2A 3V8LA 2EWNA 2O3FA 3MCZA 1ZREA 3KZYA 2O03A 5HDGA 4KUMA 1MJBA 2XAHA 2B0LA 2QQAA 1P92A 3E6CC 4R79A 4IHTA 4L9NA 1CF7A 4MTDA 2K7LA 3MAJA 4L9VA 3WTYC 1FOKA 4N9IA 1KQ0A 1FSEA 4L5IA 5ICEA 1Z91A 1RIOH 2DT5A 3M7GA 4PGHA 4U0WA 3TDZC 3E6DA 5HLHA 4TV7A 5E17F 3QP5A 2RV8A 1O3RA 1O7FA 3VODA 1T2KA 4I98B 1K79A 1W4MA 2VXZA 4AIJA 4EJUA 4KDPA 3ERED 1FP1D 2UXNA 1HW1A 4AD9A 1R5GA 2IRFG 2RNJA 5LRRA 5HVQC 2HFHA 2VOPA 1KQ8A 1BM9A 1HSTA 1QNTA 3DFGA 1U6GA 2GWRA 2X0LA 3KP2A 1WKMA 4LLNA 2DQLA 3HOTA 4KICA 2K27A 3HUGA 2OAZA 1EH7A 1R58A 1XD7A 4EJWA 4LG0A 2ZNZA 2F5EA 4RAZA 4A0XA 3GFJA 1B6AA 1G4DA 2PMHA 3K0LA 2FBIA 4KA4A 2DU9A 4ENKA 4A5MA 3JAMK 2CWEA 5BOXA 4GYGA 4E70A 2Q2EA 3RIRA
chains in the Genus database with same CATH superfamily
1TZLA 4Q35B 2DMNA 1IXRC 4JI3E 1M1EB 2H27A 4KFCA 3EETA 4R2DA 3TEDA 2KDOA 2EN2A 4KISA 2BBGA 3E97A 5KCMA 5DNYA 1K7AA 2JR1A 1ULYA 4UVAA 4Y52J 1UHSA 3L9FA 1WHNA 4LLGF 2GOMA 4BXUA 3EUHC 1J9IA 2HI3A 3S2DJ 1DQ3A 1BJZA 2Y30A 3BTIA 1FBQA 5EEHA 1X3CA 3P1XA 1TWCJ 3S1QJ 1Y8QB 2DAOA 4ZYEA 3IP4B 2X6XA 4QPQA 3LAJA 1IF1A 2EZKA 4L5EA 3F8NA 4BHPA 1GVJA 2W48A 3G71I 2QA4I 2ZMEC 1Z7UA 4OWRB 3ADJA 1YITI 2KHMA 1R1UA 1OISA 1HA8A 2L92A 3CDIA 4OAYA 1T56A 1W0TA 3ZQHA 4ABZA 3OS0A 4NXME 1XCVA 2K4BA 4DV1E 2E60A 2EOSA 2XB0X 3CUQA 4OX9E 2RQPA 4WK8F 1LLMC 1BIBA 3H36A 1VTNC 2G0EA 1IRXA 2XPVA 2OUMA 4LMYA 1Z9CA 3P9CA 4M9ZA 5JR3A 4WFTA 4RAGA 3OR2C 1SAXA 1CQTA 3I5UA 1BI0A 5A69A 3ZQFA 2QM3A 5K5OA 3CDLA 1VQPI 1J09A 5DTDA 1T6SA 2Y69H 2WBMA 2PG4A 2RNGA 5EF6A 1TWGJ 2YRMA 3A02A 3J7Yp 2XUBA 1OKRA 2F5FA 1D5YA 2HTJA 1YIJI 3IH3A 5FKOA 5ILUA 3O2PE 2H8WA 4ESBA 3WTUC 2N8XA 2YU3A 3Q0VA 2EPZA 4B48A 3S17J 4XRFA 3GTKJ 2F8BA 2YR2A 1NTCA 1JJ8C 2CUEA 1IN6A 1HF0A 3CC4I 1PDAA 1P7IA 1ZG3A 3IWDA 3CCMI 1APLC 1EKZA 4JYAE 3ABMH 1JT0A 4BJ5C 3CMMA 1U5TA 3ISPA 1PP7U 2D1HA 2LYCA 3AKZA 3V8JA 4QLCU 3EQ1A 1OCOH 3H9JA 4RB0A 2YU9J 1XDUA 2JRTA 4HNVA 3LNQA 5H2FC 4DV0E 4XQFA 3GCMA 3HC7A 4M71A 1MMNA 5D4RA 3QU6A 3ZXSA 2W25A 3RKQA 4B09A 2RQLA 4XNFA 1QQIA 1XMQE 3WHCA 5K7ZA 2UXBE 3KYDB 2BE5F 4M72A 4XN0A 2STWA 2M8EA 1UELB 2BOLA 4DZPA 3GTPJ 3F23A 2HPIA 2MC6A 3EYYA 3GTJJ 1IQOA 3LWFA 2MGQA 3FMQA 3DF8A 4DW6A 5L3BA 4F9CB 2X1EA 4M6XA 3Q5FA 2K9SA 4UUTA 1IDZA 2KL4A 3HPGA 2R7DA 5AC5A 2VBXA 3MWMA 2K7IA 1H0MA 2ZSHB 4H0EA 4LF6E 5GAHJ 2EM7A 1MKMA 4AIHA 1BR1A 3GLXA 2ECCA 3HGGA 4DMIA 2JXPA 4A6EA 2XGCA 2Q0OA 2ZJPF 3HEFA 5FFZA 2FBKA 4HSRA 1FBUA 1W7PB 3WGIA 3Q9SA 5F0FA 2VQHA 3CQZJ 4YEJA 3SHFA 4MQ9F 2DYSH 3FXOA 2F4MB 1D1BA 1ETOA 1AA7A 4PGGA 2XAJA 2Z16A 4FASD 4Y7NJ 3FM3A 1X1PA 2J5OA 4CUGA 3QODA 1HDPA 1A36A 5EG0B 5EGOA 2Q1ZB 1TBXA 2Y0MA 2A61A 3M1EA 1W5CC 2K9NA 3JU0A 2Q2EB 3GTGJ 4KZSA 3RQ4A 3RSNA 1ZELA 2ZB9A 1IGNA 4S0HB 2HZDA 1ZRDA 3GF2A 1DP7P 1IO2A 2ZCWA 3K70C 4HF2A 2EZ6A 2HTSA 1AWCA 3N97A 4G6QA 4A0YA 2BVMA 4OOGC 1YUJA 1QVTA 3VYSB 1HW2A 2CG4A 2K85A 3MSWA 1T39A 4RGXA 2Z5UA 2IW5A 2L2OA 4O4KA 2LMZA 1KU9A 2ZXIA 1F9NA 4HBLA 5FD5A 2DI3A 2M30A 3FXRA 2EMCA 3U9GA 3ZQIA 2M7AA 1NG7A 4ZYHA 1RMDA 4UB6C 3O8HA 1O57A 3BDDA 2R7VA 3KLOA 4LK1F 4CSWA 1QBJA 4IF4A 1RI7A 3DV8A 5DV5A 3LAPA 3F3XA 1XGOA 1YRNB 4PDKA 2NA2A 3ADLA 3JR9A 1LPQA 4HYEA 2YTNA 2D1VA 3BCBA 3HPZA 4U0YA 5JLXA 5K5RA 1WHQA 4LFAE 4NHRA 2V88A 5IXMB 4L5JA 1ZR9A 5E8IA 2X51A 2F5CA 3CC2I 4J8ZA 1QVUA 3OYJA 3I56I 4HDVA 4WPYA 3H35A 3DKYA 4CYCA 3JRAA 1U8RA 4B3RE 2NVYJ 2W24A 2LO3A 5E8GA 1HR0E 2HYGD 2M1BA 5LBQA 3ASNH 2HQRA 2EL4A 4NUBA 4CCNA 1SEUA 1N78A 3K4NA 5M3FJ 1OPCA 1R6RA 3H0GJ 1AH5A 2JMWA 3HHHA 4G12A 3PIPF 1PUFB 3W6VA 2HWVA 4IEJA 4EV0A 3S8PA 2DFIA 3KX2A 4CCLA 2GXBA 2W4SA 4KNYA 1LEAA 1LFPA 1VI0A 4X65E 2B63J 3E6BA 4AQYE 1IBME 4X64E 2Y9ZA 2LK2A 5JVTA 3SDBA 1XCBA 1OFCX 2EM6A 2LE2A 2ELHA 2E35A 2WTEA 2EMIA 2CS3A 5F0CA 1X48A 2LT7A 1ETWA 4CCJA 4RAFA 2X6YA 5J6XA 1MMSA 1O3QA 4I02A 5J3LA 1J0RA 4V2GA 4J19A 2VODA 5L3FA 4HLXA 4WX9A 3FM5A 1VQ8I 4XR6A 1Z7LA 2MBFA 3DTKA 3FX3A 4BY1J 3C2BA 1L4SA 1KU2A 2O5RA 4RM3A 2JVGA 4E6KG 5CVJA 3WGGA 3C4TA 2W82A 1R49A 1RUNA 4ZDOA 2Q8KA 2PJRA 4F54A 2FXAA 2B9SA 3M9AA 3BBGA 4PUSA 4P9FA 5JFRA 1FTTA 3S2WA 1VNDA 5EZHA 1YW8A 1ZGAA 3CDHA 3MQ0A 3VPRA 4A3DJ 2IBDA 4IHXA 2MLGA 4O5GA 4R8OA 2V6EA 3W2WA 2AXLA 4D5FA 1WRJA 3L2QA 1ERDA 1IUYA 5BPIA 2FV4B 4R8HA 2RGVA 3M3YJ 4A3CJ 4B3SE 3QRFF 4OIOF 1MBEA 3ZQLA 1Y39A 4RB2C 3CCUI 4MNUA 2OQGA 3HB9A 3G1MA 4C3IJ 1IXSB 2I5UA 3CUQB 5D8KB 1RPWA 2EBIA 3T5XA 2COBA 2K02A 3PSIA 2K40A 5FO5A 4X0GA 2HVRA 4ZC3A 4BJTA 1LJ9A 2E1NA 3WG9A 3DKXA 1JK1A 3BZ6A 2ZJRF 4BXXJ 3R60A 3HOVJ 1EA3A 1YYKA 1X1AA 2ZM6E 1IBKE 3OIQA 2Y75A 1Z1BA 1BB8A 2JK3A 3PUBA 4HRIA 1U5TC 4A93J 2BHZA 2NABA 2M3AA 3SZGA 2BB8A 1DU0A 4XRMA 1ITYA 1XNQE 2L9NA 1JHHA 2M4IA 2BY2A 4HQMA 4IJAA 1LE8A 4FE4A 1GHCA 2E7WA 5GTHC 4B3TE 2X4HA 1K6YA 2XRLA 2E34A 3MKLA 1ZLKA 2L6MA 2DMIA 4GXOA 4CZCA 2XRNA 3OYIA 4I7HA 1BL0A 4D0PA 4HDUA 1B72A 3RZDJ 2X1DA 3CCYA 3ML6A 3DTEA 3G6EI 2MD0A 4ANJA 1HKQA 4KIFA 3CF5F 4CCKA 3HTXA 1WJCA 1E17A 1YE9A 5F64A 4RLFA 1KU3A 2KJCA 4EJVA 5LHIA 3IRRA 4KT6A 5LD2C 2HGCA 2GIZA 1SFEA 2DFEA 2NOJB 4OAZA 2QVOA 4AC0A 4E7JA 1UAAA 3IWCA 2KRFA 2LTRA 3FIWA 4MLVA 1UN6B 3MKZA 1F5TA 1W5TA 3F6OA 4MTEA 4A3MJ 2EPAA 3AAFA 2P5LC 4A3EJ 2RKHA 2DW4A 2MFZA 1WI9A 3JREA 1JKQC 1W36C 3W2VA 4FISA 3KEOA 2F48A 4LG0B 3T0YA 1XC5A 2CQQA 2EMGA 3C4BA 1XGSA 2RC4A 1REPC 3Q3SA 1SFXA 3OMYA 4J00A 4AYBN 1QHGA 3COAC 4LIVA 4XN3A 1IXCA 4AIDA 5FLXZ 4ZH4F 4LOCA 4F6NA 4FHTA 4P1WA 1FPQA 3KFWX 4DYQA 5HDKA 2KIUA 1LVAA 3TQNA 5J1UA 5TJJA 2RSMA 3AFHA 3L7WA 3C6MA 3HOSA 2K9QA 1V3FA 3F6VA 4I09A 4QWQA 2YTGA 1RC7A 3HSRA 4HV5A 3J81K 1VQ4I 3M4OJ 2DT7B 2VQGA 3EQLF 1ZR4A 1H89C 3V8KA 3S93A 2BHYA 2ELJA 2JPAA 2KZVA 3Q9VA 2JSCA 4L0YB 5IOZA 3HOYJ 4F9AB 1QU3A 1FOXA 2R3SA 2DRPA 1GQEA 2WC2A 2JZYA 2GLIA 2DTRA 3FXLA 3OYNA 2D45A 5J40A 3WGHA 4XONA 5IV8B 2PMZN 3IWBA 2PFBA 2EFNA 5ICGA 3N4MA 2BYVE 5KNLA 2NUEA 3AG2H 4XKVA 5GADJ 4MGRA 2ZFWA 2BY1A 2CRGA 3HOWJ 4DR1E 2A69F 1OCPA 4H4KC 3MN2A 4UV9A 3TKYA 2DO7A 3E5XA 4IRGA 5M3MJ 1W1WE 4LB6B 4PJMA 2EZHA 3BR3A 4K2EA 4AWXB 2EPXA 2P4WA 3KP4A 2FTXB 1MNMC 4R03A 2FQ3A 3FXKA 3EDPA 5J8FA 4A3JJ 1OCTC 2E1MC 2AXTC 6PAXA 2NYXA 1PJRA 4A5NA 1BJAA 5L3DA 2A07F 1B8IB 5E3MA 1QGPA 2LBFA 2HHHE 3OYAA 2UXXA 2JA8J 3KLNA 4ZYDA 1LVKA 1QA6A 1P7JA 1W36D 2EH3A 4E7IA 4I2OA 1LEBA 1MSFC 4LK0F 2NXNB 4O43A 1VF9A 2D2WA 2LLKA 4DUYE 4M6YA 5M5WJ 1GT0C 1SFOJ 1J75A 2EP3A 2LSOA 2QQBA 2VBYA 2EFOA 1J2XA 1YYVA 4IZZA 3FZVA 3H3UA 2XKOA 2LTSA 3NEUA 3IWZA 4JP0A 3S3OA 4RGUA 3QPHA 3MHHC 2EV5A 1S7OA 5C4JJ 2VIXA 2QCOA 3IL2A 2LRSA 2BGCA 1FSHA 3K1MA 2V9KA 2HVSA 2STTA 1RETA 2QWWA 4D1QA 4LF7E 2M4KA 2IS6A 2LRDA 3PM1A 3K10A 5H6QA 4N4RB 3LSRA 3C2GA 2K4VA 2O6GE 4I0AA 2VASA 5M5XJ 1R5HA 1K78A 1FYLA 3GFLA 1FY7A 2VJ5A 4X6AJ 2LOOA 2L3JA 2V86A 1XMKA 2F4IA 2XF6A 3HGYA 2EA4A 3HTUA 3G73A 4FTHA 1GZ6A 2LF7A 3EPZA 3LSGA 1QZEA 2Q8UA 3M99B 3THOB 1I3QJ 2EINH 3L2CA 1ON2A 4ON0A 5KL2A 5LEJA 4BMJA 4Q5SF 1ZRFA 4UNOA 1A35A 1WH7A 2MABA 1U5TB 3JW4A 4XKBA 2BXYA 3THNA 2GA2A 1MIJA 2DLQA 1TW2A 5J8CA 2YS9A 4AYBA 1V55H 2NVQJ 3C6KA 4M0VA 2MKNA 2LCEA 1X6FA 3IH4A 4P78A 4MEXF 3BGHA 4RM2A 2EPNA 4XM3A 1RKWA 4XRSA 1HNZE 3I9V2 1S8NA 3OYLA 1BW5A 2R1FA 1TW3A 3HOUJ 1S5LC 1JK2A 3RYPA 4EVIA 1UB9A 1ZK8A 3WE2A 1BC8C 5ILVA 3GWZA 3F8MA 2H1KA 4IS1C 3LQRA 2NVTJ 2YSPA 1X1DA 2L3DA 4MHGA 4R2RA 2YTEA 2N8GA 2V6CA 3BQYA 3MKWB 1MJAA 4XSXF 4GYIA 3M1CA 1BIAA 3X2QH 1MEYC 3DBHB 2JN6A 3NQOA 1XSDA 2PQ8A 3DLLF 3KCCA 3TO7A 2R7UA 1P4AA 4OU0A 3KZZA 5AE2A 1TTYA 2XGDA 3RKWA 1Y1VJ 2LJHA 4G8XA 2W00A 3JTGA 1I5ZA 1OCZH 2TDXA 1TLHB 2FOWA 4IHYA 2EK5A 4XKWA 2H1LA 2QBYB 3CP2A 3EPKA 4KWYA 3FK6A 3QYBA 3F8CA 4E4HA 3KPHA 1O3TA 1G2FC 3GTQJ 5K1YA 4KT5C 3DWLE 3A03A 3ABLH 3ZGKA 4RMNA 1XX5A 3HSEA 5LGTA 2XKPA 2HQAA 2DIXA 2AQEA 5AE1A 4DR4E 3OSFA 5JLWA 2CV1A 3KIOA 5AONA 4BHBA 4A3FJ 2HPMA 4R1HA 5CPRB 3H9QA 4Z2YA 2ISZA 3QU3A 3MVPA 4HF0A 2Z33A 3FMSA 2H6CA 5C44J 2VQCA 1WI3A 2R7FA 5D6EA 2VE7C 5A6JA 3V7CA 3I4PA 5KL7A 4YRVA 1UILA 2EOOA 3D0SA 3NWTA 2K4JA 5FKLA 2ME0A 5GAEJ 2B7TA 2R7SA 5EZGA 2P8TA 1S7EA 4BQNA 3OL3A 1IRZA 3GZ5A 4P5OA 2VBWA 1MDMB 1X6EA 2L9SA 1QZZA 3SFZA 5J4VA 4OIPF 3T1YE 5ICFA 1JKOC 2M4GA 3HL2A 2L9VA 1HW5A 3B73A 1YX5A 3K1PA 3J7ZI 4LITA 1YYOA 5HDNA 1MSEC 4M3GA 4LTYA 2DJIA 2IA0A 3D1NI 2GBYA 1MH4A 4MIMA 2A68F 2WBSA 2KRCA 3GFIA 4GO1A 3RPUD 4BH9A 2VKHA 1USSA 1ZAAC 4JOMA 3KZIC 1E3PA 3OR1C 4KMUX 3SYTA 4R2EA 2RN7A 4P7DA 5CVRA 2JUCA 3IKTA 5E3LA 3PNTA 4PSWA 2Z99A 4A2UA 3LA2A 2LKSA 4F2JC 4XORA 1RRJA 2CYYA 5ILSA 1RUOA 2MG4A 2MDRA 2YTIA 1LFUP 1P9QC 1X2NA 2EILH 3RQIA 4ZTJA 5IT9Z 1FP2A 2L02A 3K7AJ 4CA0A 2FUG2 2NNNA 3HBLA 1X5WA 4V2FA 2HKXA 2UZKA 4RLQA 5LMUE 4XLPF 1WXRA 2ADUA 4B43A 4KIGA 1IDYA 4N4NB 4N9HA 4RB3C 4ESFA 2CTDA 2VXDA 3BTJA 2JTVA 1XMXA 3WU2C 1J5YA 1BR2A 3M8JA 2D9HA 1SC7A 1ETVA 2TRTA 2XPWA 3LFUA 1VQ7I 1T98A 5JVGF 4B3AA 3QOPA 2D5VA 4DIQA 3VB2A 1GXQA 2MSYA 3RPUA 3R6SA 1YW7A 1OYWA 2HXIA 4Q48A 2R7WA 1CF7B 1ZTRA 2FU4A 5FGMA 3HPHA 1SR9A 3VFZA 3BZKA 1ZKGA 1E2XA 1PJQA 2FJ1A 2H94A 3SZTA 2VF1A 3BPXA 3E5UA 3ZMDA 1HBXG 3QP6A 3CCLI 4MFEA 2VC0A 1YFHA 2UU9E 4IOCF 1J59A 4NC7A 2EMFA 4C30A 2PJPA 1PJSA 5IY5H 2HR3A 4UY8I 1MZBA 1A1FA 5HNFA 1LDKB 3SDGA 1NK2P 2ETHA 1E3OC 2ECBA 1IMUA 3CJRB 2CFXA 3U1DA 1TNSA 4Y3OA 4JI8E 4S05A 1BBOA 2QEXI 3I4MJ 2XF7A 3VYTB 5AASA 2XV4S 1FC3A 4XL9A 1I27A 3GW2A 3ZMZA 2DFFA 4BYYA 3LOCA 3CTAA 3OYCA 2ZXHA 2CSOA 1B69A 1TQPA 1K61A 2ZMEA 3KYCB 5CQEA 4KITB 2JSPA 3GTLJ 5H20A 4WCGA 3H3VK 4D5CA 3JRBA 3WTSC 1VQ5I 4JYKA 3E3VA 3BROA 3BT9A 1B8IA 2FF4A 3GVAA 2EOFA 5JHUA 5FFXA 3HZJA 3EPLA 3S1NJ 3KETA 1A1IA 1STUA 4C3JJ 5LMNE 5D4SA 2YRKA 2CW0F 2X6OA 4U88A 4RAYA 2EV0A 1GXPA 3PQJA 2IGMA 2NVUB 1IN8A 3HRSA 5LRSA 3K9TA 1SFUA 1ZBQA 2O61A 2EOJA 3K2AA 3S14J 3QYEA 3OL4A 3B6AA 4D7NA 3HTSB 1QZYA 1POGA 4ZYGA 1L0OC 3DEUA 4ZDPA 3TO9A 2A5WA 3AUZA 4DR3E 1IV6A 5CQGA 4B1RA 2Z2SB 5DM7F 4EGZA 4HNTA 1SVLA 4BHCA 2I10A 2R5YA 2M8GX 1YJNI 1ZR2A 4HEA2 1NCSA 2N3HA 1T8IA 3RKYA 2ZBKA 3BG7A 4CH7A 4M30A 2HJJA 4HQEA 2DMUA 1FT9A 3TP3A 5HLIA 2RTXA 4HX8A 1GV5A 3N05A 5AIQA 3OYFA 2V79A 3IHUA 4DR7E 5EJCA 4FE7A 3DJWA 3F0CA 1RR8C 2DCEA 1G3WA 4IPAA 2YX4A 2EJRA 1G8XA 2HC5A 1IBLE 4BUPA 2WV0A 2CO5A 4AU7A 3P9IA 1WHUA 2XVCA 1YLFA 5C3EJ 1FYMA 2O9LA 4IL6C 3FDYA 1MNDA 3KP6A 3ELKA 1A5JA 2MH2A 2ID3A 3A0HC 1IQSA 5H6RA 3ECHA 3CJTB 3K2ZA 4E7ZA 1YOVB 2A5YB 3JRHA 4AIKA 1H88C 1B9NA 3PNVA 3R0JA 2B3TB 2EORA 5A2QC 3OTOE 1N33E 1OR7C 4XKCA 5E3NA 3D5SC 2DOFA 3F22A 3A2KA 3O8GA 2YX7A 1VQLI 2XHKA 2VBZA 2RVCA 4HSTA 1KA8A 2H6BA 2IS4A 1ODDA 3CESA 5IT9K 3GXOA 1PDNC 3FKIJ 4WF2A 2HOAA 2WY8Q 3EUKL 5LEKA 4NB5A 1T4NA 4U0VA 4O6JA 4E7LA 2IP2A 4XLNF 2QYOA 2GXAA 3IV5A 2FRHA 2NVXJ 4DV5E 5K7HA 2DGCA 2P5VA 4YG2F 4F6MA 3IRQA 4NQWB 2V1UA 4EM2A 3FIGA 3OMLA 2Y48A 1VQ6I 4BBYA 4DJAA 4BDZA 4X66E 4BQAA 2OF7A 2LTPA 1FNNA 1DGCA 4A3KJ 3QQAA 1GLNA 4QTRA 2NS8A 2CV2A 1DU6A 3S16J 2M7QA 2HXOA 4ZZLA 3DPTA 4XLAA 1ON1A 4CZZA 1L3LA 2YZTA 2O7OA 3GFMA 1JUPA 3KYLA 3RJPA 3TBIA 5GTIC 1IRGA 4G94A 4GEQB 1ETQA 5CJ9A 3W3CA 3AG1H 4Y15A 2EM9A 1EH8A 1HNXE 2YUSA 1UHWA 1ZN2A 4L9TA 4BAYA 3K4LA 2EPCA 4LF5E 4KYWA 1X3UA 2R7TA 2MH9A 4ENMA 2L7ZA 2KQRA 4UXNA 2CQKA 2L7FP 4UB8C 1BI2A 2EMKA 2VPRA 4LG3A 4GFBA 2MW8A 4HV6A 1G2DC 2ID6A 2HDCA 1HKTA 1MGTA 1R9TJ 3ABKH 2KHXA 3QYFA 1WGXA 2KFDA 5F6FA 2WA0A 4C2MJ 3BC8A 2R7QA 2GXGA 2QLZA 4WXCA 3ROUA 5LL6R 1ZAOA 2DOEA 3DBRB 4HEIA 2EMYA 2FMYA 3PQKA 2E7XA 1EKEA 3CUOA 2WZOA 3SEZA 4LIUA 3VYUB 2AS5F 2O0YA 4NC8A 3FK7A 3S1MJ 1Z05A 3DLAA 1Y1WJ 4IHVA 3S32A 2E2HJ 1F1ZA 3MMYB 2EM5A 2OPTA 2JPBA 2GZWA 1QU6A 1GDTA 1X47A 1IV8A 2PI0A 2E1CA 2QBYA 1F2IG 4XSZF 5FLXK 1R7JA 3J7YJ 4FQGA 5HS7A 5D8LB 2R7OA 5B1BH 2PRTA 1X19A 3BLYA 2FA5A 4BE1A 5DD4A 1HC8A 1OCRH 5F1JA 3M8EA 3KEYA 1IAWA 1ZU1A 4NBQA 3S3NA 3UNGC 2IHR1 4JX4A 3TGNA 2EQ1A 2A6EF 4PJLA 2M87A 5GPCA 2VT3A 5AIPA 4YFXF 4O24A 1BI1A 1YYWA 1A31A 2Z9OA 1TC3C 4OINF 1T0FA 4P55A 3J81Z 1ACIA 3LLHA 3H1CA 1VZ0A 2DFHA 3LMLA 3VOEA 2A3SA 2V8QB 3HG9A 4KN7X 1EF4A 3O3KA 2NAZA 3K69A 1MNEA 3V7RA 1TT5B 1J26A 3H5NA 4EGYA 1HOMA 3PFYA 3J7AO 3M8FA 2EQ3A 4LFUA 1V5EA 2DK5A 1X4OA 2EPPA 3I64A 3MEXA 4B3ME 1KYWA 1FYKA 2KIMA 3QWLA 3HJEA 4HOBA 3DTIA 3E1SA 3LL7A 2RQQA 3E7LA 1FEXA 4BDYA 2A05A 2E1MA 2V89A 3J80Z 1A1GA 1FJGE 1VQKI 3K4KA 2DB2A 2EPFA 3ESWB 4DOZA 3WTTC 2KKOA 5FD6A 2EFQA 2PEXA 3BOQA 1LFBA 3HKZN 4BXFA 3I59A 4NC6A 2X85A 2EQ0A 1OYIA 2LY2A 2HOEA 4ASNA 3DCFA 1IJWC 2XPUA 1R1VA 4JI1E 3OSGA 5DDGA 1FZPB 4F7ZA 2M45A 5AE3A 4B44A 3LSMA 2EFWA 4B8XA 3GO5A 2GIVA 2NNYA 1S3JA 3TOBA 3GTOJ 2VPLA 2BVLA 1NEIA 2YTQA 4PSXA 2DDAA 3S15J 2MA3A 3HIFA 1TT0A 2E1MB 5FLXC 4E7HA 3A1YA 1X4PA 2M0CA 3VYRB 2LY1A 4PFPA 1YG2A 3I0TA 5DUIA 3C1DA 4RB1A 4I8OA 2VOOA 1X3ZB 4R2SA 3U21A 4G7OF 1D0ZA 3R0AA 1Z3YA 3PFIA 3AL0B 4YFKF 2W1OA 4MO7A 1O4XA 4ITVA 2OZ6A 4C2TA 3GEZA 4EM0B 3FKJA 1WH5A 1O7LA 1XTAA 4IXAA 5D6FA 1TF3A 1SANA 2ELKA 2VJJA 3L2RA 3FHNA 2M9AA 5HLGA 4XOPA 3A0BC 3BZCA 1H9GA 3FBIB 3ZN0A 4BE0A 4GKKE 1MMGA 1Y6IA 1IN7A 4Y13A 1YRNA 1N36E 1HNWE 2M0MA 3TOAA 2DA3A 4Q28A 1JT6A 2JPCA 1ZBTA 2EPRA 1OYYA 1BA5A 2K5CA 3I54A 2B9DA 2COMA 2KIFA 2P81A 3E6MA 3OIPA 3FXJA 3H5AA 4EQQA 2YU8A 1F4KA 4WYQB 1YTYA 2JT1A 3BQZA 2KLOA 2OBPA 2UUZA 2CU7A 5J47A 3G3ZA 3F8BA 3MFKA 2P7VB 1RZ4A 2DT6A 3CD6I 2EN6A 2YTFA 1AHDP 3FXQA 5J1RA 5DM6F 1P6RA 3HQ1A 3W2AA 4CYDA 1WJ5A 2ZXWH 3PIOF 3J7AG 4A12A 5KHDA 4DQ2A 2ZFUA 3DEWA 5EYRA 1ZHFA 3ABUA 2WBUA 1VQ9I 1IRFA 1DDNA 1X58A 1AAYA 2WB1N 4L18B 1R4NB 2A6TA 5CVUA 1DPUA 5A2QZ 2QKMB 4II2A 5L3GA 1WJAA 2L3CA 1AKHA 4U7DA 4KJZA 2LKXA 2EMWA 5D5UB 4X62E 1HKSA 2BY3A 2CQ7A 1X2MA 2BBYA 3G1OA 4KN4X 5HODA 2DLLA 3ULQB 2Y9YA 4C2UA 2DJNA 3MZHA 1T33A 3WHBA 3SXYA 5IT3A 1Y0NA 1XG1A 1LDJA 1OR7A 1YX3A 5BQTA 3F6HA 1PUFA 4G6DA 4JK1X 3LA3A 2EM0A 3L00A 1VQMI 1U2WA 4GKJE 3H09A 1T4OA 2FMLA 3SZPA 3I59B 2EM8A 2QKLB 3ZQQA 1QRYA 3HRMA 1TQIA 2PBIA 4FK5C 2JWTA 1QPMA 4UVCA 2R93J 1R23A 2XSDC 3JSOA 2M9HA 1FMWA 2VRDA 2M5WA 2DPDA 2J7JA 3QG5C 3J81C 1A6QA 2EOIA 2WY7Q 3JCUC 2VL8A 4HTGA 3ZP5A 1UCRA 3H5RA 4LJZF 3HDDA 2DODA 1F36A 3SJMA 4BNCA 3GTMJ 2FX0A 3L2VA 2XF5A 3CCEI 2DMQA 1FBSA 2GLOA 1I6XA 1D0YA 2H8RA 3BJAA 1HSJA 3CC7I 5LGNA 2R92J 1IN5A 1EH6A 3VSLA 3WODF 5E1ZB 2L33A 4NHJA 4YY3E 3LA7A 2JA5J 3KP3A 3IAM2 3RI4A 4XLCA 2EM4A 4P96A 2EOZA 3TW7A 5M5YJ 1LUJB 4LU9A 3TQMA 3T1HE 3JRIA 1VFCA 4U7BA 5IYDJ 1B9MA 2OV7A 1SMYF 2JVAA 3HKZA 1XGMA 2IA1A 2V83A 5IPAA 3CO7C 3IC7A 2DSYA 5L3EA 2WAQN 5IP9J 2RPCA 3VYXA 5FLMJ 1OJLA 3WTXC 2FNPA 4PZJA 2LREA 2RS7A 3WTVC 2RDPA 1MJ9A 1HXDA 3TW6A 3BTLA 3P7NA 3F6GA 1P4XA 2ADRA 3G1LA 2BY0A 1NG6A 1ZGWA 3DU6A 4XBFA 1D8JA 4I01A 4DBRA 1XPXA 2EM3A 5HS9A 2YTPA 1OQYA 5E20A 1RNLA 4RGSA 3REOA 1BR4A 2DDBA 4PJ0C 1FOYA 3GX4X 2L01A 5E1XA 4KMFA 3DQVC 4DZJA 2EOHA 5KL3A 2R7RA 2JWOA 2LBSB 2LNBA 1IW7F 1KJKA 2XAGA 4UUSB 4NXNE 3RKXA 2DMTA 2ESNA 3P9KA 5DUKA 3CCQI 1ZRCA 2YSOA 4F93B 4UUVA 2R0QC 2VJ4A 1GVDA 3IWFA 2MDGA 1WJBA 1Z67A 4M9SA 1TN9A 1KGSA 4YFNF 3ZOBA 4YIFA 2P7CB 4HPQA 2R5YB 4C9YA 5KL4A 1FLIA 5L3CA 4RH8A 2XC7A 1XS9A 5KVRA 2IA2A 3HRTA 2HS5A 1YO5C 3K70D 3BR5A 1XNRE 1Z6RA 2IJLA 2L0KA 1G2HA 3J80K 3S3MA 3U2RA 1FOWA 3FXMA 1DPRA 2UWMA 1SMTA 1N75A 3M07A 4Y17A 5IOYA 2XGXA 3BR0A 5IP7J 1EV7A 3BWGA 4DYCA 2E2IJ 3W6JB 2KJBA 1ZG5A 1WSUA 1IG7A 3B02A 5FKNA 1H9TA 1ZARA 2R7ZJ 2R7XA 3MZYA 5BMZA 5K7FA 2YRHA 4JI4E 4DNCA 4QIWN 1N25A 2I13A 3W6KB 2GOXB 4OIRF 2C6YA 2ENAA 3ZQ7A 4RHBB 3OYEA 1K6OA 4F55A 1PJTA 4BC9A 2ZKZA 4O5VA 1JHFA 2FBHA 5F27A 3OYGA 2L4MA 3HYIA 4FT8A 4N4OB 3A4CA 5DD8A 2IT0A 2HZTA 3ZR8X 2E5ZA 2EZIA 3GZNB 2DA7A 3HRUA 3OOPA 2R4GA 1UBDC 2VKVA 5FROA 2MYSA 3WU1B 1GTKA 3NRVA 3KEQA 4Y33A 2QSHX 1X49A 2CSHA 4JI5E 3CCVI 4A3GJ 2E5NA 3EYIA 1HCRA 2YTJA 3KWRA 2A6HF 1S29A 3FWEA 1XGNA 1X1BA 2JYAA 3FISA 4I6ZA 2MKDA 1SD7A 2QZ8A 1UHZA 3A01A 5FB2A 2CFOA 3TL4X 3ERMA 2DPUA 3L09A 1VQNI 3ASOH 4HZFA 2K9LA 3AG3H 1O0WA 1DUXC 1R1TA 4M3DA 4NNJA 4YIIA 3LFKA 3NAUA 4A69C 1JKPC 2DYRH 2EL5A 2TCTA 4PJNA 2FE3A 2WAFA 1Z77A 2G9WA 2K3FA 1JTYA 3JRGA 3PO2J 1BOBA 1ETXA 4M3FA 3R4KA 1JUSA 4W97A 4DV3E 2G7HA 1STZA 2UUBE 2V1NA 2W57A 5A6BD 1A1HA 3VHTB 2KONA 2JP9A 3RYRA 1LB2A 1FX7A 3U1KA 4OMYA 2WCC3 2OCEA 2QQ9A 4DR5E 3VK6A 5A6BA 4RDUA 4DYRA 4XIDA 4ESJA 1JJ6C 5TISC 1WFXA 1N32E 2EPLX 2VT2A 4AVZA 1WJPA 2PX9A 5D5XB 1O3SA 1YZ9A 3D5LA 4NDLA 1JI8A 3K6GA 2VONA 1K83J 2OC6A 4WSGA 1JUMA 5ADZA 5FKKA 4A0ZA 2WBTA 3BTCA 4BJ6C 2FEZA 2PMZA 3PJRA 3ZPLA 1T38A 3ECOA 1FJLA 2GHFA 2GPIA 4IQ4A 3SFIA 2OQRA 4QPOA 3BIDA 4HX7A 3ZCOA 2GA1A 2YTDA 4G7ZF 2V9PA 3OYDA 4F9BB 3GZ6A 4NZVA 4GZNC 4CICA 1UJ8A 4II3A 2EMXA 5FRMA 1SD5A 2H09A 4OMZA 4BQQA 4DUZE 4M73A 3CLOA 1S7AA 2NS7A 4LGWA 2V87A 5TSEA 1QO0D 4GDFA 3VEPA 2NRAC 4YIRX 1G6NA 1FTZA 3OV8A 3DXJF 2M34A 4JX5A 2EZLA 3WE3A 2FNAA 3ZN1A 2QSGX 3QPTA 2LY9A 4LLLA 4JI7E 4NQWA 1ZQ3P 3JTZA 5CFFE 3FXUA 5LHGA 5IP6A 1I1GA 4WXHA 1LQ1A 2ZJQF 3RDIA 3CCSI 1YPNA 2I9IA 2EV6A 2HYJA 2J5PA 4GCVA 1HLVA 2EMBA 3I71A 5HOOA 1YJWI 3V7SA 2P5KA 4DR2E 2LDUA 1NK3P 3IH2A 2E19A 3DKWA 3HOZJ 1YS7A 4TUGA 2B7EA 5F0HA 1W0UA 5IT9C 3AL0C 2BEOA 3C18A 2RAEA 3K4CA 1D3YA 4AVPA 3JRDA 1MBKA 4L0ZB 2EN4A 2E72A 4E7SA 4XLEA 5TRDA 2EE8A 3HSFA 2VKEA 1XMOE 4BCAA 1MBGA 3HHGA 4G7HF 3DU5A 4U87A 5E18F 3H3ZA 5CKTA 3TP0A 1FKAE 1YW9A 1WPKA 1FMVA 4Q47A 4BS9A 4X8WA 1LNWA 4W1UA 4PK4A 1Y8RB 2EMAA 1SVOA 2V26A 3GLLA 4GGGA 1V4RA 3EUAA 2EQRA 2QSFX 2KZGA 1W5SA 2WADA 2QUFA 2X6WA 5BNGA 1OCCH 2XAUA 3JAMC 4KHPE 1A6IA 1UZCA 2JOXA 2V7FA 4D7MA 4HW0A 1FWZA 1Z21A 2GQQA 2K86A 2JA6J 2LH9A 1JGGA 1J5EE 1G59A 4MFDA 3HOXJ 2KIQA 4FETA 2UUCE 3A01B 2HNHA 3IAS2 4D9JA 4ZZDA 1PYVA 4J01A 4O3MA 1I94E 2CUFA 4C3HJ 1SD6A 2IGKA 1A04A 3FBNB 1XSXA 1S9HA 2MC3A 3RZOJ 3T8RA 2JA2A 4M9VC 3LSIA 5F08A 3GUDA 1UMQA 4RGRA 4EJOA 3CZ6A 4LF4E 2VUMJ 3OIOA 3ZRGA 1KYZA 2OTJI 3BR6A 2VQEE 3UK3C 1C0WA 4MLOA 2V1DA 1R36A 1R00A 2VI6A 3K1NA 2ZO4A 1BBGA 1JE8A 1USTA 1V5GA 2LV2A 3PL8A 2KISA 2V1XA 3CMYA 2P6TA 1T0FC 4PCQA 3RPQA 2JRMA 2JJ7A 2CT1A 1F43A 2L8TA 1WCMJ 5CLSA 4N0BA 2JVHA 3LSKA 3S2HJ 2ESHA 3ZMUA 1P2FA 4MLQA 2O8XA 3GYHX 3I53A 4I0BA 2GM4A 1R4MB 3IKVA 1LE8B 2L7KA 5B1AH 1K78B 2EOQA 5D5VB 3SQNA 3K4JA 3QOEA 1RC9A 1XB4A 4M74A 2AO9A 3H92A 4BGDA 2P0WA 2CUZA 3VWBA 1P4WA 2X9DA 3LSJA 3ZMTA 1D5VA 2DN0A 1TNTA 2WAQA 3MZ8A 4B3XA 5DS9A 1BN5A 4XMYA 4BE2A 4FX0A 5DEQA 2XGEA 1I3AA 5LGUA 1X1CA 1ZYRF 1IZ1A 1XDSA 1WQ2A 1RKTA 3WTWC 3EPHA 1ZLJA 4HNUA 2X48A 4Q4ZF 4B4CA 3GBGA 3MKYB 3ZQCA 5HNHA 2DA5A 1Q1HA 2Z3YA 4BKXA 2A25A 4IHSA 5KL6A 4E7KA 2LFBA 4IKFA 1GUUA 2CV0A 3BJ6A 4A3BJ 1MBHA 5BPDA 1TWAJ 4XICA 2HVQA 3CMEI 1VQOI 4EEFG 1JXSA 2RREA 4JI2E 3ZOQB 5A2QK 1TP4A 2EIJH 1DQUA 4IO9F 5JHFA 4JX6A 1IN4A 2DA1A 1D1CA 5C4XJ 1Z3XA 3CJQB 5LLQA 3JRFA 2CPNA 2MD5A 4HX4A 3LQQA 3KP7A 2VE9A 4CO8A 3PNYA 3BJOA 4QSHA 2BZTA 2EIMH 3SEQA 2VC1A 2EFPA 3PUFA 4A6DA 4BQOA 2M1SA 3QPSA 4UUSA 1U78A 3BY6A 2CUJA 3MD2A 1EJ9A 2IEKA 5A6AA 2UV1A 1SD4A 2XROA 3ONQA 2KOUA 3I58A 3WTZA 3OS2A 3HM5A 1MMAA 3BPVA 2OZUA 2WWYA 2EA2A 1ORKA 2Y0SA 5A6KA 3CJNA 1BOAA 1K4SA 5ED4A 3TDUC 5KL5A 1A1LA 4HF1A 1UG0A 3H0DA 1WZ2A 3K6QA 2DXIA 3C7JA 4HAMA 3F8FA 4L9JA 2HDWA 3TMOA 1B1BA 2DOAA 5FKMA 5DYMA 2EN1A 4CGZA 1A1KA 5KK1A 3H9GA 2PN6A 2EB7A 1PKPA 5D5WB 2Z1DA 1MBJA 3OYHA 1V54H 2XSJC 3OOUA 4BU2A 1MD0A 5EDNA 2DLKA 2ELYA 1Z0XA 2DA4A 2QGUA 2VN2A 3HUGB 2MC5A 2ENCA 2LKPA 4DKKA 2W84A 3DEEA 4XRSG 5JI6A 2FSWA 2HYFA 2UXCE 1U0JA 2JQ7A 2WB1A 1G3TA 4F91B 2OA4A 2NS0A 1I1SA 1WVRA 1TQMA 3G4SI 1D8KA 1XSVA 4ETSA 2XAFA 1DP3A 3JTHA 2NUGA 3E5QA 5K5QA 2VQLA 2XDVA 2HU9A 2LUQA 4WXDA 2LD5A 2FOKA 5ERIA 2ZNYA 1YS6A 4P9UA 1YUIA 4DV6E 2L4AA 2BXZA 4M6VA 1RQ0A 2DBBA 2XIGA 1XN7A 3OY9A 3IUOA 4IQJA 1YIOA 1BC7C 4ZDLA 1W7PD 2WAEA 1KU7A 1MH3A 1YI2I 2F4VE 3ECRA 5IYBJ 2L5QA 2JOBA 5E79C 3G2BA 2KRHA 1KZHA 2L54A 2HGHA 4IX7A 2DK8A 1CGPA 4OOIA 1DI2A 2RS6A 3P5JA 1B4AA 1PVEA 1X3WB 2ACJA 2EMHA 2IGNA 1TF6A 2LBFB 3O6BB 3FMRA 1YSAC 2F5VA 1I6HJ 1AKHB 1B72B 2G7UA 5KAFC 4R2PA 4BY7J 4UVBA 4EMSA 1ONVA 3CCJI 2EPKX 5AC4A 2FGGA 2JUGA 1R22A 3C3WA 3AG4H 4RS8A 4OIQF 2YTOA 3C2HA 4JQFA 4CDGA 2F5DA 2FD5A 5F04A 4M9XA 5HS8A 2IVMA 4B47A 4EM1A 3DP7A 5EG0A 2UXDE 4LFCE 2VJIA 3I55I 4MEYF 5DCMA 3WU0A 1SFKA 1WJEA 1XMAA 3I3LA 2HQNA 3GMEA 4TUIA 5EGOB 2R76A 2EN7A 5F1RA 5LHHA 1OMIA 5FJ8J 1UHMA 5T6JA 3E0JB 2B7VA 2L7MP 3AV0A 1QHHD 2LUPB 4JI0E 3BCAA 3RTRA 3K4MA 2OTLI 2RSIA 5DCMB 1YQAA 1KQ9A 2LVSA 1JTXA 2DTZA 2VE8A 2YWQA 2XAQA 1NH3A 4CXFA 2LJUA 9ANTA 1BW6A 1SVMA 2OJED 1HQCA 3ADIA 1Z1DA 2GAUA 1MDMA 1J7KA 1AOYA 4IRIA 2YPRA 5TGTA 4Z6YA 4XLFA 3QPLA 2E71A 2EPOA 2IXSA 1JKRC 2YSRA 1G3SA 1BBYA 1JGSA 1W7PA 3RCOA 1Y0UA 3ZMVA 4PFOA 5FLVA 2V9VA 4IVNA 1B59A 4ENNA 3CO6C 3JAMZ 2PMUA 2LMDA 3OWTA 1BI3A 2DA6A 2CGPA 4DV4E 4I76A 3T8TA 2N3GA 4BEHB 5EEGA 2E2JJ 3JSPA 2YT4A 1I50J 4UHTA 2DQRA 4HLYA 2FQ4A 2VLAA 2W85A 3KE2A 3CUQC 5B5EC 4EJTA 3BG5A 2IAIA 1UFMA 2LF8A 4CHUA 2HDDA 2EL6A 2EIKH 2LR8A 2MLKA 3UKGA 5DCFA 3BG6A 4EATA 2K3PA 3FF5A 2V4JC 2VKDA 3QAHA 3LSTA 4MQVA 5B66C 2EOEA 5GAGJ 1NHAA 4IHWA 4WWCA 2OCCH 2JA7J 1ZGJA 2QENA 2HKOA 2PJRB 1FIPA 2F6CA 4XOTA 4F52A 4HA8A 4AM3A 4R2CA 4BBRJ 3OS1A 1QPIA 2VB6A 4GRIA 1PUEE 3ZMSA 4M2ZA 2CQXA 2EOXA 2Y31A 2L2MA 4IRHA 2VQFE 2K9MA 4DV7E 4DGWB 2ODRD 3F72A 3F9KA 2M2EA 3TO6A 1R71A 1V5FA 2AQFA 2ME6A 2PLYA 1PP8F 2P6SA 4LF9E 2CMPA 4LD5A 4X1EA 2ZC2A 1DGWY 3ABTA 2BV6A 3NARA 3PSFA 1WWXA 4KIBA 3V4GA 4CCMA 1D0XA 3OYMA 5CVIA 3B6CA 2W7NA 4FX4A 1AU7A 1ENHA 3JRCA 2HOSA 2HQ5A 1U3EM 1DGRM 4CYCB 2LVHA 2EM2A 1GV2A 2KPMA 4JBAA 3DPUA 4ZTFA 1TL8A 1N77A 2F4OB 4BEHA 3D5RC 2IS2A 4PJJA 3ADGA 2V85A 2CJJA 2I8DA 2ISYA 2OD5A 3BP8A 5GPAA 4IJDA 3DPLC 2ICWG 3KP5A 3K4BA 3R61A 5J4YA 2ZXJA 2EMZA 4ENJA 4R2QA 2F2EA 2L9RA 1R5ID 5BS6A 2DA2A 2WV1A 2XASA 3F21A 2IS1A 1UG2A 3VYYA 1LDDA 3CMAI 4Y4RA 1YHQI 3Q0UA 5ICCA 1IUFA 2HEOA 1OLTA 2ZJ2A 2L2NA 2EOMA 2E36A 4YHHE 1S6LA 3OYKA 4S04A 2IPQX 1U9OA 2KMUA 4R2AA 1MW7A 1A1JA 4UV8A 2EN3A 5B3SH 2CH0A 2EWLA 3EUHA 1MMDA 2KDZA 3CLQA 2LP0A 3FHZA 4G9YA 3V42A 4F3QA 1ZH5A 4LB5A 5E1WA 1ETYA 3LSPA 1U9NA 2JY9A 5CVVA 1Z6TA 2M7BA 3T1BA 1ZG1A 1G3YA 2IGOA 2ZMEB 1S72I 4IOAF 1E0EA 2YPNA 5CYVA 2DMPA 2OU2A 5EEAA 2YU5A 4RBOA 2EPMX 3UR3C 1Q1VA 3V8LA 1TWFJ 1N34E 1U8BA 2EWNA 2O3FA 3Q0WA 4M3EA 3HPSA 3BR1A 2LG4A 4HG2A 4WSPA 2CQNA 3MCZA 1ZREA 3KZYA 4A3IJ 3LMMA 2O03A 5HDGA 4KUMA 1MJBA 4BACA 5HLTA 3I4NJ 3BG9A 2XAHA 2B0LA 2QQAA 1P92A 3L1PA 4R79A 3E6CC 4IHTA 5BR8E 4DR6E 5KAIC 2NOGA 4BC7A 4L9NA 1CF7A 3DBLB 4MTDA 2DMYA 2K7LA 3MAJA 4L9VA 2XB5A 3WTYC 4M3BA 1FOKA 2X1CA 4N9IA 1YJ9I 2UUAE 1KQ0A 2E1OA 1FSEA 4L5IA 5ICEA 4BL0B 1Z91A 1WJFA 1RIOH 5FRNA 2DT5A 3M7GA 4PGHA 4U0WA 3TDZC 3E6DA 5HLHA 4TV7A 4XK4A 5E17F 3EPJA 3BR2A 2CW8A 1T08B 1Y56A 2AHQA 3QP5A 2RV8A 3RMPA 3VDXA 1O3RA 1O7FA 3VODA 1T2KA 2R5ZB 2CW7A 4I98B 1K79A 1W4MA 3BG3A 2VXZA 1T95A 4AIJA 2O8KA 4EJUA 4KDPA 4JI6E 3ERED 1D1AA 1FP1D 2UXNA 4RA2A 4YELA 1HW1A 4AD9A 1R5GA 2IRFG 4V19K 2BW3B 5LFAA 2RNJA 5LRRA 5HVQC 1WJDA 2HFHA 4ZYAA 1LKXA 3HXLA 2VOPA 4L5NC 2KT0A 1KQ8A 4ZJZA 1BM9A 1HSTA 1QNTA 5IWAE 1FIAA 3DFGA 1U6GA 2GWRA 2X0LA 3KP2A 4CCOA 5E3OA 2HOTA 2ELZA 1P47A 2EPUA 2BW3A 1WKMA 3NWSA 4I99C 1E3HA 4DBQA 4LLNA 1T4LB 4XLHA 4DV2E 2R5ZA 1ETKA 2ODRC 2Y2ZA 3CF2A 2DQLA 3HOTA 4LF8E 2NUFA 4G6TB 4KICA 3MHSC 2K27A 4FCYA 3HUGA 4X9JA 2OAZA 1RR7A 4A3LJ 1EH7A 1R58A 1XD7A 5GP9A 4EJWA 1KYQA 2LC2A 2EOYA 4LG0A 4LFBE 3J7AY 1SAUA 3CCRI 1I39A 2ZNZA 2F5EA 4BBSJ 2H36X 5J1YA 1HDDC 2QQ8A 4RAZA 1IC8A 5F3WA 4A0XA 3GFJA 4F92B 3LSHA 1B6AA 4AUXA 1KONA 1G4DA 2KP6A 2ENHA 2PMHA 3BF2A 3K0LA 2FBIA 4KA4A 2E5LE 2DU9A 3L2WA 4ENKA 2MC4A 3L2UA 1N3GA 2EMLA 4A5MA 3S1RJ 1K4TA 1X6HA 3VSKA 1RESA 2CWEA 3JAMK 4L8NA 3J80C 3CP8A 1MBFA 3OYBA 2ZSIB 2L2KB 5BOXA 2Y0SN 5IYCJ 4GYGA 4E70A 1H8AC 3DF6A 2Q2EA 4K0KE 3PO3J 4JV5E 3WG7H 2QF7A 3ZQGA 3RIRA 2EN8A 1TWHJ 2EJ4A
chains in the Genus database with same CATH topology
1IXRC 2H27A 4KFCA 3EETA 3E97A 1K7AA 1ULYA 4UVAA 3L9FA 4LLGF 4BXUA 1J9IA 5EEHA 1FBQA 2DAOA 4ZYEA 3LAJA 1IF1A 3F8NA 4BHPA 1GVJA 1Z7UA 1R1UA 1XCVA 2K4BA 3CUQA 2RQPA 4WK8F 1BIBA 1Z9CA 1VTNC 4LMYA 3P9CA 4M9ZA 5JR3A 1SAXA 3I5UA 1BI0A 2QM3A 5K5OA 1T6SA 2PG4A 2XUBA 1OKRA 2F5FA 2HTJA 5ILUA 3O2PE 4ESBA 3WTUC 2YU3A 4XRFA 2YR2A 1IN6A 1ZG3A 3ISPA 1U5TA 1PP7U 2D1HA 3V8JA 4QLCU 4RB0A 1XDUA 2JRTA 4M71A 5D4RA 3QU6A 2W25A 4B09A 1QQIA 2BE5F 4M72A 2STWA 2M8EA 3F23A 3EYYA 3LWFA 3FMQA 3DF8A 5L3BA 4M6XA 3Q5FA 2R7DA 2VBXA 3MWMA 1H0MA 4H0EA 1MKMA 4AIHA 3GLXA 4A6EA 2Q0OA 5FFZA 2FBKA 1FBUA 1W7PB 3WGIA 3Q9SA 3SHFA 4MQ9F 4PGGA 2XAJA 3FM3A 2J5OA 1TBXA 2Y0MA 2A61A 3M1EA 1ZRDA 3GF2A 1DP7P 2ZCWA 4HF2A 2HTSA 1AWCA 3N97A 4G6QA 4A0YA 1HW2A 2CG4A 1T39A 4RGXA 2Z5UA 2IW5A 1KU9A 1F9NA 4HBLA 5FD5A 2DI3A 2M30A 3FXRA 3U9GA 4ZYHA 1O57A 3BDDA 3KLOA 4LK1F 1QBJA 4IF4A 1RI7A 3DV8A 5DV5A 3LAPA 3F3XA 1XGOA 4PDKA 4HYEA 2D1VA 4U0YA 5K5RA 4L5JA 5E8IA 2F5CA 4HDVA 1U8RA 2W24A 5E8GA 2HYGD 2M1BA 5LBQA 2HQRA 1OPCA 3HHHA 2HWVA 4EV0A 2DFIA 2GXBA 4KNYA 1LEAA 3E6BA 5JVTA 1XCBA 2ELHA 2WTEA 5J6XA 1O3QA 4I02A 1J0RA 2VODA 5L3FA 4HLXA 4WX9A 3FM5A 2MBFA 3FX3A 1KU2A 5CVJA 3WGGA 1RUNA 2Q8KA 2FXAA 3M9AA 4P9FA 5JFRA 3S2WA 1YW8A 1ZGAA 3CDHA 3MQ0A 2MLGA 2AXLA 1WRJA 1IUYA 5BPIA 4R8HA 2RGVA 3QRFF 4OIOF 4RB2C 4MNUA 2OQGA 1IXSB 3CUQB 5D8KB 3T5XA 2K02A 5FO5A 1LJ9A 2E1NA 3WG9A 3BZ6A 3R60A 2Y75A 1U5TC 1JHHA 4HQMA 4IJAA 1GHCA 2E7WA 2X4HA 1ZLKA 4GXOA 2XRNA 4I7HA 4D0PA 4HDUA 3ML6A 1HKQA 4KIFA 1E17A 5F64A 1KU3A 2KJCA 4EJVA 5LHIA 3IRRA 2HGCA 1SFEA 2QVOA 2KRFA 1F5TA 1W5TA 3F6OA 4MTEA 3AAFA 2P5LC 2RKHA 2DW4A 1WI9A 3KEOA 4LG0B 3T0YA 1XGSA 2RC4A 1REPC 1SFXA 3COAC 1IXCA 5FLXZ 4ZH4F 4FHTA 1FPQA 3KFWX 5HDKA 2KIUA 1LVAA 3TQNA 5TJJA 3L7WA 3HOSA 1V3FA 3F6VA 4I09A 4QWQA 3HSRA 4HV5A 3J81K 3EQLF 3V8KA 3Q9VA 2JSCA 4L0YB 2R3SA 2WC2A 2JZYA 2DTRA 2D45A 3WGHA 2PFBA 2EFNA 5ICGA 3N4MA 2BYVE 4MGRA 2ZFWA 2A69F 4UV9A 3TKYA 2DO7A 3E5XA 4IRGA 4LB6B 4AWXB 4K2EA 2P4WA 3KP4A 2FQ3A 5J8FA 3EDPA 6PAXA 2NYXA 4A5NA 1BJAA 5L3DA 2A07F 1QGPA 2UXXA 3KLNA 4ZYDA 4I2OA 1LEBA 4LK0F 2D2WA 4M6YA 1J75A 2LSOA 2QQBA 2VBYA 2EFOA 1J2XA 1YYVA 3FZVA 3H3UA 2XKOA 3NEUA 3IWZA 4RGUA 3QPHA 2EV5A 1S7OA 3IL2A 2BGCA 1FSHA 3K1MA 2STTA 2QWWA 5H6QA 2O6GE 4I0AA 1K78A 1R5HA 1FYLA 3GFLA 1FY7A 1XMKA 3G73A 3HTUA 2EA4A 2LF7A 3L2CA 1ON2A 4ON0A 5LEJA 4Q5SF 1ZRFA 4UNOA 1U5TB 3JW4A 2GA2A 1TW2A 5J8CA 4MEXF 1S8NA 1TW3A 3RYPA 4EVIA 1UB9A 3WE2A 1BC8C 5ILVA 3GWZA 3F8MA 3LQRA 2L3DA 4MHGA 2V6CA 1MJAA 4XSXF 4GYIA 1BIAA 3NQOA 1XSDA 2PQ8A 3KCCA 3TO7A 1P4AA 4OU0A 3KZZA 1TTYA 3RKWA 4G8XA 3JTGA 1I5ZA 2TDXA 1TLHB 2EK5A 2QBYB 3F8CA 1O3TA 5K1YA 4KT5C 5LGTA 3HSEA 2XKPA 5AONA 4BHBA 4R1HA 4Z2YA 2ISZA 3QU3A 4HF0A 2Z33A 3FMSA 2H6CA 2R7FA 5D6EA 3V7CA 3I4PA 3D0SA 2K4JA 2P8TA 3GZ5A 4P5OA 2VBWA 1MDMB 1QZZA 3SFZA 4OIPF 5ICFA 1HW5A 3B73A 3K1PA 5HDNA 2IA0A 2A68F 3GFIA 4GO1A 4BH9A 1USSA 4KMUX 2RN7A 5CVRA 3IKTA 2Z99A 4A2UA 3LA2A 2CYYA 5ILSA 1RUOA 5IT9Z 1FP2A 2L02A 2NNNA 2HKXA 2UZKA 4XLPF 2ADUA 4KIGA 4N9HA 4RB3C 4ESFA 2JTVA 1J5YA 1T98A 3QOPA 3VB2A 1GXQA 3RPUA 3R6SA 1YW7A 1OYWA 4Q48A 1CF7B 2FU4A 5FGMA 3VFZA 1E2XA 2H94A 3SZTA 3BPXA 3E5UA 3ZMDA 1HBXG 3QP6A 2VC0A 1YFHA 1J59A 2PJPA 2HR3A 1MZBA 1LDKB 2ETHA 2CFXA 3U1DA 1TNSA 4S05A 2XV4S 1FC3A 1I27A 3GW2A 3ZMZA 4BYYA 3CTAA 2CSOA 1TQPA 2ZMEA 5H20A 4WCGA 3WTSC 3E3VA 3BROA 2FF4A 3GVAA 5JHUA 5FFXA 3KETA 5D4SA 2CW0F 4U88A 4RAYA 2EV0A 1GXPA 3PQJA 1IN8A 3HRSA 5LRSA 3K9TA 1SFUA 2O61A 3HTSB 1QZYA 4ZYGA 1L0OC 3DEUA 3TO9A 4EGZA 4BHCA 3RKYA 2ZBKA 4HQEA 1FT9A 5HLIA 4HX8A 5AIQA 2V79A 3IHUA 1G3WA 4IPAA 2YX4A 2EJRA 2WV0A 2CO5A 3P9IA 2XVCA 1YLFA 1FYMA 3KP6A 3ELKA 2MH2A 5H6RA 3ECHA 3K2ZA 4AIKA 2A5YB 1B9NA 3R0JA 3F22A 2YX7A 2XHKA 2VBZA 2RVCA 1KA8A 2H6BA 1ODDA 5IT9K 3GXOA 1PDNC 4WF2A 5LEKA 4NB5A 4U0VA 4O6JA 2IP2A 4XLNF 2QYOA 2FRHA 2P5VA 4YG2F 3IRQA 2V1UA 4EM2A 2Y48A 4BQAA 1FNNA 4ZZLA 3DPTA 1ON1A 4CZZA 1L3LA 3GFMA 3RJPA 1IRGA 4G94A 5CJ9A 4Y15A 1EH8A 1UHWA 1ZN2A 4L9TA 4BAYA 4KYWA 1X3UA 2MH9A 4ENMA 4UXNA 2CQKA 1BI2A 4HV6A 2HDCA 1HKTA 1MGTA 5F6FA 2GXGA 2QLZA 4WXCA 3ROUA 1ZAOA 2FMYA 3PQKA 2E7XA 3CUOA 2AS5F 2O0YA 1Z05A 1F1ZA 2JPBA 2GZWA 2PI0A 2E1CA 2QBYA 4XSZF 5FLXK 1R7JA 5HS7A 5D8LB 2FA5A 5DD4A 3M8EA 1IAWA 3TGNA 2A6EF 2M87A 2VT3A 5AIPA 4YFXF 1BI1A 2Z9OA 4OINF 1T0FA 4P55A 3J81Z 3VOEA 2A3SA 4KN7X 3O3KA 3K69A 2NAZA 3V7RA 4EGYA 3J7AO 3M8FA 4LFUA 2DK5A 3I64A 3MEXA 1KYWA 1FYKA 2KIMA 4HOBA 3J80Z 3WTTC 2KKOA 5FD6A 2EFQA 2PEXA 3BOQA 3I59A 1OYIA 2HOEA 4ASNA 1R1VA 5DDGA 1FZPB 4F7ZA 2M45A 2EFWA 4B8XA 3GO5A 2GIVA 2NNYA 1S3JA 3TOBA 2MA3A 3HIFA 1YG2A 3I0TA 5DUIA 3C1DA 4RB1A 2VOOA 4G7OF 3R0AA 3PFIA 4YFKF 2OZ6A 3GEZA 4EM0B 4IXAA 1O7LA 5D6FA 5HLGA 1H9GA 3ZN0A 1IN7A 4Y13A 3TOAA 2JPCA 1OYYA 3I54A 2COMA 2KIFA 3E6MA 4EQQA 1F4KA 1YTYA 2JT1A 2OBPA 3G3ZA 3F8BA 3MFKA 2P7VB 1RZ4A 3FXQA 1P6RA 4CYDA 4A12A 4DQ2A 1ZHFA 3ABUA 1IRFA 1DDNA 4L18B 5CVUA 1DPUA 5A2QZ 5L3GA 4U7DA 5D5UB 1HKSA 2BBYA 4KN4X 2DLLA 3ULQB 3MZHA 3SXYA 5IT3A 1LDJA 1OR7A 5BQTA 4G6DA 4JK1X 3LA3A 3L00A 1U2WA 2FMLA 3SZPA 3I59B 3HRMA 1TQIA 2PBIA 4UVCA 1QPMA 1R23A 3JSOA 2M5WA 2DPDA 3ZP5A 1UCRA 4LJZF 4BNCA 1FBSA 1I6XA 3BJAA 1HSJA 5LGNA 1IN5A 1EH6A 3WODF 5E1ZB 4NHJA 3LA7A 3KP3A 3RI4A 4P96A 4U7BA 1B9MA 1SMYF 1XGMA 2IA1A 3CO7C 3IC7A 5L3EA 3WTXC 2FNPA 4PZJA 3WTVC 2RDPA 1MJ9A 1HXDA 3P7NA 1P4XA 4XBFA 1D8JA 4I01A 5HS9A 5E20A 1RNLA 4RGSA 3REOA 3GX4X 2L01A 5E1XA 4KMFA 3DQVC 2LNBA 1IW7F 2XAGA 3RKXA 2ESNA 3P9KA 5DUKA 1ZRCA 4UUVA 3IWFA 4M9SA 1KGSA 4YFNF 2P7CB 4YIFA 1FLIA 5L3CA 5KVRA 2IA2A 3HRTA 2HS5A 1YO5C 1Z6RA 2IJLA 3J80K 3U2RA 1DPRA 2UWMA 1SMTA 4Y17A 2XGXA 1EV7A 3BWGA 3W6JB 2KJBA 1ZG5A 1WSUA 3B02A 1H9TA 1ZARA 3MZYA 5BMZA 4DNCA 3W6KB 2C6YA 4OIRF 3ZQ7A 1K6OA 2ZKZA 4O5VA 1JHFA 2FBHA 2L4MA 3HYIA 4FT8A 5DD8A 2IT0A 2HZTA 3HRUA 3OOPA 3WU1B 3NRVA 3KEQA 3EYIA 2A6HF 1S29A 3FWEA 1XGNA 1SD7A 2QZ8A 5FB2A 2DPUA 3L09A 4HZFA 1DUXC 1R1TA 4YIIA 3LFKA 2FE3A 2G9WA 3R4KA 2G7HA 1STZA 2W57A 3RYRA 1LB2A 1FX7A 4OMYA 2QQ9A 4ESJA 2VT2A 5D5XB 1O3SA 3D5LA 2VONA 4A0ZA 2FEZA 3ZPLA 1T38A 3ECOA 2OQRA 4HX7A 2GA1A 4G7ZF 3GZ6A 4CICA 1SD5A 2H09A 4OMZA 4M73A 3CLOA 1S7AA 4LGWA 1QO0D 3VEPA 2NRAC 1G6NA 3OV8A 3DXJF 3WE3A 2FNAA 3ZN1A 3QPTA 4LLLA 4NQWA 3FXUA 5LHGA 1I1GA 4WXHA 1LQ1A 3RDIA 2EV6A 4GCVA 2J5PA 3I71A 5HOOA 3V7SA 2P5KA 2LDUA 3DKWA 1YS7A 2BEOA 3C18A 4AVPA 1D3YA 4L0ZB 5TRDA 3HSFA 3HHGA 4G7HF 5E18F 3H3ZA 1YW9A 4Q47A 1LNWA 4GGGA 1V4RA 1W5SA 2QUFA 4HW0A 1FWZA 2GQQA 2K86A 4ZZDA 4O3MA 1SD6A 1A04A 1XSXA 2MC3A 3T8RA 3GUDA 4RGRA 4EJOA 1KYZA 1C0WA 2V1DA 1R36A 1R00A 3K1NA 2ZO4A 1JE8A 1USTA 2V1XA 2P6TA 4PCQA 3RPQA 5CLSA 4N0BA 2ESHA 3ZMUA 1P2FA 2O8XA 3GYHX 3I53A 4I0BA 3IKVA 1K78B 5D5VB 3SQNA 1XB4A 4M74A 3H92A 1P4WA 3ZMTA 1D5VA 1TNTA 1BN5A 4FX0A 5DEQA 5LGUA 1ZYRF 1IZ1A 1XDSA 1WQ2A 3WTWC 1ZLJA 4Q4ZF 1Q1HA 2Z3YA 4IHSA 3BJ6A 5BPDA 1JXSA 5A2QK 1IN4A 5LLQA 2MD5A 4HX4A 3LQQA 3KP7A 2VE9A 4CO8A 3BJOA 4A6DA 2VC1A 2EFPA 1U78A 3BY6A 1SD4A 2XROA 3I58A 3WTZA 3BPVA 2OZUA 2WWYA 2EA2A 3CJNA 1BOAA 5ED4A 3TDUC 4HF1A 3C7JA 4HAMA 3F8FA 4L9JA 1B1BA 5DYMA 4CGZA 5KK1A 2PN6A 2EB7A 5D5WB 1MD0A 2VN2A 2LKPA 2W84A 5JI6A 2FSWA 2HYFA 1G3TA 2OA4A 2NS0A 1I1SA 1TQMA 1D8KA 1XSVA 4ETSA 2XAFA 3JTHA 3E5QA 5K5QA 4WXDA 2FOKA 5ERIA 2ZNYA 1YS6A 4P9UA 2L4AA 2DBBA 2XIGA 1XN7A 1YIOA 1BC7C 1KU7A 1W7PD 2L54A 1CGPA 2DK8A 4OOIA 1B4AA 2ACJA 3O6BB 3FMRA 2G7UA 4UVBA 4EMSA 1ONVA 1R22A 3C3WA 4RS8A 4OIQF 4JQFA 4CDGA 2F5DA 4M9XA 5HS8A 2IVMA 4EM1A 3DP7A 4MEYF 5DCMA 3WU0A 1XMAA 2HQNA 5F1RA 5LHHA 1OMIA 1UHMA 3RTRA 5DCMB 1YQAA 1KQ9A 2VE8A 2XAQA 4CXFA 1HQCA 1Z1DA 2GAUA 1MDMA 1J7KA 1AOYA 4IRIA 2YPRA 2YSRA 1G3SA 1BBYA 1JGSA 1W7PA 1Y0UA 3ZMVA 2V9VA 4IVNA 1B59A 4ENNA 3CO6C 3JAMZ 2PMUA 1BI3A 2CGPA 3T8TA 5EEGA 3JSPA 4UHTA 2DQRA 4HLYA 2W85A 3KE2A 3CUQC 4EJTA 1UFMA 2LF8A 4CHUA 2MLKA 5DCFA 3FF5A 3QAHA 3LSTA 4MQVA 1NHAA 4WWCA 1ZGJA 2QENA 2HKOA 4HA8A 1PUEE 3ZMSA 4IRHA 3F72A 3TO6A 2PLYA 1PP8F 2P6SA 4LD5A 3V4GA 3ABTA 2BV6A 1WWXA 4KIBA 4FX4A 5CVIA 1U3EM 4JBAA 2ISYA 2OD5A 3BP8A 3DPLC 3KP5A 3R61A 2ZXJA 4ENJA 2F2EA 5BS6A 2XASA 3F21A 1LDDA 5ICCA 2HEOA 2ZJ2A 1S6LA 4S04A 2IPQX 4UV8A 3EUHA 3FHZA 4G9YA 1ZH5A 4LB5A 5E1WA 5CVVA 1Z6TA 3T1BA 1ZG1A 1G3YA 2ZMEB 5CYVA 2OU2A 3V8LA 2EWNA 2O3FA 3MCZA 1ZREA 3KZYA 2O03A 5HDGA 4KUMA 1MJBA 2XAHA 2B0LA 2QQAA 1P92A 3E6CC 4R79A 4IHTA 4L9NA 1CF7A 4MTDA 2K7LA 3MAJA 4L9VA 3WTYC 1FOKA 4N9IA 1KQ0A 1FSEA 4L5IA 5ICEA 1Z91A 1RIOH 2DT5A 3M7GA 4PGHA 4U0WA 3TDZC 3E6DA 5HLHA 4TV7A 5E17F 3QP5A 2RV8A 1O3RA 1O7FA 3VODA 1T2KA 4I98B 1K79A 1W4MA 2VXZA 4AIJA 4EJUA 4KDPA 3ERED 1FP1D 2UXNA 1HW1A 4AD9A 1R5GA 2IRFG 2RNJA 5LRRA 5HVQC 2HFHA