1EH6A

Human o6-alkylguanine-dna alkyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
177
structure length
168
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 168
sequence length 177
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh6A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh6A01
2HYFA 1L0OC 3VFZA 3WODF 2YU3A 2QQBA 4UV9A 5LBQA 4IRIA 3BOQA 4RB3C 3WTWC 4MEYF 2XIGA 1Z91A 1ZHFA 2V6CA 2FBIA 4P9UA 3V8LA 2NNNA 2M30A 3CLOA 5DDGA 3TKYA 3U9GA 1V3FA 1MJ9A 2JTVA 2M87A 4EMSA 4KMFA 1XGSA 1XCBA 4KN7X 4RAYA 3WTYC 2JPCA 2HKXA 2VBXA 3WTTC 2O3FA 3J80Z 3HYIA 3ZPLA 2UZKA 1J0RA 3HOTA 4KYWA 3LQRA 1D5VA 3DPTA 4I09A 5HOOA 2HR3A 2MLGA 3WTXC 3PFIA 3FMRA 1I1GA 1U6GA 5D8LB 4CYDA 1B1BA 3GZ6A 1FZPB 1OR7A 1J9IA 4A0ZA 2L4AA 3O3KA 5E1WA 1KU3A 2WV0A 5E8GA 2ZJ2A 4B09A 3F6VA 1P4XA 2GIVA 3K2ZA 4CXFA 5HLHA 5HDGA 3IWZA 1QO0D 2QZ8A 4HW0A 2FU4A 2A61A 3F6OA 1ZG3A 4MTEA 4RS8A 3FWEA 4IHSA 4MTDA 2H27A 4BYYA 1FBQA 3RKYA 2EJRA 2K7LA 1JHHA 1P92A 1IRFA 3KZZA 2EK5A 2QQAA 4UXNA 1RUNA 1G3WA 1Z6RA 3BJAA 3RIRA 4EJWA 2PMHA 3KE2A 3LAPA 4ZZLA 2Z99A 3ZN1A 4G7ZF 1KA8A 4I98B 2D45A 2B0LA 2JT1A 3MWMA 3IRQA 2IPQX 2DQLA 4GGGA 4G9YA 3FM3A 5JI6A 2VC0A 3HIFA 4GXOA 1YFHA 3V7RA 3ERED 5L3FA 1B59A 5LRRA 5BQTA 3FF5A 2Q0OA 5TJJA 1GVJA 2CG4A 3QPTA 2HFHA 1S29A 3L2CA 3DQVC 4MQ9F 4HLXA 3HHHA 4LFUA 4GCVA 4YG2F 2FOKA 2VE8A 4CDGA 4IJAA 5ILUA 5DUIA 5CLSA 2K02A 3TOBA 2ZMEB 1F4KA 4UVBA 4UV8A 2KRFA 1H9TA 3KEQA 4PGGA 4IPAA 2X0LA 5HS8A 2PLYA 1HXDA 3QP5A 1XMAA 5BPIA 3EYYA 3JSOA 2M45A 5DD4A 1T0FA 2ETHA 3HSFA 1IN4A 4P55A 1OPCA 1YS6A 3E3VA 1BI1A 2G7UA 1DPRA 2W57A 1R58A 4Q48A 2CW0F 3ZMVA 5LHGA 2WWYA 3TO9A 5HLIA 2A6HF 3L7WA 1FLIA 4OMZA 1TBXA 4I2OA 5H6RA 5D6EA 2M1BA 4HF1A 5E1XA 4EJUA 2H6BA 4LD5A 1ZH5A 2MH2A 2P7VB 2MD5A 3K1NA 3HOSA 2UWMA 3RTRA 2ADUA 4FT8A 3TDZC 5KVRA 3W6JB 1PP7U 2KIMA 4CHUA 2JRTA 1YIOA 3T0YA 5ERIA 2E1NA 3LA3A 3LWFA 1ZG1A 4KICA 4P9FA 4QWQA 1S3JA 1LDJA 5CVVA 2OU2A 3NQOA 2RDPA 1S6LA 2W85A 5FD6A 1F1ZA 2V79A 4G8XA 3JTGA 1G6NA 2XAHA 1HBXG 3EYIA 1ZLJA 4G7OF 4KDPA 3REOA 4S05A 2P5KA 2OBPA 2V1UA 4IRHA 4N0BA 1D3YA 1FOKA 3PQJA 1FBUA 4HDUA 4RGRA 1ULYA 3KZYA 3WG9A 2LF8A 1FYMA 3TO6A 2VC1A 2EV6A 3IL2A 2ZKZA 4WX9A 4ENMA 4FX0A 3OOPA 2XRNA 1FYLA 3ISPA 1TNSA 3IKTA 3BY6A 1DP7P 1R22A 3BPXA 1GXPA 2GXGA 4Y13A 3K9TA 3MAJA 1T39A 3IRRA 1TQPA 3I53A 3RPUA 1BOAA 2PFBA 1HSJA 3I0TA 3RKWA 1XSVA 5L3EA 1U5TC 4AIHA 3KLOA 5IT9Z 3JW4A 2FNPA 1OMIA 4KUMA 2H09A 4L0YB 5LHIA 2EB7A 3ZMZA 1SD6A 3LAJA 1SFEA 2L4MA 1K78B 1QZZA 2KIUA 4L18B 1PDNC 1D8JA 4LLGF 3E6BA 5L3GA 1MJBA 5AIQA 4HAMA 3GX4X 2ESHA 1TW3A 2D1HA 3C7JA 1FBSA 1U5TB 2DQRA 1FSEA 3MZYA 4UVCA 5E1ZB 2LF7A 1ZGJA 2FA5A 1ZYRF 3I4PA 1RNLA 2DK8A 5DD8A 4XSXF 1RIOH 3WTSC 3WTZA 2L01A 1R7JA 2KKOA 4EM0B 4OIQF 4M71A 3WU1B 5ED4A 4A0YA 5LGUA 3F8BA 3WTUC 3GFLA 3GYHX 5LEKA 1IN7A 4HX7A 1J7KA 1UHWA 3LA2A 1GXQA 1USTA 3GLXA 4GYIA 1YW7A 3ZP5A 3SZTA 2QENA 3CO7C 4O6JA 2IT0A 2V1XA 2RN7A 1R36A 4M6YA 1HW1A 1HW2A 2DW4A 1T38A 1J59A 3K69A 5J6XA 2KJCA 2Z5UA 4OOIA 2F5FA 4HV5A 1ZARA 1FSHA 4KA4A 1HKQA 2L02A 3CO6C 1O3TA 4UHTA 1U78A 2LDUA 4BAYA 1G3SA 3ULQB 2UXXA 4LLLA 4BXUA 2STTA 2RC4A 5CVUA 4O3MA 5K5OA 3GF2A 3WE3A 3QOPA 1IZ1A 1KYWA 3DKWA 1LVAA 3DPLC 4Q5SF 2IA1A 4MQVA 2NNYA 3DP7A 3RYRA 2Z3YA 2LSOA 4L9TA 2P6SA 2LKPA 1YW9A 4OMYA 2ZO4A 5TRDA 2GA1A 2EFNA 3SZPA 2HYGD 2ZCWA 2XAGA 4M6XA 2O03A 3B02A 1KQ9A 5F64A 3KP2A 1Z05A 1HQCA 1VTNC 3E5XA 1B6AA 2MC3A 4OIPF 3CUOA 2NYXA 1WWXA 1PP8F 2TDXA 4H0EA 2P7CB 4I01A 3O6BB 4WXHA 3I54A 4EM2A 2CSOA 1I27A 1OYIA 4M9XA 2PQ8A 3BDDA 1DDNA 2VXZA 4RGSA 2VOPA 3ECHA 3F8CA 3J7AO 2VT3A 1K6OA 2EFWA 3F23A 5LGTA 4EV0A 2V1DA 3DFGA 1WRJA 3LA7A 1CF7A 1KQ0A 4Y17A 3M8EA 1R5GA 3M8FA 2Y75A 3MCZA 5FB2A 4NB5A 5ICEA 4HZFA 5HDKA 1LEBA 2XASA 4HLYA 4IRGA 1QQIA 2HS5A 3BP8A 2ESNA 1B9MA 2CGPA 2MA3A 5JHUA 2DI3A 1LNWA 1LDDA 3JSPA 3QPHA 5FD5A 3QU3A 2DPUA 2P8TA 2M8EA 3KP4A 1V4RA 2ZXJA 1XGMA 1I1SA 4EJTA 3ZMDA 1I5ZA 4LK0F 1HSTA 2K4BA 4OIRF 2PJPA 2GA2A 2O61A 2COMA 4LG0A 2H94A 3ZMSA 4E70A 3J81Z 1B9NA 2XVCA 2K4JA 1ZGAA 2DBBA 1TLHB 2GZWA 5E17F 4BNCA 3BROA 2YSRA 1ONVA 4WXDA 1IN8A 4NQWA 3PQKA 5F6FA 3P7NA 4PZJA 3I5UA 3E5QA 1BI3A 2EV5A 5D5VB 4U0YA 2XKPA 3MFKA 3E6MA 1FP2A 1XCVA 2HWVA 1MZBA 2MBFA 4KIGA 2EA2A 2ELHA 3KETA 4B8XA 2RVCA 6PAXA 2NRAC 2QYOA 4AD9A 2D1VA 3KEOA 1YYVA 3Q5FA 3M1EA 4R8HA 2OD5A 3EUHA 2EV0A 3QAHA 1A04A 1HKSA 1R1UA 3MEXA 3F72A 1I6XA 2A68F 1W7PA 3HSEA 2J5OA 1G3YA 2EFQA 3L00A 3GW2A 1YLFA 5D8KB 3CUQA 3ML6A 5DV5A 5ILSA 1IUYA 2E7WA 4U0WA 4ZYEA 3BJOA 1EV7A 5FGMA 3FM5A 4Z2YA 1QBJA 1ZRDA 4FHTA 3HHGA 1P2FA 4A6EA 4XSZF 2R3SA 3O2PE 3N97A 4L5JA 3M9AA 1FY7A 5F1RA 2RGVA 3BJ6A 1O3QA 2RNJA 3VOEA 4EGYA 1QNTA 3SFZA 3R61A 2CYYA 1K79A 1BC8C 4OINF 3U2RA 5LLQA 1IAWA 1FC3A 1LJ9A 3CJNA 3BPVA 3VODA 2OZ6A 1IRGA 1ODDA 1USSA 1KGSA 5HLGA 5AIPA 1WKMA 4I02A 2XAFA 3FX3A 4IVNA 2L54A 2XAJA 2A3SA 3RPQA 3GUDA 3IKVA 3NEUA 4TV7A 4L9JA 4LGWA 3U1DA 1C0WA 3DV8A 3FMQA 3CUQB 3W6KB 4WXCA 5HDNA 4ESFA 3RKXA 4AIJA 2V9VA 5IT9K 1Z6TA 3BZ6A 4ESJA 1MDMA 1IW7F 1XSXA 1U8RA 3KP5A 5DCMA 1AOYA 1XGNA 2EA4A 2BE5F 2H6CA 2VOOA 2BV6A 2HOEA 4YFNF 4EVIA 1LB2A 1UHMA 5CVRA 3HUGA 4HF0A 1XSDA 3GZ5A 3V7CA 5CVIA 3JAMK 4NHJA 2Y0MA 4LLNA 3QRFF 4R1HA 2OZUA 1BM9A 2GQQA 1SMTA 1NHAA 3HTUA 5CJ9A 5BPDA 3IWFA 1XD7A 2FMLA 3RI4A 3K1MA 3D5LA 2VBZA 2VN2A 5JR3A 2FNAA 3WU0A 5A2QZ 1REPC 1BJAA 2Q8KA 2GWRA 5FLXK 1S7OA 1TQMA 1MGTA 4F7ZA 3ZQ7A 1L3LA 2HDCA 1ZREA 4HX4A 1R00A 1MDMB 2MLKA 1SD4A 2VBWA 1XGOA 3KFWX 3FXQA 5DCMB 1FNNA 2PMUA 2QLZA 1YQAA 2HTSA 1RI7A 4WCGA 4XLNF 2A69F 2F2EA 2Y48A 3C18A 1EH7A 2F5DA 4MEXF 3F8NA 3EDPA 1DUXC 3B73A 1IXCA 1P6RA 2D2WA 4G7HF 4BH9A 4XLPF 4ZYHA 3ZMUA 1EH6A 4ESBA 3T5XA 5LEJA 1XDSA 1S8NA 2P6TA 2FXAA 2ZBKA 1Y0UA 5CYVA 2QBYA 1FP1D 4U7DA 4HF2A 4I7HA 2O6GE 1OKRA 3JTHA 1MKMA 1O7LA 1Q1HA 1TQIA 4KN4X 3ROUA 4LMYA 1JE8A 2O8XA 3E6CC 4PGHA 2Z9OA 2NAZA 3F21A 4HX8A 2E7XA 2QWWA 4CGZA 2A6EF 2QQ9A 3P9IA 1R23A 1XMKA 2HQNA 2P4WA 3RYPA 1SFUA 1FX7A 2O0YA 3TO7A 4L9NA 2KJBA 2AXLA 2XGXA 4ENKA 5AONA 2J5PA 4ETSA 3E97A 3P9CA 1E2XA 1KU7A 3E5UA 5BS6A 2QM3A 3AAFA 5D6FA 5FFXA 1T2KA 5HS9A 2YR2A 3J80K 3BWGA 3P9KA 4L5IA 4M73A 2JSCA 4AIKA 5D4RA 1AWCA 4A2UA 5L3CA 3VB2A 4HQEA 5IT3A 4FX4A 2L3DA 2P5VA 2QBYB 2ISZA 5DEQA 3HRTA 1ZN2A 3OV8A 1CGPA 1IN6A 1ON2A 4YFKF 4Y15A 4ENJA 1ZLKA 3TDUC 2CO5A 1O3RA 2OQGA 1YTYA 2A5YB 3N4MA 2X4HA 4WK8F 2BGCA 2ZNZA 3ABTA 3R4KA 2EFPA 1WQ2A 3FZVA 4YIIA 1QPMA 1KQ8A 1GHCA 4HYEA 3ECOA 4QLCU 3R0JA 1G3TA 2FBKA 1R1VA 1J5YA 5LRSA 2EWNA 2FBHA 3E6DA 1KYZA 1Z7UA 4L9VA 1R1TA 4Q47A 1PUEE 2AS5F 4ENNA 2ACJA 4DNCA 3QU6A 1MD0A 4UUVA 1ON1A 3KP6A 3GFIA 3NRVA 5J8FA 3COAC 2IW5A 4U88A 1ZRFA 1E17A 4LJZF 2BEOA 3J81K 2R7DA 1WSUA 1OYWA 4EQQA 3V8JA 2DPDA 3T1BA 2JZYA 2VBYA 4EJVA 3WGIA 4WF2A 1XB4A 1ZAOA 2RKHA 3GFJA 1K7AA 4HA8A 4KIBA 3IHUA 3HRMA 3FHZA 4RB1A 3ZMTA 5HVQC 5CVJA 1P4WA 3T8TA 4M74A 1SMYF 4U7BA 4A5NA 4BHPA 3LSTA 4HOBA 5ICGA 1J2XA 4XRFA 2P5LC 2ZNYA 4HDVA 4MGRA 4RB0A 1QGPA 4KNYA 3I59A 3L9FA 1QZYA 3ABUA 3I64A 1BIBA 1LDKB 4G6DA 3CDHA 3ELKA 3L09A 3G73A 2ZMEA 3ZN0A 1B4AA 3FXUA 4A12A 3HTSB 4LK1F 5H20A 4P5OA 3DEUA 2YX4A 2W84A 1CF7B 4HBLA 1W7PD 2Z33A 4MNUA 1UB9A 4G6QA 2DFIA 1IXSB 3LFKA 1FWZA 2Q2EA 2DTRA 3T8RA 1F5TA 4BHBA 1P4AA 3F8FA 4OU0A 3GEZA 2FEZA 5BMZA 2NS0A 3WTVC 2BYVE 5K1YA 4G94A 3I71A 4M72A 1W4MA 1Z1DA 1O3SA 1FYKA 2RV8A 3VEPA 2YX7A 1H9GA 1YG2A 2FRHA 2VE9A 3I59B 3R6SA 2IJLA 5D5WB 4LG0B 1X3UA 4LB6B 4JBAA 4ON0A 2DO7A 1IXRC 5EEGA 2PI0A 1RUOA 2WC2A 4RGUA 1Z9CA 4WWCA 1JHFA 3F22A 2HEOA 1ZRCA 1LQ1A 4M9ZA 4XBFA 1RZ4A 1IF1A 4GO1A 4RGXA 3SQNA 5KK1A 3C1DA 1JGSA 3EQLF 2EFOA 4HV6A 4ASNA 2A07F 1S7AA 2E1CA 4O5VA 2HGCA 4EGZA 1LEAA 1YW8A 3CUQC 3WE2A 2FQ3A 3C3WA 5ICFA 3QP6A 2PG4A 2C6YA 2W25A 1ZG5A 1F9NA 4JQFA 2WTEA 1TTYA 4KMUX 4R79A 1BC7C 1XDUA 3IC7A 3MQ0A 5D4SA 1W7PB 5H6QA 1SD5A 2QUFA 2IP2A 3H92A 5A2QK 4KFCA 3K1PA 3GVAA 4M9SA 2XKOA 2HQRA 2IRFG 1UFMA 4KT5C 3R0AA 3HSRA 2IVMA 3EETA 4A5MA 1O7FA 2CWEA 3DXJF 2CQKA 2VODA 1BI0A 3TQNA 1FPQA 1D8KA 3GXOA 2F5EA 2OQRA 2KIFA 3RDIA 5L3DA 3WGGA 1BIAA 1XN7A 5DYMA 4K2EA 2DLLA 4ZYGA 2XHKA 1K78A 3HRSA 2VONA 1BBYA 1BI2A 4Q4ZF 2FSWA 3HRUA 1U5TA 2R7FA 4BHCA 5D5UB 3GWZA 4ZH4F 1TNTA 1SAXA 3SXYA 2STWA 2GAUA 2M5WA 1STZA 4PDKA 4I0BA 4JK1X 3LQQA 1U2WA 3Q9SA 4I0AA 3SHFA 1KU2A 3F3XA 4P96A 5HS7A 3DF8A 4YFXF 1U3EM 3S2WA 2K86A 2ZFWA 2FE3A 2MH9A 3M7GA 5FO5A 3KP3A 3GFMA 2PN6A 4N9HA 4N9IA 2PBIA 5LGNA 4BQAA 3RJPA 2JPBA 2XROA 4YIFA 2G9WA 5ILVA 1YS7A 5E18F 2W24A 4D0PA 3V4GA 2HZTA 5LHHA 4UNOA 2IA0A 2VT2A 3K0LA 2CFXA 2HKOA 2XUBA 4IF4A 4U0VA 4IHTA 1T98A 3MZHA 4PCQA 4LB5A 3D0SA 4EM1A 2XV4S 5EEHA 5J8CA 4HQMA 2K27A 1EH8A 1BN5A 1W5TA 3JAMZ 3TOAA 4S04A 1TW2A 5FFZA 2FMYA 4L0ZB 1IN5A 1OYYA 4AWXB 4RAZA 5K5RA 1J75A 2IA2A 5DCFA 4RB2C 2DAOA 4A0XA 2DT5A 1SD7A 1WI9A 2OA4A 5ICCA 1G4DA 2OAZA 4DQ2A 3H3UA 3Q9VA 1FT9A 5FLXZ 1KU9A 3KLNA 1UCRA 2QVOA 3F8MA 3G3ZA 5JVTA 2ISYA 3FMSA 1MJAA 1YO5C 1W5SA 3KP7A 5BOXA 4IXAA 1DPUA 1HKTA 1R5HA 4CICA 3V8KA 4ZZDA 4CO8A 3CTAA 1H0MA 2DU9A 1T6SA 4EJOA 3GO5A 2XAQA 5E8IA 2G7HA 4OIOF 1JXSA 2DK5A 3WGHA 2FF4A 2RQPA 3I58A 4AVPA 2GXBA 2LNBA 2UXNA 4ZYDA 5JFRA 1HW5A 4UVAA 4CZZA 5K5QA 3FXRA 4A6DA 3TGNA 2HTJA 3H3ZA 3V7SA 2YPRA 1O57A 5L3BA 5DUKA 1SFXA 5D5XB 2BBYA 4MHGA 2PEXA 4GYGA 4KIFA 3KCCA 3R60A 2F5CA 5E20A
chains in the Genus database with same CATH superfamily
1OCOH 2HYFA 1L0OC 3VFZA 3WODF 2YU3A 2QQBA 4DV6E 4UV9A 4LIVA 5LBQA 4RM2A 4IRIA 5F3WA 3BOQA 3ZQGA 4RB3C 4A3LJ 3WTWC 2X6XA 4MEYF 2EJ4A 4AYBN 2YTDA 2XIGA 4AC0A 1Z91A 4LFAE 1ZHFA 2V6CA 2FBIA 4P9UA 3V8LA 2NNNA 5M3FJ 5JVGF 4TUGA 1W1WE 5E3OA 3G6EI 2M30A 3CLOA 4KT6A 2M4IA 5DDGA 5GADJ 2YTGA 5ADZA 4A3BJ 1A1JA 3TKYA 1JKRC 3FK7A 4F52A 3LLHA 3U9GA 2KLOA 1TT0A 1V3FA 1MJ9A 2A5WA 2JTVA 2M87A 5TSEA 1E0EA 1XMQE 4EMSA 1YITI 3CCLI 5KNLA 2BOLA 3BR5A 3CCJI 4KMFA 1ETXA 4M0VA 3UK3C 4AUXA 1TF3A 1XGSA 2EPCA 4RLQA 1T4NA 2QSGX 1XCBA 4KN7X 1RC9A 2LBSB 5GPCA 4RAYA 4LF4E 3WTYC 1X49A 4FE7A 3DPUA 2JPCA 4P7DA 2AQEA 2HKXA 3OYFA 2B7EA 4GZNC 2VBXA 1LKXA 1AHDP 2DMQA 3WTTC 2EM9A 4DYRA 4RH8A 3GZNB 2XPWA 1X4OA 2O3FA 1MIJA 3J80Z 3G71I 3HYIA 3ZPLA 2MGQA 1HA8A 2CTDA 4CYCB 2UZKA 4P78A 1J0RA 5IYBJ 2WB1N 1N3GA 2YZTA 4BKXA 2RSMA 4IKFA 3S93A 4B3AA 3HOTA 4KYWA 2M4GA 1VQ9I 3LQRA 1MNMC 2EP3A 1D5VA 3DPTA 2RQQA 4I09A 3IH4A 4PFPA 5HOOA 2HR3A 2CFOA 2MLGA 3WTXC 3PFIA 4XM3A 1ETQA 4NHRA 3FMRA 4CCKA 1I1GA 1U6GA 4M3FA 4O5GA 3WU2C 1OCTC 3NAUA 5D8LB 1APLC 2KZGA 3PM1A 1B1BA 4CYDA 3GZ6A 1PJTA 3VYRB 2CUFA 1MMNA 4KJZA 1FZPB 4ANJA 2E2JJ 1OR7A 1J9IA 3TBIA 4A0ZA 2ODRD 3DBHB 3J7ZI 2BW3A 2CUEA 3GLLA 2L4AA 2N8GA 1YSAC 2AO9A 3O3KA 5E1WA 1W5CC 1DU6A 1H8AC 1KU3A 3G4SI 2WV0A 5E8GA 3K4KA 3NARA 2IS4A 5GTHC 3C4TA 3K70D 2ZJ2A 2DOFA 3F6VA 4B09A 4BBYA 1W0TA 1P4XA 2GIVA 2IGKA 2EN1A 3K2ZA 4CXFA 5HLHA 3MVPA 2K3FA 2Y9YA 5HDGA 2VJIA 3IWZA 1X1DA 4V2GA 4X0GA 2L9SA 1QO0D 2EQ1A 3ZQCA 2OCCH 2QZ8A 1DU0A 4HW0A 3M3YJ 4N4RB 2JUGA 4BUPA 2FU4A 4XIDA 1A36A 2A61A 3F6OA 3T1YE 4D7MA 3SYTA 2YTEA 1ZG3A 4NC8A 4RS8A 3FWEA 4MTEA 4IHSA 2YPNA 2WBSA 4B3ME 4MTDA 2H27A 4BYYA 1YIJI 1FBQA 3RKYA 2EJRA 2K7LA 2Y0SA 1JHHA 2EM8A 1P92A 5A69A 1IRFA 3KZZA 2EK5A 2QQAA 4UXNA 2JSPA 3CJRB 1RUNA 1G3WA 1Z6RA 1T33A 3PO2J 5CKTA 4RLFA 3BJAA 3RIRA 5T6JA 4EJWA 2WBUA 2PMHA 3KE2A 2JOXA 3LAPA 3LMLA 3H0DA 4A3DJ 3JRCA 1VFCA 4ZZLA 3J7YJ 4Y33A 3HDDA 3DU5A 5BNGA 1BOBA 2Z99A 3ZN1A 2DT6A 3BQZA 3VYXA 4G7ZF 1KA8A 1POGA 4I98B 3TW6A 2X9DA 2D45A 3OWTA 2B0LA 2JT1A 3RZDJ 1K4TA 2L7KA 1WI3A 2LBFA 3MWMA 4M3DA 3IRQA 3CC7I 2IPQX 1A6IA 2DQLA 4IHWA 1HC8A 4GGGA 4G9YA 3FM3A 4ZDLA 5JI6A 2V4JC 3CCSI 2VC0A 3VWBA 5A2QC 2GLIA 3HIFA 4GXOA 3OYNA 4JI0E 2IAIA 2DT7B 1YFHA 2QQ8A 2YWQA 3V7RA 3ERED 5L3FA 2YU5A 1B59A 5LRRA 2DA5A 2ZMEC 3OIQA 5BQTA 3FF5A 2X48A 2Q0OA 5TJJA 1GVJA 1P7JA 2CG4A 3QPTA 2KZVA 3CDLA 4JP0A 2CV0A 2HFHA 1S29A 3L2CA 3DQVC 4MQ9F 1ETYA 2M34A 3CCYA 4DBQA 1KZHA 3S8PA 4HLXA 4CCOA 2YTOA 3HHHA 3K70C 4XNFA 4LFUA 1VQOI 4GCVA 3TW7A 2I5UA 2EPPA 4YG2F 5IYCJ 2FOKA 4BJ6C 3WHCA 4GDFA 2VE8A 4R8OA 4GKKE 4CDGA 4Y4RA 1UELB 2MDGA 2V7FA 4RAGA 4D5CA 4IJAA 5ILUA 5DUIA 4XLHA 4A3MJ 5CLSA 2K02A 3TOBA 2XSJC 2ZMEB 1F4KA 2VUMJ 1X5WA 1X1CA 4UVBA 2EM5A 2UUCE 4UV8A 2O9LA 4R2PA 2KRFA 2JUCA 2Y30A 1BL0A 2EOXA 2R7XA 2EOZA 3OYEA 1H9TA 3KEQA 2VQEE 3P5JA 3QWLA 2X0LA 4IPAA 4PGGA 3K10A 4CUGA 2EZIA 5HS8A 2PLYA 4F2JC 1HXDA 3QP5A 1XMAA 2R7TA 2HQAA 2IS1A 3F6HA 2MC5A 3GTPJ 2NVUB 2X1CA 5BPIA 3EYYA 1DGRM 1YRNA 2KONA 3DKYA 2BB8A 2B9DA 2VE7C 3JSOA 3DJWA 4NC6A 3BCAA 2M45A 2KMUA 5DD4A 4LOCA 3EUHC 1T0FA 2OF7A 3FKIJ 2ETHA 3HSFA 1IN4A 4P55A 2DTZA 3M1CA 1PJSA 2EN2A 3V42A 1OPCA 1YS6A 3E3VA 2DFFA 1HNXE 1TP4A 1BI1A 2G7UA 1DPRA 1N77A 2W57A 1R58A 3MKZA 3BF2A 2XF6A 5E3NA 2EPAA 4FASD 4Q48A 4MLVA 5KL5A 2LBFB 4Y3OA 2Q2EB 2V8QB 2CW0F 2EQRA 3ZMVA 5LHGA 2ID3A 1X3WB 4YELA 1KONA 4CSWA 3HOXJ 2WWYA 3TO9A 4P1WA 5HLIA 2A6HF 4BGDA 2B9SA 3T1HE 1YUIA 3L7WA 1FLIA 4OMZA 5IPAA 1K61A 3ADGA 4E6KG 1TBXA 2QF7A 5H6RA 2OUMA 4I2OA 2R4GA 5D6EA 2M1BA 1UHSA 4CCJA 4HF1A 5E1XA 2L9VA 2R93J 4N4NB 4EJUA 1PJQA 3JRGA 2H6BA 2ZXWH 2M9AA 4LD5A 2QSFX 1QHGA 1ZH5A 2MH2A 1MBFA 3PSFA 5TISC 2RQLA 4R2QA 2P7VB 1R4MB 2P0WA 1TL8A 2FJ1A 4LIUA 2MD5A 3OL4A 2HOTA 3K1NA 3HOSA 1ZBQA 3RCOA 4E7IA 2UWMA 1IG7A 2M3AA 2JYAA 3RTRA 2ADUA 3NWSA 4FT8A 3TDZC 5KVRA 3W6JB 2LMZA 3MHSC 1BR1A 1PP7U 2UUBE 4R2EA 2KIMA 2VIXA 2LY9A 3I4MJ 4BCAA 4CHUA 2JMWA 2JRTA 4LU9A 2DMUA 5JLWA 1YIOA 3T0YA 3KYDB 1YOVB 5ERIA 2E1NA 5KAFC 3LA3A 3LWFA 1ZG1A 3K4BA 4KICA 2EQ3A 4P9FA 4QWQA 1TC3C 1S3JA 1LDJA 4KWYA 4DR4E 4DR2E 2LK2A 5CVVA 2OU2A 2VKVA 1RPWA 3NQOA 2NUFA 1IV8A 2YTJA 4OAYA 4LFBE 2RDPA 1S6LA 2W85A 5FD6A 2VB6A 1F1ZA 3ZQIA 2V79A 4G8XA 5HNFA 3JTGA 2MABA 1G6NA 2JQ7A 2XAHA 2IS2A 1HBXG 3EYIA 1ZLJA 3P1XA 3FXOA 4G7OF 4E7LA 3LFUA 3REOA 4KDPA 4S05A 3DF6A 2P5KA 3BR3A 3DEWA 2VJ5A 2OBPA 1UG0A 2V1UA 3G1LA 1WFXA 2XPUA 3AL0C 2V1NA 4F6MA 4IRHA 4N0BA 1D3YA 4RAFA 1ZR4A 1FOKA 3PQJA 1YYKA 2L5QA 5FKOA 1FBUA 3MKYB 4HDUA 4RGRA 1ULYA 1N34E 3KZYA 4MLQA 3WG9A 1RMDA 4HRIA 3CF2A 3RPUD 3PFYA 2LF8A 4LITA 3X2QH 1FYMA 2V87A 3TO6A 2VC1A 4XQFA 2EIKH 4A69C 2R7WA 1O4XA 1VF9A 2HU9A 2EZ6A 3GTOJ 3QODA 4ZJZA 1JTYA 2EH3A 1K4SA 2EV6A 3IL2A 2EILH 2ZKZA 4WX9A 4ENMA 4FX0A 4KHPE 2FV4B 4G12A 5IV8B 2BZTA 2HVSA 3OOPA 2DCEA 4UB8C 2L7MP 2XRNA 1A5JA 2UU9E 3IAS2 1FYLA 1GQEA 1Y1WJ 3ISPA 1TNSA 2M7QA 3IKTA 1UJ8A 3BY6A 2E35A 4HEIA 1X2MA 3WHBA 5IP7J 1DP7P 2NVQJ 1R22A 3S1NJ 4A3CJ 1S7EA 1FTZA 3BPXA 3ADLA 3K6GA 4F54A 1RC7A 3BR2A 1GXPA 2GXGA 4Y13A 3K9TA 2QGUA 2MYSA 1RKTA 3MAJA 1UZCA 1T39A 3VHTB 4EATA 3RMPA 3IRRA 1TQPA 3HL2A 2JA7J 2EMAA 5FRMA 3THNA 3I53A 3RPUA 1BOAA 2PFBA 1HSJA 1EF4A 1GTKA 3I0TA 3RKWA 1XSVA 3AG1H 5L3EA 3M8JA 1U5TC 2MW8A 3HGGA 4AIHA 1QZEA 1LE8A 2ENHA 3KLOA 2LG4A 5IT9Z 4M9VC 3JW4A 1ZELA 4HSRA 2FNPA 1OMIA 2NS8A 4KUMA 1DQUA 1Z7LA 3DLLF 2H09A 4L0YB 1I39A 5LHIA 2EB7A 1W36D 3ZMZA 3Q0WA 1SD6A 5HODA 3LAJA 1SFEA 2L4MA 1K78B 2JWTA 1QZZA 4DJAA 2KIUA 3DWLE 1EA3A 2VQCA 4L18B 1PDNC 1D8JA 4LLGF 1Z77A 3E6BA 5L3GA 5J3LA 1MJBA 2GBYA 4HG2A 4HAMA 5AIQA 3N05A 1JJ6C 3GX4X 2ESHA 1TW3A 4IZZA 2D1HA 1LVKA 5EG0A 2HJJA 2HYJA 3EPHA 2LMDA 1JUPA 1A1KA 3RSNA 3C7JA 1S5LC 2QSHX 1FBSA 1U5TB 3TL4X 2DQRA 1FSEA 2R1FA 1Y0NA 2EM3A 2XSDC 2QA4I 3OTOE 3KPHA 1F2IG 4NC7A 1ETOA 1IBLE 2EL6A 3MZYA 4UVCA 2Z16A 3BZKA 5E1ZB 2LREA 2LF7A 1V55H 2ZB9A 1ZGJA 2FA5A 1H88C 4DYQA 1ZYRF 3HEFA 1EKZA 3I4PA 2NOJB 1RNLA 2DK8A 1ZGWA 1H89C 1V5FA 5DD8A 4XSXF 2NVTJ 1RIOH 3WTSC 3IH2A 3WTZA 2L01A 1R7JA 2X6WA 2HDDA 1RKWA 1NG7A 3CMEI 4O4KA 2KKOA 4EM0B 1FJLA 4B43A 3ZQQA 4OIQF 4DGWB 4M71A 5E79C 3WU1B 3BLYA 1TN9A 4PK4A 4XOPA 1PKPA 3A01B 2EMWA 5ED4A 1V54H 4A0YA 5LGUA 1FOYA 4HNUA 4I76A 2H36X 3F8BA 2AQFA 4R03A 1IQSA 3OIOA 3WTUC 1HOMA 4HNVA 4NZVA 3HB9A 3GFLA 2ADRA 3GYHX 5LEKA 1IN7A 1T08B 1BBGA 1XMXA 4N4OB 4HX7A 4BBSJ 1WJFA 2RREA 4RBOA 1J7KA 1ZTRA 3KZIC 4K0KE 1UHWA 2DYSH 3HPGA 3DCFA 3LA2A 3AG4H 3BT9A 1GXQA 4JX4A 2EMBA 1EJ9A 1ZQ3P 4DKKA 1USTA 3GLXA 3H9QA 4GYIA 1YW7A 2OC6A 3ZP5A 1X6EA 3SZTA 2ELZA 4II3A 2EMLA 2QENA 3CO7C 4O6JA 3L2QA 3HPZA 3ZGKA 4F91B 2V1XA 2IT0A 2RN7A 1BW5A 4BY7J 1R36A 2K9MA 3H5AA 4M6YA 1HW1A 4ZTFA 1HW2A 2L33A 1J5EE 3E7LA 3H09A 2DW4A 3MKWB 1T38A 1J59A 4BC9A 3K69A 1Z0XA 1VQLI 4XR6A 5J6XA 2BY1A 2Z5UA 2KJCA 2F5FA 3DBRB 1ZARA 3AFHA 4HV5A 4OOIA 1FSHA 4AU7A 3SJMA 4KA4A 1HKQA 2L02A 2FX0A 2KDOA 1BR2A 3HBLA 4XKWA 3CO6C 1O3TA 2DA1A 2E60A 4UHTA 5J1RA 1XG1A 2DMNA 1U78A 2JA6J 1WHQA 3JREA 2LDUA 2WY8Q 4XRMA 2ECCA 1N25A 4BAYA 5A6AA 3THOB 1G3SA 2YU9J 3ULQB 3OY9A 2UXXA 2E1MA 3HGYA 2ZJPF 4IS1C 4XKCA 5F27A 2EOJA 2LT7A 1FJGE 1WJDA 2R5ZA 4LLLA 2HC5A 3EPZA 4YIRX 1B8IA 4BXUA 4OX9E 1MMGA 3PUFA 3HKZN 2PJRA 2STTA 3SEQA 2RC4A 5CVUA 2V6EA 1VQNI 3D5RC 2HNHA 4F55A 4O3MA 5K5OA 3GF2A 3WE3A 2M2EA 4BE2A 1D0XA 4DR1E 2JVAA 1MBJA 4W97A 3OYDA 2CV1A 3QOPA 4TUIA 3ONQA 1K6YA 4FCYA 1IZ1A 1KYWA 4DBRA 4BACA 1AU7A 1Z21A 3DKWA 2M1SA 1LVAA 2LKXA 2JA5J 3DPLC 3LSJA 4Q5SF 2LOOA 4DUYE 2IA1A 4MQVA 4RA2A 2I10A 2NNYA 1UILA 2WBMA 3DP7A 2CSHA 3RYRA 2Z3YA 2N3GA 2LSOA 5HLTA 2EOYA 2F4VE 3TMOA 4L9TA 3PO3J 2L2OA 5IOZA 5GAEJ 4IHXA 4WPYA 2P6SA 2EORA 2LKPA 4MO7A 2PMZN 2YUSA 1YW9A 3CMYA 2EQ0A 4OMYA 2ZO4A 5TRDA 2LVSA 2GA1A 3K4LA 3LNQA 3OMLA 2EFNA 3SZPA 2HYGD 1MSFC 3GTMJ 2A25A 3S3OA 2ZCWA 2GHFA 4X65E 2XAGA 4A3IJ 4M6XA 3VSLA 2O03A 2ELKA 3B02A 1IBME 2XRLA 1TWCJ 1KQ9A 5F64A 3KP2A 1YX3A 5IWAE 1Z05A 4ZDPA 1HQCA 1VTNC 4IHYA 1FMWA 3E5XA 1B6AA 2MC3A 4OIPF 2E34A 3CUOA 2NYXA 2CW7A 1S9HA 1MBKA 1WWXA 4OAZA 2TDXA 3QPLA 1PP8F 4H0EA 2P7CB 4I01A 4YY3E 4UY8I 3O6BB 4WXHA 1D1CA 3I54A 4EM2A 4GEQB 3BTLA 1V5EA 3CD6I 1SVMA 2O7OA 2CSOA 5B1BH 1I27A 3VYTB 4C3HJ 1OYIA 4M9XA 2PQ8A 2E1MB 1DGWY 3BDDA 1D0ZA 3EPLA 1DDNA 2VXZA 4RGSA 2R5ZB 1PDAA 5KL7A 5IXMB 1D1AA 2K85A 1B8IB 2OTJI 4R2RA 2E2IJ 2VOPA 3ECHA 1HDPA 3F8CA 2PJRB 2VT3A 3J7AO 2YSOA 3ADJA 5B66C 1K6OA 3HQ1A 2BVMA 1N32E 4CA0A 4BU2A 3E0JB 2HZDA 2EFWA 4MFDA 3F23A 1JKQC 1VZ0A 2E5NA 5EJCA 4EV0A 5LGTA 2VXDA 5TGTA 1OJLA 2V1DA 3DFGA 1X1PA 3PL8A 1WRJA 2COBA 4Y52J 2DMIA 3LA7A 4V2FA 1CF7A 1KQ0A 4Y17A 2ZXHA 3B6CA 4IHVA 3M8EA 1T4LB 2EMYA 1R5GA 3A1YA 1VQ5I 4V19K 3M4OJ 2JR1A 3M8FA 3PIOF 4PFOA 2Y75A 1WH7A 3MCZA 2DXIA 4IOCF 2DMYA 5FB2A 3FBIB 4NB5A 2WADA 5ICEA 1HF0A 1JI8A 1QU3A 3AUZA 4HZFA 5HDKA 1LEBA 2XASA 3MHHC 4HLYA 4IRGA 5F04A 1XS9A 3GBGA 1XX5A 1QQIA 2HS5A 2EBIA 4A3GJ 3RKQA 3L2UA 3QYFA 3CCRI 3BP8A 5KL6A 2ESNA 2WBTA 5M3MJ 1B9MA 2CGPA 4GKJE 4BL0B 1WJPA 2MA3A 5JHUA 5GAHJ 3OYAA 2EPNA 2DI3A 1LNWA 1G8XA 1LDDA 3JSPA 1X1BA 3QPHA 5FD5A 3QU3A 2WAQA 2JK3A 2DPUA 2P8TA 2IGOA 1E3OC 4F9BB 2M8EA 3K2AA 3KP4A 1V4RA 2ZXJA 1QRYA 4M6VA 1XGMA 3Q0VA 4NXNE 1ENHA 2MDRA 1I1SA 4EJTA 3ZMDA 1OR7C 2CQNA 1I5ZA 4LK0F 1HSTA 1UG2A 2K4BA 4OIRF 2PJPA 3G2BA 2YTQA 2GA2A 2QKMB 3E1SA 2O61A 2COMA 3K7AJ 2HOAA 4LG0A 2V88A 2H94A 3W6VA 3CF5F 1A31A 5FKLA 3ZMSA 4II2A 4E70A 3J81Z 1B9NA 2N8XA 2XVCA 2NABA 5F08A 1ZR2A 2K4JA 1ZGAA 2EM6A 5IP9J 3AG3H 1UHZA 2DBBA 4BS9A 1TLHB 3HPSA 4DUZE 2GZWA 3ZR8X 3OYLA 5E17F 2MD0A 4D5FA 5J4VA 3U1KA 2K40A 2KOUA 3CCEI 1MNEA 4BNCA 2HI3A 3BROA 2TCTA 2M9HA 1PVEA 3HM5A 2YSRA 4CZCA 2VF1A 2QEXI 1ONVA 4WXDA 3H0GJ 3AG2H 1FMVA 1IN8A 3RQ4A 3A0HC 4NQWA 2FTXB 3PQKA 5F6FA 3I4NJ 3P7NA 4PZJA 2WV1A 2BW3B 2KIQA 3I5UA 4IL6C 3U21A 3D1NI 3E5QA 1BI3A 2EV5A 4JI2E 2F4IA 3I55I 1X6FA 5D5VB 2E1OA 4LF8E 4U0YA 3S17J 2XKPA 3MFKA 3CC4I 3E6MA 1X58A 2M7BA 1RQ0A 2ODRC 3GTLJ 4B3RE 1FP2A 4IQ4A 2E2HJ 1XCVA 2HWVA 2A05A 3HXLA 1MZBA 2XGEA 1EKEA 2MBFA 2GIZA 3K4MA 3QYEA 2NS7A 3L2WA 4KIGA 2EMIA 2EA2A 2ELHA 3IH3A 3KETA 4M3BA 4B8XA 2RVCA 5K7FA 1MBEA 6PAXA 4DV0E 5A6BD 2NRAC 2QYOA 4AD9A 2EMGA 3BTJA 2D1VA 2K9NA 3HOVJ 3IWCA 3KEOA 1VQPI 2DDBA 1YYVA 5IT9C 2LC2A 3BG5A 3Q5FA 3OOUA 1JKOC 3M1EA 1X6HA 4R8HA 2OD5A 3EUHA 2EV0A 1IQOA 4J8ZA 3QAHA 1A04A 1HKSA 1R1UA 3MEXA 3FDYA 1Z67A 4MLOA 3F72A 3S1QJ 1I6XA 2DN0A 3BR1A 2A68F 3CMMA 1MEYC 4X9JA 2KHXA 2E5ZA 1W7PA 3HSEA 1ETWA 4E7KA 2J5OA 1G3YA 2EFQA 3BR6A 1FIPA 3L00A 3W2WA 3GW2A 2Y9ZA 5EEAA 1OCPA 3A02A 1YLFA 3VDXA 5D8KB 4XLEA 3CUQA 2EMFA 3BGHA 3HTXA 3BCBA 3ML6A 3FIWA 5DV5A 5ILSA 4XRSA 1IUYA 3JAMC 2E7WA 4U0WA 4ZYEA 2B7VA 3BJOA 2EM7A 2EOEA 1EV7A 5FGMA 1ACIA 5A6BA 3FM5A 4Z2YA 1QBJA 1ZRDA 4FHTA 3HHGA 5FLVA 1P2FA 4A6EA 4NNJA 2JRMA 1JT6A 2R3SA 4XSZF 3O2PE 1ETVA 3N97A 4PUSA 4L5JA 1LFPA 3BG6A 4NQWB 3M9AA 1JT0A 1FY7A 4AM3A 3HKZA 5F1RA 4X1EA 2RGVA 2K9LA 3BJ6A 1O3QA 2RNJA 3VOEA 3IAM2 1MMSA 4EGYA 4JI5E 1QNTA 3SFZA 1UMQA 3OS1A 2W48A 4F6NA 2MG4A 5F0CA 2IXSA 1T8IA 5LMUE 3R61A 3HC7A 3PJRA 2IEKA 4QPOA 4QTRA 2CYYA 2EINH 4F93B 4R2CA 2ZXIA 1K79A 1F43A 3C4BA 5FLXC 2LLKA 3JRIA 1BC8C 4OINF 4B44A 2CUZA 3U2RA 3JRBA 3BG7A 5LLQA 4NXME 1IAWA 2F4OB 5B5EC 1N36E 1FC3A 1LJ9A 2JP9A 3CJNA 3H36A 2VRDA 4AYBA 5A6JA 2QCOA 5J4YA 3BPVA 4R2DA 4ZYAA 3VODA 2OZ6A 1IRGA 2YTIA 2EOHA 1ODDA 2HOSA 1VQ6I 2IS6A 4JI1E 1N33E 1T0FC 4ZC3A 1USSA 1I6HJ 1KGSA 2V9PA 2E19A 5HLGA 2EN3A 5AIPA 1WKMA 1LLMC 4I02A 3OYKA 2XAFA 3FX3A 2VPLA 4IVNA 2EMCA 2FGGA 2L54A 2XAJA 2EMZA 2A3SA 3RPQA 3GUDA 3IKVA 3NEUA 4R2AA 4TV7A 2EM4A 4L9JA 4ABZA 3MZ8A 3IP4B 3HOYJ 4HPQA 4LGWA 1YUJA 3U1DA 2DA2A 3VK6A 2HXIA 3H35A 1C0WA 5AE3A 3DV8A 5CPRB 3FMQA 3S1RJ 3CDIA 2I8DA 1YJNI 1YRNB 3CUQB 3W6KB 4WXCA 5HDNA 2HPIA 2KISA 3C2BA 4ESFA 3RKXA 4E7ZA 3ZOBA 3G1OA 4AIJA 4HTGA 4DV7E 2KT0A 1X4PA 1ZAAC 2V9VA 3QG5C 5IT9K 1Z6TA 3BZ6A 4ESJA 1MDMA 1IW7F 5C3EJ 1XSXA 3DU6A 1U8RA 3KP5A 2CPNA 1IDYA 4JI6E 2LJHA 5DCMA 2WB1A 3H3VK 1AOYA 3H5NA 4O43A 3KX2A 1GDTA 3LOCA 3NWTA 4XRSG 1OQYA 2V26A 1XGNA 2XPVA 2EA4A 3QOEA 1T95A 2JN6A 4E7HA 2BE5F 3GCMA 2H6CA 1PJRA 1DGCA 2HPMA 1PYVA 2VOOA 3TEDA 3J7Yp 2BV6A 4XKVA 5IP6A 4DR6E 5M5XJ 2HOEA 2KQRA 4YFNF 4EVIA 3FXKA 1UHMA 4XN0A 1LB2A 5CVRA 5EZGA 4A3KJ 3HUGA 1Y39A 4HF0A 1VQ4I 1XSDA 1FIAA 2F5VA 3GZ5A 3V7CA 1P47A 5CVIA 4J19A 3JAMK 4HEA2 4R2SA 2BBGA 1OCCH 5GTIC 2P81A 4NHJA 2Y0MA 3JCUC 1NTCA 2YS9A 1MMAA 4I6ZA 3H9JA 4LLNA 1MW7A 1Y1VJ 4EEFG 3QRFF 4R1HA 2DA6A 4LG3A 1WHUA 4OWRB 4C2MJ 4CH7A 2OZUA 1BM9A 2ELJA 2GQQA 5EDNA 1D5YA 2OTLI 2L3CA 1SMTA 1QVTA 1TT5B 4QSHA 1NHAA 3HTUA 5CJ9A 4B4CA 5BPDA 3EQ1A 4XLFA 1X1AA 1WVRA 1XD7A 2FMLA 3IWFA 4PSWA 3BIDA 5FLMJ 3LSPA 1LPQA 2YRHA 3M99B 3RI4A 3S2HJ 3K1MA 1XTAA 3D5LA 4JX5A 2VBZA 1I94E 2UUZA 3OYMA 1G59A 2VN2A 5DTDA 5JR3A 2FNAA 4MFEA 3WU0A 5F0HA 5A2QZ 1BJAA 1REPC 4DR7E 2Q8KA 2GWRA 1X47A 1E3HA 2CQXA 2VQLA 5FLXK 2DJNA 4D9JA 4FK5C 1S7OA 1TQMA 3ASNH 1SC7A 1MGTA 2RS6A 3I3LA 4F7ZA 4IO9F 1RR7A 3DKXA 3ZQ7A 4DV3E 1Y56A 1LFUP 1L3LA 2HDCA 3TP3A 3F0CA 4DW6A 1NK2P 3ZQLA 1ZREA 2LYCA 3GTQJ 4X8WA 2OPTA 1QPIA 1JJ8C 4HX4A 2YTPA 3J80C 2PRTA 3DTIA 2CMPA 1R00A 3IV5A 2MLKA 1MDMB 1SD4A 2VBWA 1R5ID 1XGOA 3KFWX 9ANTA 3FXQA 4F3QA 1SFKA 2M0MA 5JLXA 4IJDA 5DCMB 2XB5A 3FISA 1FNNA 1HR0E 2PMUA 4KZSA 5HNHA 3BR0A 1U0JA 5BR8E 2QLZA 3HOUJ 1YQAA 3J7AY 2V9KA 2ELYA 2HTSA 2VQHA 3RQIA 1RI7A 4WCGA 2NA2A 2BXYA 2Z2SB 4XLNF 1GV2A 2A69F 2XF7A 4B48A 2F2EA 2LRDA 2Y0SN 2Y48A 3C18A 1EH7A 2F5DA 4MEXF 3GTJJ 1X2NA 5FKKA 3F8NA 3EDPA 4L5EA 1DUXC 3B73A 1FTTA 1IXCA 1P6RA 2D2WA 1UBDC 3OMYA 4G7HF 4BH9A 4XLPF 1BB8A 4ZYHA 3ZMUA 1EH6A 3L1PA 4Y7NJ 4ESBA 1HCRA 2R76A 5DS9A 3T5XA 5LEJA 1XDSA 1S8NA 5EGOA 1GT0C 2P6TA 2EMXA 1OLTA 2FXAA 2ZBKA 1Y0UA 5CYVA 3UNGC 2QBYA 3C2HA 1FP1D 4U7DA 3FXJA 4HF2A 3S15J 1OISA 2EOSA 4I7HA 2O6GE 5CQGA 1OKRA 4M3GA 2HQ5A 3JTHA 1A1FA 1MKMA 1O7LA 5KHDA 1Q1HA 3H1CA 5F0FA 1MNDA 1R49A 1ITYA 1TQIA 4C2UA 3PNYA 4KN4X 3ROUA 5EF6A 4LMYA 1JE8A 2O8XA 2EOIA 3E6CC 1QVUA 1ZK8A 4PGHA 2Z9OA 2NAZA 2R0QC 3F21A 1Q1VA 2EPLX 1IJWC 4D1QA 3A4CA 4HX8A 2E7XA 1X48A 2QWWA 4CGZA 2A6EF 5C44J 2QQ9A 2BHYA 1NEIA 1JUSA 4C3JJ 3P9IA 1R23A 1LE8B 1R4NB 5LL6R 1IO2A 1XMKA 2HQNA 2RPCA 3ECRA 5AC4A 4BQQA 2KRCA 2YRMA 1SR9A 1WH5A 2UXCE 2P4WA 1YX5A 3RYPA 2MFZA 5LFAA 3JU0A 1TZLA 2ZFUA 1SFUA 1FX7A 1KYQA 3EPKA 2UXDE 2HDWA 5J1UA 2O0YA 4A93J 3TO7A 4L9NA 1JUMA 3SEZA 5FKMA 2XF5A 2KJBA 4GRIA 2AXLA 1AKHA 3J81C 3FKJA 1N75A 2V86A 1SVOA 2XGXA 1W36C 3FIGA 2EPOA 2H8RA 4ENKA 2RSIA 2ECBA 5AONA 2J5PA 4ETSA 2DFEA 3E97A 3HPHA 3P9CA 5EG0B 1E2XA 1KU7A 5JHFA 4C30A 3E5UA 2MC6A 5KAIC 4OOGC 2DMPA 5BS6A 2YTFA 2QM3A 3AAFA 2K7IA 5D6FA 2NXNB 3A03A 4DV2E 4XICA 1FOXA 3ZXSA 1DP3A 2EPRA 4JV5E 3VSKA 5FFXA 1T2KA 2HVQA 3ABKH 5HS9A 4RDUA 2YR2A 3J80K 3BWGA 3P9KA 4L5IA 4M73A 2JSCA 2EE8A 4AIKA 3S16J 5D4RA 1AWCA 4A2UA 5L3CA 3VB2A 3JTZA 5J40A 3OYIA 3DTKA 4HQEA 1JKPC 5IT3A 3ESWB 2HXOA 2ZM6E 5EGOB 4FX4A 1GUUA 4JYAE 2L3DA 2CRGA 2P5VA 1R6RA 2QBYB 2DLKA 4E7JA 4UB6C 3IWDA 2ISZA 5DEQA 2L92A 4L5NC 2H1KA 1IGNA 3HRTA 1ZN2A 2L9RA 2FD5A 4KISA 3OV8A 5M5WJ 2EPZA 1CGPA 2W82A 1IN6A 5GAGJ 2VKHA 5E3MA 2DA3A 1A6QA 1ON2A 4YFKF 2I13A 4ITVA 4Y15A 2VJJA 4Z6YA 4ENJA 1ZLKA 2I9IA 3TDUC 5B1AH 2CO5A 3FXMA 1O3RA 2E5LE 2BHZA 2LFBA 3FHNA 2OQGA 2XC7A 3M07A 3CP2A 4QIWN 1YTYA 2A5YB 3CZ6A 3OYGA 3N4MA 2X4HA 4WK8F 2BGCA 3ABMH 2ZNZA 3ABTA 3R4KA 2EFPA 5DM7F 3BG3A 1WQ2A 3FZVA 5AC5A 4YIIA 1MSEC 1QPMA 1B72A 2E1MC 1JTXA 1KQ8A 2GOXB 1IBKE 1GHCA 4HYEA 3ECOA 4RM3A 4RMNA 4NDLA 4QLCU 1ZBTA 3JRFA 3R0JA 1G3TA 2FBKA 1R1VA 1G2HA 1J5YA 5LRSA 4LFCE 2EWNA 1AKHB 1HNZE 5AE1A 2CQ7A 1T56A 2D9HA 2FBHA 3E6DA 1KYZA 2CW8A 1P7IA 3LSHA 1Z7UA 2WAEA 1VI0A 3DLAA 4L9VA 2ZSHB 1R1TA 3GMEA 4FE4A 4Q47A 2W00A 1VQ8I 2F4MB 2KL4A 1PUEE 2AS5F 4ENNA 2Q1ZB 3HZJA 2ACJA 2LCEA 2R92J 5C4JJ 4BJTA 4DNCA 2JPAA 5DNYA 3QU6A 2AXTC 4JOMA 1MD0A 4BY1J 2EOQA 4BMJA 1ERDA 2V85A 4UUVA 1ON1A 2LTRA 3KP6A 3GFIA 3NRVA 5J8FA 1XNRE 3COAC 4M2ZA 1WJCA 3S3MA 4B3XA 3KYCB 4UUTA 2IW5A 1ZU1A 4U88A 1ZRFA 4Q35B 1Z1BA 3BBGA 2DA7A 1E17A 2L7FP 1U9OA 4LJZF 2BEOA 4IEJA 4XL9A 3J81K 1L4SA 2R7DA 4BJ5C 1WSUA 2GM4A 1OYWA 3ZCOA 4I99C 4EQQA 3L2VA 3V8JA 2W1OA 2EMHA 4B1RA 2DPDA 1RR8C 3T1BA 2DMTA 3DTEA 2JZYA 1NCSA 2VBYA 4EJVA 4WSPA 3WGIA 4WF2A 3OS0A 5IYDJ 1XB4A 3SDGA 1TF6A 1ZAOA 2RKHA 2EPUA 1OCRH 3GFJA 2VKEA 4J01A 2IBDA 1K7AA 2RAEA 5EZHA 4HA8A 1ORKA 1HNWE 4KIBA 3CCVI 2O5RA 3IHUA 3HRMA 4HSTA 2CQQA 3FHZA 4RB1A 3OS2A 3OSFA 2BXZA 4DV5E 5CFFE 3ZMTA 1DI2A 4BE0A 5HVQC 2V89A 1Y8RB 4JI8E 5F1JA 5CVJA 1P4WA 1GVDA 1WCMJ 3D5SC 3T8TA 4M74A 1B72B 4XLCA 1SMYF 1YYOA 4U7BA 4A5NA 1G2DC 4BHPA 1YZ9A 4PJLA 3LSTA 1E3PA 2EM0A 1SANA 4HOBA 5IY5H 5ICGA 2DA4A 2ME6A 1J2XA 2OCEA 3QQAA 2L9NA 2L6MA 4DV1E 3ASOH 2KP6A 4XRFA 2P5LC 3OR1C 2NOGA 2ZNYA 2E72A 4HDVA 2VPRA 4WSGA 2BY0A 4WYQB 2DOAA 2PX9A 4MGRA 2RS7A 4RB0A 4AVZA 1QGPA 2L8TA 1UN6B 4PJ0C 4KNYA 1A35A 2WA0A 3G1MA 3I59A 4XORA 3L9FA 1QZYA 3ABUA 3I64A 3ZRGA 2R7VA 2ENCA 3L2RA 4XKBA 2LH9A 3MMYB 1BIBA 2RTXA 1LDKB 2B3TB 4G6DA 2MKDA 1GV5A 3ABLH 3CDHA 2LY2A 4ZDOA 2LV2A 3DBLB 4BBRJ 4DIQA 4CCMA 3ELKA 2DGCA 1TWHJ 2XAUA 3L09A 3G73A 2VLAA 3O8HA 1D0YA 3FXLA 2ZMEA 1QHHD 4W1UA 2EIJH 1B4AA 3ZN0A 5B3SH 2BVLA 4E7SA 1VQMI 3FXUA 2LVHA 3VYYA 1W0UA 4A12A 1PUFA 4F92B 4JI4E 4F9AB 5E3LA 1SFOJ 3HTSB 3EUAA 4LK1F 2JVGA 1WJBA 5C4XJ 2EN7A 2DB2A 2ID6A 3PIPF 2EPMX 5H20A 4P5OA 1IRZA 2DJIA 2CT1A 1VQKI 3DEUA 3LSGA 2BY2A 2YX4A 1MMDA 2W84A 4I8OA 2LP0A 1CF7B 4HBLA 3BZCA 4Q28A 1A1GA 1P9QC 1W7PD 2Z33A 4GFBA 4MNUA 1SAUA 3ADIA 4B47A 5H2FC 3OYBA 1UB9A 4YEJA 4G6QA 2DFIA 2EL5A 4X66E 2EN8A 1IXSB 3ZQHA 3LFKA 1FWZA 1CQTA 1HDDC 3OYHA 2Q2EA 2DTRA 3T8RA 1F5TA 4BHBA 4NUBA 1P4AA 3F8FA 4MIMA 4OU0A 4C3IJ 2JA8J 3GEZA 2FEZA 5BMZA 2NS0A 4KITB 3AV0A 3WTVC 5LD2C 4O24A 2NUEA 4BDYA 3HG9A 2BYVE 5K1YA 4G94A 2CS3A 2KRHA 3CJTB 1QA6A 3I71A 4M72A 2KHMA 2L2MA 1W4MA 1Z1DA 2K9QA 1IUFA 1O3SA 3WG7H 1FYKA 2RV8A 2JJ7A 2LTPA 3VEPA 4F9CB 4XONA 2YX7A 1H9GA 1WJEA 3ERMA 3VYSB 4C9YA 1YG2A 2FRHA 3I56I 3UR3C 4FISA 4FETA 2VE9A 1BA5A 4J00A 3I59B 3R6SA 4G6TB 2EN4A 4X62E 2IJLA 5D5WB 1AH5A 4X64E 1YJ9I 2F8BA 3CESA 2VQFE 4LG0B 1ETKA 1X3UA 4LB6B 4JBAA 4NBQA 2LJUA 4ON0A 5DM6F 2DO7A 4BEHA 1IXRC 1YE9A 1X19A 2R7OA 3OIPA 4D7NA 3JRDA 1NH3A 2XB0X 2JY9A 1A1IA 2WCC3 3PSIA 1PUFB 2LTSA 4ZTJA 5EEGA 5KL2A 4LF7E 1XNQE 2L2KB 1VNDA 3H5RA 5K7HA 2K5CA 2PI0A 2Z1DA 1RUOA 2WC2A 2LKSA 3CCQI 4RGUA 1Z9CA 4DZJA 4LF9E 4WWCA 1JHFA 3SZGA 3F22A 2HEOA 2M7AA 1ZRCA 4WFTA 4DR5E 1LQ1A 4M9ZA 4XBFA 1RZ4A 2Q8UA 1IF1A 4RHBB 4GO1A 4UUSA 2X1DA 4RGXA 5GPAA 3SQNA 3AKZA 2JOBA 5KK1A 2A6TA 2M0CA 3C1DA 1ZKGA 5KL4A 2V83A 1JGSA 2EMKA 2L0KA 2EFOA 3EQLF 4HV6A 2GPIA 3OL3A 3O8GA 4ASNA 4XOTA 1S7AA 2Y2ZA 4JYKA 2A07F 2E1CA 4PJNA 4O5VA 2ICWG 2W4SA 2HGCA 4EGZA 2LO3A 4B3SE 1LEAA 1YW8A 4BDZA 2EN6A 4BQNA 1RRJA 1BR4A 1J26A 2EPFA 3HJEA 3K4CA 3TP0A 3CUQC 5IOYA 3WE2A 2EIMH 1B69A 3MSWA 4L8NA 2CJJA 3W2AA 2FQ3A 3C3WA 2Y69H 5ICFA 3MD2A 3QP6A 2PG4A 1MH4A 3OYJA 2C6YA 2JXPA 2W25A 2FQ4A 2PMZA 1ZG5A 2L3JA 1F9NA 4JQFA 3LSRA 2WTEA 1TTYA 2X51A 2EM2A 2ZSIB 1WJAA 2MSYA 1IV6A 3S3NA 1U8BA 4KMUX 4R79A 2R7ZJ 1BC7C 2NVYJ 1WJ5A 2EPKX 1NG6A 1XDUA 3RZOJ 3IC7A 3MQ0A 5D4SA 1W7PB 5H6QA 1SD5A 2R5YA 2QUFA 2R7RA 1RETA 1IDZA 2IP2A 2X1EA 5CQEA 3H92A 5A2QK 4KFCA 3C2GA 2DYRH 3K1PA 1OFCX 3GVAA 2HGHA 4M9SA 2XKOA 3S14J 2ZJQF 1MH3A 2HQRA 3LSIA 2W7NA 2IRFG 1YYWA 4BEHB 2DIXA 3K4NA 2DSYA 1UFMA 2GOMA 2LD5A 2HHHE 3OYCA 4KT5C 1ZR9A 3R0AA 1FOWA 3BC8A 3HSRA 2F6CA 2IVMA 2HVRA 3EETA 4A5MA 3Q0UA 1O7FA 4A3JJ 2UXBE 2CWEA 2X85A 1T4OA 3DXJF 2VASA 1OCZH 2CQKA 2VODA 1BI0A 3TQNA 3A0BC 2UV1A 1FPQA 1D8KA 2JWOA 2JVHA 2AHQA 1R71A 3GXOA 2F5EA 2BY3A 2OQRA 2KIFA 2X6OA 2R7UA 3RDIA 5L3DA 2DRPA 2DOEA 4UUSB 3WGGA 1BIAA 1XN7A 5DYMA 1SEUA 4K2EA 4BQOA 2DLLA 4ZYGA 2XHKA 1K78A 3LSKA 2IGMA 3KEYA 2GLOA 3TQMA 3F9KA 4BXFA 3HRSA 2YRKA 1AAYA 3F6GA 5FRNA 2VONA 2VKDA 3K4JA 3DEEA 2DFHA 3CCUI 4AIDA 4HNTA 3S1MJ 1BBYA 1S72I 1BI2A 4Q4ZF 3SFIA 2LE2A 1IRXA 2CH0A 1DQ3A 4FTHA 1FKAE 2FSWA 3HRUA 1U5TA 4X6AJ 2R7FA 1GLNA 2ENAA 4BHCA 5D5UB 1JGGA 3W3CA 3GWZA 4ZH4F 1KJKA 1TNTA 1SAXA 3SXYA 4DV4E 5KL3A 4YHHE 1BBOA 2LY1A 2EWLA 2STWA 1O0WA 2GAUA 4DZPA 2O8KA 2G0EA 1XMOE 1R9TJ 3FK6A 4IOAF 5K7ZA 2M5WA 1STZA 1N78A 4PDKA 4I0BA 3AL0B 1TWGJ 4JK1X 3LQQA 1U2WA 3Q9SA 3ZOQB 2E71A 3BG9A 2R5YB 2EZHA 3I9V2 3MN2A 3BTCA 2XGDA 1I50J 2B7TA 1BW6A 2OJED 4I0AA 5J1YA 1JK1A 4PJMA 3SHFA 1KU2A 3F3XA 4P96A 1UAAA 2WY7Q 3S2DJ 1WXRA 5HS7A 3DF8A 2J7JA 4YFXF 2N3HA 3Q3SA 3S32A 4DOZA 1BJZA 2XDVA 3S2WA 2K86A 1U3EM 2ZFWA 3A01A 2FE3A 3PNTA 3CMAI 3CLQA 2E36A 2K3PA 2MH9A 3M7GA 5FO5A 3GTGJ 2EZKA 3KP3A 2L7ZA 1VQ7I 3GFMA 2RNGA 1U9NA 1Z3XA 1M1EB 3SDBA 3ZQFA 2PN6A 4N9HA 3OR2C 4N9IA 2ME0A 2PBIA 2K4VA 5LGNA 2IGNA 2D5VA 4BQAA 3RJPA 4AQYE 2JPBA 3HOWJ 2QKLB 2XROA 4YIFA 2WAQN 2G9WA 5J47A 5ILVA 1YI2I 1GZ6A 1YS7A 2MKNA 5E18F 2W24A 4D0PA 3CQZJ 1WHNA 3FBNB 3EPJA 3V4GA 2HZTA 5LHHA 3LSMA 4UNOA 2IA0A 4C2TA 4LF6E 2VT2A 3K0LA 3A2KA 4XMYA 2CFXA 2HKOA 2XUBA 3PUBA 4IF4A 4U0VA 1LUJB 2VI6A 3CC2I 2NUGA 2DODA 4IHTA 3HUGB 3BTIA 4JI7E 1T98A 3MZHA 4JI3E 2L2NA 4PCQA 4LB5A 1LFBA 3D0SA 4EM1A 2XV4S 5EEHA 5FROA 1NK3P 2IHR1 2YSPA 3BQYA 3JRAA 3W2VA 5J8CA 2H1LA 4HQMA 1FEXA 5FJ8J 2K27A 1EH8A 1MBHA 1STUA 1BN5A 1W5TA 3JAMZ 1WPKA 2KFDA 3LMMA 2EPXA 1TWFJ 3TOAA 3VYUB 3JRHA 1QU6A 3C6MA 2LUPB 4S04A 4BXXJ 4XN3A 1Y8QB 1TW2A 2M8GX 5FFZA 1YHQI 2YU8A 2FMYA 2DDAA 4PSXA 2GXAA 4L0ZB 1WZ2A 1IN5A 4B3TE 1OYYA 4BE1A 2CUJA 1Z3YA 3VPRA 4AWXB 2KPMA 4RAZA 2CU7A 5EYRA 2EZLA 5K5RA 2KDZA 1J75A 2IA2A 5DCFA 4RB2C 1I3QJ 2DLQA 2LR8A 2DAOA 2LRSA 4A0XA 4LF5E 3QYBA 2DT5A 1SD7A 1YPNA 1WI9A 2OA4A 2JA2A 4XLAA 2OV7A 2ZC2A 2EOMA 1I3AA 4FQGA 4H4KC 5ICCA 2B63J 5GP9A 3H9GA 1G4DA 2EOOA 2YTNA 2UUAE 2OAZA 4DQ2A 2NVXJ 1V5GA 3H3UA 3Q9VA 1FT9A 5FLXZ 4YRVA 1KU9A 3KLNA 3CP8A 4QPQA 3IWBA 1UCRA 2QVOA 2VL8A 3QPSA 3KYLA 1IMUA 1X3ZB 3F8MA 2XGCA 2H8WA 3G3ZA 3EUKL 2FUG2 2FOWA 5JVTA 2ISYA 1TWAJ 3FMSA 3J7AG 1MJAA 4A3FJ 3UKGA 1A1HA 1YO5C 1W5SA 3KIOA 3KP7A 1XC5A 5BOXA 1HLVA 1JK2A 1D1BA 1J09A 4IXAA 1DPUA 1HKTA 1R5HA 2EOFA 3CCMI 1G2FC 4CICA 3V8KA 2EL4A 5LMNE 2K9SA 4ZZDA 5AASA 1IC8A 4CO8A 3CTAA 1X3CA 1H0MA 2DU9A 1T6SA 4EJOA 4IQJA 3GO5A 4U87A 2XAQA 5E8IA 2G7HA 2VQGA 4S0HB 4OIOF 5A6KA 3HOZJ 1JXSA 2DK5A 3JR9A 3GTKJ 2TRTA 3WGHA 2FF4A 2RQPA 3I58A 4IX7A 4CCLA 4AVPA 1AA7A 5AE2A 2GXBA 1Y6IA 2X6YA 3B6AA 5KCMA 2LNBA 2CV2A 2MC4A 4M3EA 3C6KA 2LUQA 4LTYA 4A3EJ 2R7QA 2UXNA 4ZYDA 3OSGA 1YJWI 4BC7A 1A1LA 3PNVA 2VJ4A 2Y31A 4PJJA 2YT4A 5JFRA 1HW5A 4UVAA 4CYCA 2WAFA 1MBGA 2R7SA 4CZZA 3IUOA 5K5QA 3KWRA 3FXRA 4A6DA 2WZOA 3TGNA 1K83J 4JX6A 3MKLA 2HTJA 3CJQB 3H3ZA 3V7SA 2YPRA 4M30A 1O57A 3LL7A 4E4HA 1WGXA 4XK4A 5L3BA 5M5YJ 5DUKA 2F48A 2M4KA 1SFXA 5D5XB 2BBYA 4MHGA 3K6QA 2PEXA 4DMIA 1F36A 4GYGA 4KIFA 3KCCA 3R60A 5FKNA 1RESA 2F5CA 4CCNA 5E20A 1SVLA 4DYCA 2ZJRF 4DR3E 1XPXA
chains in the Genus database with same CATH topology
2HYFA 1L0OC 3VFZA 3WODF 2YU3A 2QQBA 4UV9A 5LBQA 4IRIA 3BOQA 4RB3C 3WTWC 4MEYF 2XIGA 1Z91A 1ZHFA 2V6CA 2FBIA 4P9UA 3V8LA 2NNNA 2M30A 3CLOA 5DDGA 3TKYA 3U9GA 1V3FA 1MJ9A 2JTVA 2M87A 4EMSA 4KMFA 1XGSA 1XCBA 4KN7X 4RAYA 3WTYC 2JPCA 2HKXA 2VBXA 3WTTC 2O3FA 3J80Z 3HYIA 3ZPLA 2UZKA 1J0RA 3HOTA 4KYWA 3LQRA 1D5VA 3DPTA 4I09A 5HOOA 2HR3A 2MLGA 3WTXC 3PFIA 3FMRA 1I1GA 1U6GA 5D8LB 4CYDA 1B1BA 3GZ6A 1FZPB 1OR7A 1J9IA 4A0ZA 2L4AA 3O3KA 5E1WA 1KU3A 2WV0A 5E8GA 2ZJ2A 4B09A 3F6VA 1P4XA 2GIVA 3K2ZA 4CXFA 5HLHA 5HDGA 3IWZA 1QO0D 2QZ8A 4HW0A 2FU4A 2A61A 3F6OA 1ZG3A 4MTEA 4RS8A 3FWEA 4IHSA 4MTDA 2H27A 4BYYA 1FBQA 3RKYA 2EJRA 2K7LA 1JHHA 1P92A 1IRFA 3KZZA 2EK5A 2QQAA 4UXNA 1RUNA 1G3WA 1Z6RA 3BJAA 3RIRA 4EJWA 2PMHA 3KE2A 3LAPA 4ZZLA 2Z99A 3ZN1A 4G7ZF 1KA8A 4I98B 2D45A 2B0LA 2JT1A 3MWMA 3IRQA 2IPQX 2DQLA 4GGGA 4G9YA 3FM3A 5JI6A 2VC0A 3HIFA 4GXOA 1YFHA 3V7RA 3ERED 5L3FA 1B59A 5LRRA 5BQTA 3FF5A 2Q0OA 5TJJA 1GVJA 2CG4A 3QPTA 2HFHA 1S29A 3L2CA 3DQVC 4MQ9F 4HLXA 3HHHA 4LFUA 4GCVA 4YG2F 2FOKA 2VE8A 4CDGA 4IJAA 5ILUA 5DUIA 5CLSA 2K02A 3TOBA 2ZMEB 1F4KA 4UVBA 4UV8A 2KRFA 1H9TA 3KEQA 4PGGA 4IPAA 2X0LA 5HS8A 2PLYA 1HXDA 3QP5A 1XMAA 5BPIA 3EYYA 3JSOA 2M45A 5DD4A 1T0FA 2ETHA 3HSFA 1IN4A 4P55A 1OPCA 1YS6A 3E3VA 1BI1A 2G7UA 1DPRA 2W57A 1R58A 4Q48A 2CW0F 3ZMVA 5LHGA 2WWYA 3TO9A 5HLIA 2A6HF 3L7WA 1FLIA 4OMZA 1TBXA 4I2OA 5H6RA 5D6EA 2M1BA 4HF1A 5E1XA 4EJUA 2H6BA 4LD5A 1ZH5A 2MH2A 2P7VB 2MD5A 3K1NA 3HOSA 2UWMA 3RTRA 2ADUA 4FT8A 3TDZC 5KVRA 3W6JB 1PP7U 2KIMA 4CHUA 2JRTA 1YIOA 3T0YA 5ERIA 2E1NA 3LA3A 3LWFA 1ZG1A 4KICA 4P9FA 4QWQA 1S3JA 1LDJA 5CVVA 2OU2A 3NQOA 2RDPA 1S6LA 2W85A 5FD6A 1F1ZA 2V79A 4G8XA 3JTGA 1G6NA 2XAHA 1HBXG 3EYIA 1ZLJA 4G7OF 4KDPA 3REOA 4S05A 2P5KA 2OBPA 2V1UA 4IRHA 4N0BA 1D3YA 1FOKA 3PQJA 1FBUA 4HDUA 4RGRA 1ULYA 3KZYA 3WG9A 2LF8A 1FYMA 3TO6A 2VC1A 2EV6A 3IL2A 2ZKZA 4WX9A 4ENMA 4FX0A 3OOPA 2XRNA 1FYLA 3ISPA 1TNSA 3IKTA 3BY6A 1DP7P 1R22A 3BPXA 1GXPA 2GXGA 4Y13A 3K9TA 3MAJA 1T39A 3IRRA 1TQPA 3I53A 3RPUA 1BOAA 2PFBA 1HSJA 3I0TA 3RKWA 1XSVA 5L3EA 1U5TC 4AIHA 3KLOA 5IT9Z 3JW4A 2FNPA 1OMIA 4KUMA 2H09A 4L0YB 5LHIA 2EB7A 3ZMZA 1SD6A 3LAJA 1SFEA 2L4MA 1K78B 1QZZA 2KIUA 4L18B 1PDNC 1D8JA 4LLGF 3E6BA 5L3GA 1MJBA 5AIQA 4HAMA 3GX4X 2ESHA 1TW3A 2D1HA 3C7JA 1FBSA 1U5TB 2DQRA 1FSEA 3MZYA 4UVCA 5E1ZB 2LF7A 1ZGJA 2FA5A 1ZYRF 3I4PA 1RNLA 2DK8A 5DD8A 4XSXF 1RIOH 3WTSC 3WTZA 2L01A 1R7JA 2KKOA 4EM0B 4OIQF 4M71A 3WU1B 5ED4A 4A0YA 5LGUA 3F8BA 3WTUC 3GFLA 3GYHX 5LEKA 1IN7A 4HX7A 1J7KA 1UHWA 3LA2A 1GXQA 1USTA 3GLXA 4GYIA 1YW7A 3ZP5A 3SZTA 2QENA 3CO7C 4O6JA 2IT0A 2V1XA 2RN7A 1R36A 4M6YA 1HW1A 1HW2A 2DW4A 1T38A 1J59A 3K69A 5J6XA 2KJCA 2Z5UA 4OOIA 2F5FA 4HV5A 1ZARA 1FSHA 4KA4A 1HKQA 2L02A 3CO6C 1O3TA 4UHTA 1U78A 2LDUA 4BAYA 1G3SA 3ULQB 2UXXA 4LLLA 4BXUA 2STTA 2RC4A 5CVUA 4O3MA 5K5OA 3GF2A 3WE3A 3QOPA 1IZ1A 1KYWA 3DKWA 1LVAA 3DPLC 4Q5SF 2IA1A 4MQVA 2NNYA 3DP7A 3RYRA 2Z3YA 2LSOA 4L9TA 2P6SA 2LKPA 1YW9A 4OMYA 2ZO4A 5TRDA 2GA1A 2EFNA 3SZPA 2HYGD 2ZCWA 2XAGA 4M6XA 2O03A 3B02A 1KQ9A 5F64A 3KP2A 1Z05A 1HQCA 1VTNC 3E5XA 1B6AA 2MC3A 4OIPF 3CUOA 2NYXA 1WWXA 1PP8F 2TDXA 4H0EA 2P7CB 4I01A 3O6BB 4WXHA 3I54A 4EM2A 2CSOA 1I27A 1OYIA 4M9XA 2PQ8A 3BDDA 1DDNA 2VXZA 4RGSA 2VOPA 3ECHA 3F8CA 3J7AO 2VT3A 1K6OA 2EFWA 3F23A 5LGTA 4EV0A 2V1DA 3DFGA 1WRJA 3LA7A 1CF7A 1KQ0A 4Y17A 3M8EA 1R5GA 3M8FA 2Y75A 3MCZA 5FB2A 4NB5A 5ICEA 4HZFA 5HDKA 1LEBA 2XASA 4HLYA 4IRGA 1QQIA 2HS5A 3BP8A 2ESNA 1B9MA 2CGPA 2MA3A 5JHUA 2DI3A 1LNWA 1LDDA 3JSPA 3QPHA 5FD5A 3QU3A 2DPUA 2P8TA 2M8EA 3KP4A 1V4RA 2ZXJA 1XGMA 1I1SA 4EJTA 3ZMDA 1I5ZA 4LK0F 1HSTA 2K4BA 4OIRF 2PJPA 2GA2A 2O61A 2COMA 4LG0A 2H94A 3ZMSA 4E70A 3J81Z 1B9NA 2XVCA 2K4JA 1ZGAA 2DBBA 1TLHB 2GZWA 5E17F 4BNCA 3BROA 2YSRA 1ONVA 4WXDA 1IN8A 4NQWA 3PQKA 5F6FA 3P7NA 4PZJA 3I5UA 3E5QA 1BI3A 2EV5A 5D5VB 4U0YA 2XKPA 3MFKA 3E6MA 1FP2A 1XCVA 2HWVA 1MZBA 2MBFA 4KIGA 2EA2A 2ELHA 3KETA 4B8XA 2RVCA 6PAXA 2NRAC 2QYOA 4AD9A 2D1VA 3KEOA 1YYVA 3Q5FA 3M1EA 4R8HA 2OD5A 3EUHA 2EV0A 3QAHA 1A04A 1HKSA 1R1UA 3MEXA 3F72A 1I6XA 2A68F 1W7PA 3HSEA 2J5OA 1G3YA 2EFQA 3L00A 3GW2A 1YLFA 5D8KB 3CUQA 3ML6A 5DV5A 5ILSA 1IUYA 2E7WA 4U0WA 4ZYEA 3BJOA 1EV7A 5FGMA 3FM5A 4Z2YA 1QBJA 1ZRDA 4FHTA 3HHGA 1P2FA 4A6EA 4XSZF 2R3SA 3O2PE 3N97A 4L5JA 3M9AA 1FY7A 5F1RA 2RGVA 3BJ6A 1O3QA 2RNJA 3VOEA 4EGYA 1QNTA 3SFZA 3R61A 2CYYA 1K79A 1BC8C 4OINF 3U2RA 5LLQA 1IAWA 1FC3A 1LJ9A 3CJNA 3BPVA 3VODA 2OZ6A 1IRGA 1ODDA 1USSA 1KGSA 5HLGA 5AIPA 1WKMA 4I02A 2XAFA 3FX3A 4IVNA 2L54A 2XAJA 2A3SA 3RPQA 3GUDA 3IKVA 3NEUA 4TV7A 4L9JA 4LGWA 3U1DA 1C0WA 3DV8A 3FMQA 3CUQB 3W6KB 4WXCA 5HDNA 4ESFA 3RKXA 4AIJA 2V9VA 5IT9K 1Z6TA 3BZ6A 4ESJA 1MDMA 1IW7F 1XSXA 1U8RA 3KP5A 5DCMA 1AOYA 1XGNA 2EA4A 2BE5F 2H6CA 2VOOA 2BV6A 2HOEA 4YFNF 4EVIA 1LB2A 1UHMA 5CVRA 3HUGA 4HF0A 1XSDA 3GZ5A 3V7CA 5CVIA 3JAMK 4NHJA 2Y0MA 4LLNA 3QRFF 4R1HA 2OZUA 1BM9A 2GQQA 1SMTA 1NHAA 3HTUA 5CJ9A 5BPDA 3IWFA 1XD7A 2FMLA 3RI4A 3K1MA 3D5LA 2VBZA 2VN2A 5JR3A 2FNAA 3WU0A 5A2QZ 1REPC 1BJAA 2Q8KA 2GWRA 5FLXK 1S7OA 1TQMA 1MGTA 4F7ZA 3ZQ7A 1L3LA 2HDCA 1ZREA 4HX4A 1R00A 1MDMB 2MLKA 1SD4A 2VBWA 1XGOA 3KFWX 3FXQA 5DCMB 1FNNA 2PMUA 2QLZA 1YQAA 2HTSA 1RI7A 4WCGA 4XLNF 2A69F 2F2EA 2Y48A 3C18A 1EH7A 2F5DA 4MEXF 3F8NA 3EDPA 1DUXC 3B73A 1IXCA 1P6RA 2D2WA 4G7HF 4BH9A 4XLPF 4ZYHA 3ZMUA 1EH6A 4ESBA 3T5XA 5LEJA 1XDSA 1S8NA 2P6TA 2FXAA 2ZBKA 1Y0UA 5CYVA 2QBYA 1FP1D 4U7DA 4HF2A 4I7HA 2O6GE 1OKRA 3JTHA 1MKMA 1O7LA 1Q1HA 1TQIA 4KN4X 3ROUA 4LMYA 1JE8A 2O8XA 3E6CC 4PGHA 2Z9OA 2NAZA 3F21A 4HX8A 2E7XA 2QWWA 4CGZA 2A6EF 2QQ9A 3P9IA 1R23A 1XMKA 2HQNA 2P4WA 3RYPA 1SFUA 1FX7A 2O0YA 3TO7A 4L9NA 2KJBA 2AXLA 2XGXA 4ENKA 5AONA 2J5PA 4ETSA 3E97A 3P9CA 1E2XA 1KU7A 3E5UA 5BS6A 2QM3A 3AAFA 5D6FA 5FFXA 1T2KA 5HS9A 2YR2A 3J80K 3BWGA 3P9KA 4L5IA 4M73A 2JSCA 4AIKA 5D4RA 1AWCA 4A2UA 5L3CA 3VB2A 4HQEA 5IT3A 4FX4A 2L3DA 2P5VA 2QBYB 2ISZA 5DEQA 3HRTA 1ZN2A 3OV8A 1CGPA 1IN6A 1ON2A 4YFKF 4Y15A 4ENJA 1ZLKA 3TDUC 2CO5A 1O3RA 2OQGA 1YTYA 2A5YB 3N4MA 2X4HA 4WK8F 2BGCA 2ZNZA 3ABTA 3R4KA 2EFPA 1WQ2A 3FZVA 4YIIA 1QPMA 1KQ8A 1GHCA 4HYEA 3ECOA 4QLCU 3R0JA 1G3TA 2FBKA 1R1VA 1J5YA 5LRSA 2EWNA 2FBHA 3E6DA 1KYZA 1Z7UA 4L9VA 1R1TA 4Q47A 1PUEE 2AS5F 4ENNA 2ACJA 4DNCA 3QU6A 1MD0A 4UUVA 1ON1A 3KP6A 3GFIA 3NRVA 5J8FA 3COAC 2IW5A 4U88A 1ZRFA 1E17A 4LJZF 2BEOA 3J81K 2R7DA 1WSUA 1OYWA 4EQQA 3V8JA 2DPDA 3T1BA 2JZYA 2VBYA 4EJVA 3WGIA 4WF2A 1XB4A 1ZAOA 2RKHA 3GFJA 1K7AA 4HA8A 4KIBA 3IHUA 3HRMA 3FHZA 4RB1A 3ZMTA 5HVQC 5CVJA 1P4WA 3T8TA 4M74A 1SMYF 4U7BA 4A5NA 4BHPA 3LSTA 4HOBA 5ICGA 1J2XA 4XRFA 2P5LC 2ZNYA 4HDVA 4MGRA 4RB0A 1QGPA 4KNYA 3I59A 3L9FA 1QZYA 3ABUA 3I64A 1BIBA 1LDKB 4G6DA 3CDHA 3ELKA 3L09A 3G73A 2ZMEA 3ZN0A 1B4AA 3FXUA 4A12A 3HTSB 4LK1F 5H20A 4P5OA 3DEUA 2YX4A 2W84A 1CF7B 4HBLA 1W7PD 2Z33A 4MNUA 1UB9A 4G6QA 2DFIA 1IXSB 3LFKA 1FWZA 2Q2EA 2DTRA 3T8RA 1F5TA 4BHBA 1P4AA 3F8FA 4OU0A 3GEZA 2FEZA 5BMZA 2NS0A 3WTVC 2BYVE 5K1YA 4G94A 3I71A 4M72A 1W4MA 1Z1DA 1O3SA 1FYKA 2RV8A 3VEPA 2YX7A 1H9GA 1YG2A 2FRHA 2VE9A 3I59B 3R6SA 2IJLA 5D5WB 4LG0B 1X3UA 4LB6B 4JBAA 4ON0A 2DO7A 1IXRC 5EEGA 2PI0A 1RUOA 2WC2A 4RGUA 1Z9CA 4WWCA 1JHFA 3F22A 2HEOA 1ZRCA 1LQ1A 4M9ZA 4XBFA 1RZ4A 1IF1A 4GO1A 4RGXA 3SQNA 5KK1A 3C1DA 1JGSA 3EQLF 2EFOA 4HV6A 4ASNA 2A07F 1S7AA 2E1CA 4O5VA 2HGCA 4EGZA 1LEAA 1YW8A 3CUQC 3WE2A 2FQ3A 3C3WA 5ICFA 3QP6A 2PG4A 2C6YA 2W25A 1ZG5A 1F9NA 4JQFA 2WTEA 1TTYA 4KMUX 4R79A 1BC7C 1XDUA 3IC7A 3MQ0A 5D4SA 1W7PB 5H6QA 1SD5A 2QUFA 2IP2A 3H92A 5A2QK 4KFCA 3K1PA 3GVAA 4M9SA 2XKOA 2HQRA 2IRFG 1UFMA 4KT5C 3R0AA 3HSRA 2IVMA 3EETA 4A5MA 1O7FA 2CWEA 3DXJF 2CQKA 2VODA 1BI0A 3TQNA 1FPQA 1D8KA 3GXOA 2F5EA 2OQRA 2KIFA 3RDIA 5L3DA 3WGGA 1BIAA 1XN7A 5DYMA 4K2EA 2DLLA 4ZYGA 2XHKA 1K78A 3HRSA 2VONA 1BBYA 1BI2A 4Q4ZF 2FSWA 3HRUA 1U5TA 2R7FA 4BHCA 5D5UB 3GWZA 4ZH4F 1TNTA 1SAXA 3SXYA 2STWA 2GAUA 2M5WA 1STZA 4PDKA 4I0BA 4JK1X 3LQQA 1U2WA 3Q9SA 4I0AA 3SHFA 1KU2A 3F3XA 4P96A 5HS7A 3DF8A 4YFXF 1U3EM 3S2WA 2K86A 2ZFWA 2FE3A 2MH9A 3M7GA 5FO5A 3KP3A 3GFMA 2PN6A 4N9HA 4N9IA 2PBIA 5LGNA 4BQAA 3RJPA 2JPBA 2XROA 4YIFA 2G9WA 5ILVA 1YS7A 5E18F 2W24A 4D0PA 3V4GA 2HZTA 5LHHA 4UNOA 2IA0A 2VT2A 3K0LA 2CFXA 2HKOA 2XUBA 4IF4A 4U0VA 4IHTA 1T98A 3MZHA 4PCQA 4LB5A 3D0SA 4EM1A 2XV4S 5EEHA 5J8CA 4HQMA 2K27A 1EH8A 1BN5A 1W5TA 3JAMZ 3TOAA 4S04A 1TW2A 5FFZA 2FMYA 4L0ZB 1IN5A 1OYYA 4AWXB 4RAZA 5K5RA 1J75A 2IA2A 5DCFA 4RB2C 2DAOA 4A0XA 2DT5A 1SD7A 1WI9A 2OA4A 5ICCA 1G4DA 2OAZA 4DQ2A 3H3UA 3Q9VA 1FT9A 5FLXZ 1KU9A 3KLNA 1UCRA 2QVOA 3F8MA 3G3ZA 5JVTA 2ISYA 3FMSA 1MJAA 1YO5C 1W5SA 3KP7A 5BOXA 4IXAA 1DPUA 1HKTA 1R5HA 4CICA 3V8KA 4ZZDA 4CO8A 3CTAA 1H0MA 2DU9A