1EH6A

Human o6-alkylguanine-dna alkyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
177
structure length
168
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE
total genus 43
structure length 168
sequence length 177
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1eh6A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1eh6A01
3Q9SA 3FMRA 5CVIA 1UB9A 3I64A 1PDNC 3RJPA 3ZMUA 2BE5F 3IRQA 2P5LC 2ZNYA 4ENMA 3KP6A 3ABTA 3HOTA 4L5JA 1L3LA 3E6MA 4UVCA 2X4HA 3WODF 5J8FA 3WTUC 3HRMA 4HA8A 2ISZA 3FHZA 3TKYA 2RGVA 2JPBA 4MTDA 3TDZC 2QQBA 2O03A 3HHHA 2NAZA 1IRFA 4OIOF 5FD5A 1LQ1A 3IKVA 3ECHA 1ZRFA 1FWZA 3KZZA 5D4SA 3KP5A 4Y15A 4Y17A 4GYIA 1ULYA 4OIPF 2MD5A 2UXXA 5HLIA 4CXFA 3GXOA 2OBPA 4EV0A 1K6OA 2Q2EA 1Z91A 3D5LA 2A5YB 4TV7A 4FX4A 3MFKA 3HUGA 2MLKA 1NHAA 5EEGA 5D8KB 3FMQA 3EUHA 5D8LB 4B8XA 3KP3A 2L4AA 4KMUX 1CF7A 2UZKA 2G7HA 3T0YA 1T6SA 2VXZA 1AOYA 2MH9A 3C1DA 3DQVC 3FXQA 4BXUA 4EMSA 4P9UA 2IT0A 1LEBA 2FBIA 3G73A 3QP5A 1FSEA 2O3FA 3J80Z 1FSHA 2D1HA 2YSRA 2IJLA 1ON1A 3JAMZ 3IRRA 4HX7A 2PI0A 1QGPA 4WXCA 1K79A 2STWA 2MBFA 3R4KA 1CF7B 3E97A 3CUQB 5DCMA 1SAXA 1LB2A 4A12A 1J9IA 3GFIA 3RKWA 1J5YA 2D2WA 4CICA 2PG4A 4ZYGA 5K5QA 3ZMDA 1J0RA 2FNPA 5HS9A 1QNTA 2ISYA 1BC7C 3J81Z 2H09A 2ZNZA 4LJZF 3BROA 3EYIA 2OQRA 4FT8A 4KA4A 3RDIA 2IW5A 2F5FA 2E1NA 1GXPA 1DP7P 4I2OA 4UV8A 1QQIA 3GWZA 5HOOA 5ERIA 3I59A 2XAJA 5BS6A 1U8RA 2PMUA 3ABUA 2K86A 4M9SA 5HDGA 1PP8F 1G3TA 4BAYA 2ESNA 2DK5A 4WXHA 2BBYA 1XMAA 3BWGA 4QWQA 4WK8F 5FLXK 2DW4A 4ZZLA 3ZMTA 5DEQA 3KETA 4D0PA 3IWZA 3E5UA 4HBLA 2R7FA 4RS8A 4MEYF 1DUXC 4LG0A 5LEJA 5HS7A 3T8RA 4S04A 2W57A 1SFXA 4QLCU 4LB6B 2QVOA 3D0SA 3F8NA 3TDUC 2W84A 3E5QA 5FB2A 1QBJA 1QO0D 2XAFA 3HSFA 3SXYA 3GVAA 1RIOH 1U78A 3Q9VA 4LLLA 4ASNA 4L18B 2XAHA 4L5IA 2MH2A 3W6JB 2FE3A 2XUBA 5D6EA 4ESJA 1MJAA 2X0LA 2KRFA 2R7DA 5L3EA 4AD9A 3J7AO 3GZ5A 2VT2A 2RV8A 1TBXA 2P6TA 3I54A 1XCBA 3F22A 5TJJA 4A0XA 1IN6A 2K02A 2RVCA 3QP6A 2JZYA 1C0WA 1HBXG 3VB2A 4RB2C 2DPUA 2QENA 1TW2A 3KZYA 4I0BA 2M1BA 3KP2A 2DU9A 2ZMEB 2OZUA 2P5KA 5D6FA 2JT1A 2DBBA 5KVRA 2ZXJA 2QBYB 1S8NA 1W4MA 5F6FA 3CTAA 3QOPA 3TOBA 3COAC 5IT9K 2OAZA 2ELHA 2FA5A 2CW0F 1OPCA 4ON0A 4JQFA 1FYMA 4NQWA 4GCVA 3V8KA 5ICFA 2IRFG 3ECOA 3TO7A 4G9YA 1HQCA 1KU7A 2HYFA 4KNYA 3DFGA 3I0TA 1U3EM 5ICCA 3HIFA 2Z5UA 2DI3A 1H9GA 3K1MA 4IRGA 3R60A 3WGGA 4I0AA 2FMLA 2VONA 1S7AA 1FP2A 1FBSA 3K1NA 5CLSA 2RNJA 2ZBKA 1BIAA 1O7FA 2P5VA 1YIOA 2CGPA 2PFBA 3K9TA 3DV8A 3FMSA 3MAJA 2XKPA 3ZP5A 1FBQA 1R7JA 2GZWA 3CDHA 1XGMA 4M9ZA 3L9FA 1XGNA 4EJVA 4WX9A 4M6XA 4G6DA 4HF1A 3VOEA 1OYWA 4PDKA 4MHGA 1DPRA 5L3DA 4BH9A 4ENJA 3I5UA 3FM3A 1XN7A 2P7VB 2DPDA 4BNCA 3FM5A 5DCFA 3H3ZA 4EJTA 3OV8A 3GYHX 1MGTA 2KJCA 3KEQA 2FXAA 1B59A 2Z99A 2A69F 2JRTA 1W7PB 2GQQA 4Q47A 2GAUA 3QPHA 2HEOA 4IPAA 3ZN0A 4GGGA 4G7ZF 4I01A 2AXLA 1LDDA 1T38A 1IRGA 3LAJA 1KGSA 2GA1A 2IVMA 4FHTA 2ZKZA 1O3TA 4G7OF 2HQNA 2BYVE 2A07F 3AAFA 5CVUA 3V8LA 3LQRA 2XGXA 4OIQF 2QUFA 4LK0F 4HLYA 2MC3A 1EH8A 4M72A 4CHUA 1YO5C 2J5OA 1IN4A 1YG2A 4U0WA 4XRFA 2QZ8A 3P9KA 1LDKB 3WU0A 2PBIA 1I5ZA 3R0AA 1ZG3A 1YW9A 2VC0A 4MQVA 3J81K 3SFZA 4OU0A 2E1CA 3REOA 1WRJA 3FWEA 4YFKF 5LLQA 2OA4A 5E1WA 4GXOA 2PQ8A 2HYGD 1USSA 1YS6A 5LRSA 3GW2A 2KJBA 2XVCA 3WTWC 1F9NA 4WXDA 5ED4A 3U9GA 5JFRA 5DYMA 5HDKA 5DD8A 2EA2A 2EV0A 6PAXA 3EQLF 1SFUA 1WKMA 1ZYRF 4P9FA 5BMZA 3ZMSA 5AONA 2FBHA 4WF2A 1T39A 1S29A 3DKWA 5A2QK 4A6EA 2M5WA 3BY6A 2PEXA 3BZ6A 3DP7A 1IXSB 2DLLA 1ZG5A 2VT3A 1ZLJA 3ZQ7A 3RKYA 2GIVA 1O7LA 5DUIA 1RNLA 3JW4A 2DQRA 3DPLC 4A0ZA 3HSEA 1BJAA 4L9VA 4AWXB 2CWEA 1YTYA 2FEZA 4P5OA 1D3YA 5D5VB 4OMZA 4KN7X 4ZZDA 4RB1A 1KA8A 4N0BA 2VBXA 5CVVA 3WU1B 3IHUA 5E18F 2RQPA 2EK5A 1XSXA 3I59B 1LVAA 1X3UA 1BOAA 4I09A 3SQNA 1BI1A 4IJAA 1PUEE 3LA2A 2RKHA 1LJ9A 3CO7C 3F8BA 4OIRF 4EJOA 1FX7A 2JSCA 4U7BA 4CYDA 3GO5A 5DD4A 1I1GA 4L9NA 2DK8A 5FFXA 4HX4A 3KE2A 1ZGJA 1CGPA 1FOKA 1MD0A 3VEPA 2EFNA 3C7JA 2E7XA 5IT9Z 1I1SA 2QQ9A 3CUQC 5BQTA 5JHUA 3FZVA 3PQJA 4NB5A 2M8EA 4OOIA 5J6XA 2W25A 2YX4A 2GA2A 4N9IA 3LAPA 2GWRA 3EYYA 1ON2A 4BHPA 2CG4A 1GVJA 3P9CA 2J5PA 3I53A 4EJUA 3WTXC 1P2FA 1V3FA 5A2QZ 2O8XA 2QBYA 5D5XB 5E17F 4G94A 4RB3C 4MEXF 2A3SA 4H0EA 5LGTA 4CGZA 3BJ6A 3F23A 2B0LA 1BBYA 4Z2YA 4MQ9F 2FU4A 3HSRA 1J2XA 3W6KB 3F72A 1R23A 4B09A 4UVBA 1P4AA 2MA3A 1TQPA 1D5VA 1GHCA 2XAQA 4RGXA 1LNWA 5LGNA 1LEAA 1BI2A 3KCCA 1FLIA 3GFLA 2ETHA 1FP1D 1J59A 2V1DA 3RI4A 3CUQA 4M71A 5DCMB 3NEUA 3ZPLA 1W5TA 1A04A 4UNOA 2D45A 5H6QA 2XKOA 2YX7A 3L2CA 3M7GA 4EM1A 2OD5A 2K4JA 4GYGA 3M8FA 2VOPA 1T2KA 1E2XA 3WG9A 4CZZA 2K7LA 2EWNA 3R6SA 2QYOA 1XGOA 1XSDA 1P6RA 2G9WA 3BJOA 4UV9A 2Q0OA 1RUNA 1IW7F 5J8CA 1IXRC 2DQLA 5LRRA 1DPUA 1Z1DA 4ESFA 4ZYEA 2MLGA 4XSXF 2H27A 4R1HA 5IT3A 2FOKA 5K5RA 2KIUA 2P6SA 1JHHA 1STZA 1VTNC 5LHHA 3R0JA 3G3ZA 4P96A 3ZMVA 1R5GA 2COMA 2HFHA 5LEKA 2RDPA 2Q8KA 4R79A 2LSOA 3TO9A 3M8EA 4HYEA 3BPVA 2H94A 5JVTA 2O6GE 1HSJA 4LB5A 3WTTC 5L3CA 1U6GA 3I4PA 3WTYC 1ZRCA 2ZMEA 2LDUA 1W5SA 1EV7A 1U5TC 4G6QA 2M87A 3F21A 1G3WA 4MNUA 3GLXA 2PJPA 5KK1A 4I7HA 4IHSA 1TNTA 2HQRA 1YW8A 3JSPA 1GXQA 3BP8A 5K1YA 2VN2A 5D5UB 1KYWA 3N97A 4F7ZA 4HLXA 1I6XA 4EVIA 4XBFA 5TRDA 3O3KA 1IN7A 3SZTA 5JI6A 1H9TA 2ZO4A 5BPIA 1SD6A 3ZN1A 2DFIA 3CUOA 5DUKA 4L0ZB 1PP7U 1YW7A 1T0FA 3B02A 1O57A 2DTRA 2W24A 4U0VA 4HX8A 4M9XA 1TLHB 1JGSA 1G3SA 3EETA 1T98A 3MEXA 3BDDA 1JHFA 1RI7A 1G3YA 1R58A 3GEZA 1XGSA 1WWXA 3J80K 1HW2A 3RKXA 1I27A 1JE8A 1IZ1A 1YQAA 3TOAA 4ESBA 4YFNF 3CO6C 5E1ZB 2EFWA 3F6OA 1MJ9A 2IP2A 5LHGA 1XDUA 5LBQA 1TQIA 1J75A 2ESHA 2STTA 2WC2A 1WSUA 4UXNA 4R8HA 3I58A 3RPUA 1BI0A 4YFXF 2HS5A 1HKTA 1ZGAA 2HTSA 1H0MA 2VE9A 1MKMA 4HZFA 4E70A 1FNNA 3SHFA 2EFQA 1XMKA 1ZARA 1R1TA 1BIBA 3FX3A 1YYVA 4KN4X 4AVPA 3V7CA 2UWMA 1ZLKA 2OU2A 3GZ6A 3NRVA 2QWWA 2A6EF 2QM3A 5E1XA 1UCRA 1REPC 5F1RA 5HDNA 4LLNA 3P7NA 4A6DA 2YPRA 5JR3A 2LF7A 3QU6A 2M30A 2A61A 1Q1HA 2HGCA 2XROA 3S2WA 1OMIA 3T1BA 4M6YA 5DDGA 3MQ0A 1JXSA 4HV5A 1R22A 2L54A 1G4DA 1TW3A 5FFZA 2VBYA 5FLXZ 2KKOA 2K4BA 3IL2A 3KP4A 2A68F 2LF8A 4HAMA 1SMTA 2WV0A 3ELKA 3L00A 3E6CC 2LKPA 4HDVA 3VODA 4UVAA 2L4MA 5LGUA 3LA7A 1P4WA 4RGUA 1B9MA 1XCVA 3FF5A 1B4AA 1R1UA 1Z9CA 3K2ZA 4PCQA 1K78B 3QPTA 1IN8A 2BGCA 1U5TA 4GO1A 3V4GA 3QU3A 3E6BA 3GF2A 1RUOA 4EQQA 2HKXA 1XB4A 4IRHA 4LG0B 4KYWA 2Y0MA 2ZFWA 3RTRA 1MJBA 1IN5A 1KU3A 2JPCA 3C3WA 3HRTA 2VE8A 2HOEA 1ZAOA 2QQAA 1G6NA 4KIGA 1TNSA 2JTVA 5EEHA 4I02A 4KIBA 2L3DA 1QPMA 3WGIA 1FPQA 2VODA 3U1DA 1F5TA 2IPQX 5ILSA 1UFMA 4MTEA 1K78A 2UXNA 1FT9A 1R1VA 3NQOA 1O3SA 1F1ZA 1HW1A 3F6VA 3SZPA 4IXAA 2CFXA 1SD7A 1O3QA 5E8IA 1R00A 4K2EA 2ACJA 4M73A 2ZCWA 3GFJA 1TQMA 1SMYF 2D1VA 4MGRA 3FXRA 4AIKA 2Y48A 3RYPA 1KQ8A 1U2WA 2BV6A 2HR3A 4KFCA 4DNCA 4ZYDA 4CDGA 1FY7A 5CVRA 2PN6A 4ENNA 4BQAA 5H6RA 5ICGA 1KU9A 1S6LA 4HW0A 2ZJ2A 4PZJA 3WTSC 4BHBA 1Z7UA 3GX4X 3ROUA 1YFHA 2L02A 5CJ9A 2RN7A 1Y0UA 4PGGA 1FC3A 4LD5A 1O3RA 2V79A 1WQ2A 1SD4A 4XLPF 4IRIA 2BEOA 3E5XA 3TQNA 3DPTA 4HV6A 1MZBA 2OZ6A 4EJWA 5HLHA 3JSOA 1XD7A 5ILUA 4A5NA 3MCZA 3V8JA 2XHKA 3O6BB 4ZYHA 2H6CA 4O3MA 3HRUA 3KEOA 3HRSA 3H3UA 1ODDA 3DEUA 3DF8A 3K69A 3CLOA 2EJRA 3PQKA 1EH6A 1B9NA 2IA2A 2P4WA 5H20A 4G8XA 5DV5A 2LNBA 3V7SA 4RAYA 3L7WA 2CO5A 4LGWA 1MDMB 2F5DA 3B73A 2R3SA 1XDSA 1W7PA 3LWFA 2HDCA 3ERED 2QLZA 2KIMA 1BC8C 5D4RA 1OR7A 3KLNA 2XV4S 3QRFF 4JK1X 1RZ4A 5E8GA 2FNAA 1UHMA 3E3VA 5ICEA 4KICA 2NNYA 3HTUA 3VFZA 1WI9A 1V4RA 4L0YB 2XRNA 3MZHA 2TDXA 4ZH4F 1KQ0A 1IAWA 4L9TA 1IUYA 4HF0A 3RPQA 1D8JA 4HOBA 3F8FA 4KIFA 2VC1A 3I71A 4BYYA 1K7AA 3F8CA 4YG2F 1XSVA 3T5XA 1R5HA 4JBAA 2DO7A 3P9IA 2P8TA 4WWCA 1DDNA 4UHTA 4ETSA 2EFPA 4U0YA 2V9VA 1ZREA 1B1BA 2DAOA 4RGSA 3N4MA 3C18A 2E7WA 1ZN2A 2V1XA 4AIJA 2FRHA 3HHGA 3BJAA 4HQMA 2XAGA 5FGMA 3PFIA 2Z33A 1FYLA 2PLYA 1ZRDA 2EFOA 2XASA 4CO8A 4Y13A 4Q4ZF 3E6DA 2HTJA 4LK1F 1HSTA 4P55A 2OQGA 2VBWA 3ULQB 3OOPA 4LLGF 1KYZA 3JAMK 4OMYA 2VOOA 2FQ3A 2DT5A 3F3XA 3WTVC 3H92A 1E17A 1YS7A 1AWCA 3LA3A 5BPDA 3R61A 3KFWX 1SFEA 4XSZF 3ML6A 4A2UA 1P92A 3TO6A 1KU2A 3JTHA 2FSWA 2V1UA 4HDUA 3WE3A 3GUDA 2XIGA 4HQEA 4LFUA 4A0YA 1B6AA 1ONVA 1ZHFA 2FF4A 3K0LA 5LHIA 1BI3A 1BN5A 3LSTA 3O2PE 4RGRA 4I98B 2VBZA 3GFMA 3JTGA 1R36A 1D8KA 5BOXA 2HKOA 3BOQA 3WTZA 5AIQA 4NHJA 5F64A 1LDJA 1Z6TA 2RC4A 4G7HF 2KIFA 1HW5A 1HKQA 3HTSB 5CVJA 1UHWA 4IF4A 2NNNA 4S05A 1BM9A 2ADUA 2EV6A 3K1PA 1W7PD 3CJNA 4KUMA 4WCGA 3IC7A 1FYKA 2A6HF 4EM0B 3KLOA 4IVNA 2Z9OA 2K27A 1HXDA 4ENKA 4N9HA 4DQ2A 3WE2A 2EB7A 4EGZA 1YLFA 1FBUA 4Q48A 4O6JA 1IXCA 3T8TA 2YR2A 3RYRA 3HYIA 4HF2A 4UUVA 2PMHA 4AIHA 5ILVA 3DXJF 3L09A 3IKTA 1HKSA 3F8MA 4L9JA 4A5MA 2NS0A 1KQ9A 3QAHA 2NYXA 2HZTA 1S7OA 1ZG1A 5E20A 1OYIA 2IA1A 2Z3YA 3LQQA 2WWYA 2CSOA 4O5VA 3MZYA 2GXBA 2V6CA 5HVQC 2CYYA 2O61A 3RIRA 1F4KA 3U2RA 2AS5F 5L3BA 5K5OA 2G7UA 4RB0A 1SD5A 1Z05A 2FMYA 2F5CA 2GXGA 2Y75A 5D5WB 2H6BA 3BPXA 1L0OC 1Z6RA 1QZZA 2O0YA 4RAZA 4U88A 4YIIA 5L3FA 2M45A 1J7KA 5FO5A 4LMYA 4IHTA 3MWMA 3Q5FA 1MDMA 3M1EA 1IF1A 4KMFA 2WTEA 3WGHA 3ISPA 2EV5A 3FXUA 3TGNA 4M74A 4EM2A 2F5EA 2P7CB 2CQKA 4Q5SF 1EH7A 3M9AA 3IWFA 3KP7A 2HWVA 2NRAC 1TTYA 2F2EA 5HS8A 2C6YA 4PGHA 1U5TB 5AIPA 1USTA 3LFKA 5CYVA 4YIFA 4KT5C 1OKRA 2L01A 1OYYA 5HLGA 2IA0A 5L3GA 2EA4A 1ZH5A 1QZYA 3EDPA 4FX0A 4XLNF 1FZPB 4OINF 4BHCA 2W85A 3ZMZA 3V7RA 4KDPA 2YU3A 2FBKA 5FD6A 3HOSA 4EGYA 4U7DA 1P4XA 1S3JA
chains in the Genus database with same CATH superfamily
3DBLB 3Q9SA 9ANTA 3FMRA 5CVIA 1UB9A 3I64A 1PDNC 3RJPA 3ZMUA 1VQ9I 2BE5F 4B48A 3K6QA 3IRQA 3DEWA 1D0YA 2OCCH 2VKDA 3DTIA 3ASOH 5M5WJ 2COBA 1YJ9I 4CZCA 2P5LC 2E35A 4LF4E 2ZNYA 3PSIA 3OYCA 3CCQI 3BBGA 4ENMA 4NZVA 3KP6A 3ABTA 3HOTA 2UU9E 1AH5A 4L5JA 1L3LA 2FX0A 3J7AY 3E6MA 4N4NB 4UVCA 2X4HA 3DLAA 2JPAA 2R4GA 3C2HA 2M9AA 2WCC3 2DMUA 1XS9A 2NVXJ 3WODF 5GADJ 2RS7A 2BBGA 5J8FA 3GCMA 2LMZA 5J3LA 4O24A 1TZLA 4S0HB 3WTUC 3MSWA 4BBRJ 3HRMA 4HA8A 4EATA 2ISZA 4DV2E 3LSKA 3FHZA 3TKYA 4BJ5C 3FIGA 2RGVA 3VYTB 1UAAA 2JPBA 5AASA 4AVZA 4MTDA 2RNGA 4RM2A 3G71I 3LL7A 3CQZJ 4QIWN 3TDZC 4BE1A 2QQBA 3DBHB 3DLLF 2O03A 1ZBQA 4XIDA 3HHHA 5C3EJ 2NAZA 3WG7H 1IRFA 4OIOF 1UILA 5FD5A 1E0EA 1JKRC 1CQTA 2JN6A 1LQ1A 3IKVA 3KX2A 3EQ1A 3ECHA 2JWTA 2WAFA 1ZRFA 1FWZA 4DV6E 3KZZA 5D4SA 3KP5A 4Y15A 1ZTRA 3CZ6A 3J80C 3JRFA 3K6GA 2KQRA 4Y17A 2NVYJ 2XSJC 4GYIA 1ULYA 2A05A 4OIPF 2MD5A 1SANA 2ZXWH 2UXXA 5HLIA 4CXFA 2H36X 3OR1C 3GXOA 3OMLA 2OBPA 2EMCA 4GDFA 2JUGA 4EV0A 1TT0A 1K6OA 3CCVI 2Q2EA 1MBGA 1Z91A 3HPGA 3EPJA 1R6RA 3HOVJ 3D5LA 1IRZA 2EN4A 2A5YB 1FMWA 3PJRA 2MABA 2F4OB 2HDWA 2H1LA 2BVMA 1MMDA 4TV7A 4FX4A 3MFKA 2EQ0A 2RSIA 3HUGA 3ZQLA 3CJTB 2MLKA 4IHXA 2TCTA 1NHAA 5EEGA 4AIDA 4R2EA 3BTCA 4F3QA 2W1OA 3H3VK 5D8KB 3FMQA 3ADGA 1N77A 4MLOA 3E1SA 3EUHA 4Y4RA 5D8LB 4B8XA 1ETKA 3F6HA 3KP3A 2L4AA 4KMUX 2NS8A 4DUZE 3BCBA 2VXDA 1U8BA 2EOMA 3DF6A 1CF7A 3VHTB 2UZKA 4BCAA 2G7HA 1MW7A 2WBSA 3T0YA 3BC8A 1ETVA 1T6SA 2VXZA 1IQOA 1AOYA 2MH9A 2QSFX 3C1DA 3DQVC 3HKZA 3K4BA 4XR6A 4O43A 3FXQA 4UUTA 4BXUA 4EMSA 4P9UA 2W7NA 4CCLA 1Z3XA 2IT0A 1LEBA 2FBIA 4A3IJ 3H0DA 3G73A 1W0TA 2DIXA 3QP5A 1FSEA 2W48A 2O3FA 3J80Z 4F6NA 1ZAAC 3CP8A 3A0BC 1X6HA 3CCSI 4UB8C 4P78A 4DR2E 1FSHA 2D1HA 2NVQJ 2YSRA 2EZ6A 4ABZA 1OCZH 2IJLA 3QODA 5FLMJ 1ON1A 3JAMZ 4R2CA 3DKYA 1WH5A 2QF7A 3IRRA 4V2GA 5A6BD 4HX7A 1JK2A 2CW8A 2R7WA 3OS2A 2PI0A 1QGPA 4WXCA 1K79A 4KITB 2ME0A 2STWA 2MBFA 3R4KA 2HYJA 4B4CA 1CF7B 3FXKA 3E97A 3S2DJ 3CUQB 5DCMA 1SAXA 1LB2A 4GEQB 4A12A 4E7HA 2IGNA 5J4VA 1J9IA 5M5YJ 4B3TE 3GFIA 2DCEA 2VI6A 1TWFJ 3AUZA 4F9BB 1TP4A 3RKWA 2CPNA 1J5YA 2G0EA 2DXIA 2D2WA 4CICA 3OS0A 3BG9A 2PG4A 5KCMA 4ZYGA 3DU6A 3ZMDA 5K5QA 2WBTA 2LFBA 1J0RA 5B3SH 4DV1E 2FNPA 5HS9A 2EMGA 5T6JA 4D5CA 4J01A 4U87A 1QNTA 2ISYA 1BC7C 2XF6A 3J81Z 1JTYA 2H09A 2ZNZA 1RRJA 2EL5A 2E2HJ 4LJZF 1PJSA 3BROA 4BEHB 2B63J 2LLKA 1N78A 1UJ8A 2MFZA 4IS1C 3EYIA 2OQRA 4FT8A 4KA4A 3OL4A 3PO2J 2ELKA 3H1CA 2RQLA 3RDIA 2IW5A 3L2RA 2F5FA 2ICWG 2E1NA 3J7AG 2CUFA 1GXPA 3D5SC 1DP7P 1O4XA 3MZ8A 3KYCB 1ETYA 4I2OA 4UV8A 1QQIA 3HM5A 3KEYA 2JA2A 2EN7A 1ITYA 4BDYA 3GWZA 3K70D 3LMLA 5HOOA 5ERIA 3RZDJ 1H8AC 3I59A 5KAFC 2EPXA 2DOAA 4IOCF 1FOYA 4PUSA 1MH3A 2YTPA 1UHSA 1K6YA 2XAJA 4BE0A 1OCTC 5BS6A 1U8RA 2L7FP 4C2UA 4LF5E 2PMUA 3MKZA 1XPXA 3ABUA 4EEFG 2K86A 4M9SA 3VPRA 1TWAJ 5HDGA 5IY5H 1EA3A 1PP8F 5IV8B 3H36A 1G3TA 2K3PA 4LIUA 3PIPF 1UMQA 2JQ7A 3FBNB 5GTHC 2O7OA 4BEHA 4BAYA 3I4MJ 2OF7A 4GRIA 3LSJA 2ESNA 2DK5A 4WXHA 2BBYA 3BCAA 3BR6A 3I56I 1XMAA 3BWGA 4FASD 3U1KA 2EJ4A 4QWQA 4WK8F 2Y9ZA 5FLXK 5CFFE 2DW4A 3C2BA 2K9LA 2LBSB 4ZZLA 1HNXE 3ZMTA 5FRMA 5DEQA 2GXAA 2M8GX 3KETA 4D0PA 3IWZA 1Z0XA 2CUZA 2L9VA 3E5UA 4HBLA 3A0HC 1A1KA 4DV5E 3BF2A 2EPPA 2IS2A 2R7FA 2JVAA 2HDDA 1WXRA 1I39A 2LC2A 2WB1N 4MEYF 2OC6A 1KONA 4RS8A 3TL4X 1DUXC 4F55A 2IGKA 4LG0A 5LEJA 2YU9J 2EN1A 2YPNA 2VKVA 2E36A 3FXMA 2PMZA 1RPWA 5HS7A 3T8RA 1A35A 4S04A 3ADJA 2W57A 3PUBA 4JP0A 4LFBE 1SFXA 4QLCU 2ECCA 4LB6B 2K5CA 2QVOA 3D0SA 3F8NA 4MO7A 1R71A 3JU0A 3TDUC 1B8IA 1J5EE 4F93B 2W84A 1VQLI 3E5QA 3DTEA 1GLNA 1QRYA 3M8JA 5FLVA 5FB2A 4R2RA 1SAUA 5KAIC 2BY0A 1QBJA 3OIOA 1QO0D 2XAFA 3HSFA 3SXYA 1Y56A 3GVAA 1T4LB 2DA7A 1RIOH 3H9QA 3MVPA 3OYNA 1W1WE 1U78A 3Q9VA 2R7OA 4LLLA 4ASNA 4RHBB 2KLOA 3K4NA 3KWRA 3OYHA 4FCYA 3LSHA 1POGA 4L18B 2V4JC 2XAHA 4L5IA 2MH2A 5F27A 1I3AA 3W6JB 1JKPC 3PM1A 2DOFA 2FE3A 5FKKA 2EL6A 2X6WA 2XUBA 5D6EA 4ESJA 1MJAA 5EJCA 5LFAA 4F54A 2X0LA 3SDGA 2KRFA 3A03A 2RQQA 4B3ME 2R7DA 3BG7A 5DS9A 5L3EA 2LBFB 3QYEA 4AD9A 3OYJA 2EE8A 3J7AO 1IQSA 2KHXA 3VSKA 2AQEA 3GZ5A 4C30A 2VT2A 5A6AA 2RV8A 1DP3A 2EPOA 1TBXA 2P6TA 5CQEA 1JUMA 3I54A 1XCBA 2EMXA 5E3NA 3F22A 3IH2A 4F52A 1IJWC 1IDYA 4DR3E 1EKZA 1PJTA 5TJJA 4A0XA 2E5LE 1IN6A 2K02A 1UG2A 1OCPA 2RVCA 5F04A 3QP6A 2JZYA 1C0WA 3AL0C 2DA3A 1HBXG 5B66C 1U0JA 1WVRA 3VB2A 4RB2C 2DPUA 2QENA 2MDRA 2M7QA 1RQ0A 1TN9A 3GBGA 2ZM6E 2Y2ZA 1R49A 2DT7B 2Z16A 1B72A 2DODA 4DMIA 1TW2A 2IS1A 3KZYA 2LY2A 4I0BA 2Y69H 2BZTA 2M1BA 2EM6A 3KP2A 1PUFA 2DU9A 1BA5A 1IRXA 1XMOE 2Z2SB 2ZMEB 3G4SI 2OZUA 2P0WA 2P5KA 3I9V2 2F8BA 2JJ7A 5D6FA 3DPUA 3HDDA 2JT1A 3GZNB 2DBBA 3BG5A 3OYBA 2UV1A 5KVRA 2ZXJA 2QBYB 1GDTA 1S8NA 1W4MA 3OYDA 3S8PA 5HODA 2EPLX 5F6FA 2BY1A 3CTAA 3CCRI 3QOPA 3TOBA 3COAC 2LV2A 3JRIA 5IT9K 3GTJJ 1YOVB 1WHNA 1OJLA 1WHQA 2OAZA 1ZR9A 2ELHA 1K4TA 2K7IA 4GZNC 3CC7I 4FETA 2FA5A 2GOXB 4R8OA 2M34A 2CW0F 4A3LJ 2X1CA 1Z77A 1OPCA 1YX3A 3BR5A 4ON0A 4JQFA 1FYMA 1YYOA 4NQWA 4GCVA 4B47A 3V8KA 1XMQE 3PUFA 3B6AA 3CCLI 2HVQA 3LSMA 5ICFA 2IRFG 2UUBE 3ECOA 3TO7A 2EL4A 4PJMA 2CFOA 1RC9A 2E1MC 4B44A 2EZKA 2FTXB 3P1XA 5LL6R 4G9YA 1HQCA 3ASNH 1IC8A 1KU7A 2HYFA 4I99C 4KNYA 1A1FA 3DFGA 4LTYA 1J26A 3I0TA 1U3EM 5ICCA 1Q1VA 2R5ZA 5FKOA 3HIFA 4UUSA 2R1FA 2Z5UA 2EPZA 2DI3A 4II2A 1IV6A 1H9GA 1Z3YA 1YI2I 3K1MA 3ZOBA 5GAHJ 1NCSA 4IRGA 3C2GA 3R60A 3WGGA 1K61A 4I0AA 2M4KA 3IUOA 3OYFA 2FMLA 2VONA 1S7AA 2DDBA 1FP2A 1WZ2A 4BY7J 4UY8I 1R9TJ 1FBSA 1RETA 2W4SA 3K1NA 4PFPA 5CLSA 2RNJA 1E3PA 3RPUD 5EEAA 2ZBKA 4D1QA 3CCMI 1E3HA 1BIAA 2XDVA 3FXLA 1O7FA 2P5VA 1YIOA 2XGEA 4RAFA 2CGPA 2PFBA 3K9TA 1L4SA 1XC5A 3DV8A 3FMSA 3MAJA 3IH4A 2CV2A 2XKPA 2IS6A 3ZP5A 1FBQA 1R7JA 2GZWA 3TQMA 3CDHA 1XGMA 4M9ZA 1ZGWA 3L9FA 1SR9A 2J7JA 1XGNA 4EJVA 4BS9A 4B43A 4WX9A 3RQIA 4M6XA 1ETXA 4G6DA 4HF1A 2ZJPF 1F36A 3VOEA 5GPAA 2MC6A 1OYWA 1QU6A 4DKKA 4PDKA 4MHGA 1DPRA 5L3DA 4XLHA 2WADA 3I5UA 3FM3A 4BH9A 4DYCA 4ENJA 4QPOA 2DGCA 1XN7A 2P7VB 5J47A 2DPDA 4BNCA 3FM5A 5DCFA 5FROA 1T56A 2RREA 3H3ZA 2H8WA 1HDDC 4EJTA 3OV8A 3GYHX 3BLYA 1MGTA 2KJCA 1XG1A 2VJ4A 2F48A 4XK4A 3KEQA 2AO9A 1XTAA 1HCRA 2FXAA 1B59A 2F4VE 2Z99A 2A69F 2JRTA 4E7JA 1W7PB 1IO2A 1N25A 1D1BA 4DOZA 2GQQA 2CJJA 4Q47A 2GAUA 3J7Yp 3A4CA 5A6BA 4IZZA 3QPHA 4M3DA 1IBKE 2HEOA 2V7FA 5HNFA 2NS7A 4IPAA 4YY3E 3ZN0A 4JX5A 3VDXA 2BB8A 3AG3H 3CMEI 4GGGA 4XLEA 4G7ZF 4I01A 2AXLA 1LDDA 1T38A 1IRGA 3LAJA 2HI3A 4M3GA 2OTLI 2R92J 1M1EB 1KGSA 2GA1A 4XICA 2IVMA 4A93J 4FHTA 1H88C 5AE2A 2UUZA 2V1NA 5IXMB 2ZKZA 2ZXIA 1O3TA 4G7OF 4CA0A 3BQZA 1ZK8A 2HQNA 2BYVE 2X48A 2M4IA 3GTPJ 2A07F 5BR8E 2DYSH 3AAFA 5GAEJ 1VQ6I 4L8NA 2EM8A 5CVUA 3V8LA 3JRDA 4AUXA 4JI6E 1Y1VJ 3LQRA 1W36C 1X3WB 2XGXA 3CJRB 4OIQF 2QUFA 4LK0F 4HLYA 3GTQJ 2ECBA 2MC3A 4RA2A 4UB6C 2VQHA 2O8KA 1FOXA 4HSTA 1EH8A 4M72A 2K9MA 5F0CA 3FHNA 4XRSG 4I76A 1YO5C 4CHUA 4BJ6C 2J5OA 3H5RA 3BGHA 5IP9J 4K0KE 2DFEA 1IN4A 2R5ZB 2E2IJ 1JTXA 3K70C 2V83A 1YG2A 4U0WA 4E7IA 1O0WA 4XRFA 2DMNA 2QZ8A 3P9KA 1LDKB 2BY2A 3WU0A 4HTGA 2PBIA 1I5ZA 2EILH 3R0AA 2VC0A 1ZG3A 1YW9A 4MQVA 3J81K 3SFZA 5C4XJ 2DB2A 4OU0A 3FIWA 1D5YA 2DA6A 4AM3A 3S1MJ 2E1CA 5C4JJ 1X49A 3REOA 1WRJA 3AV0A 1X1PA 1XX5A 3FWEA 4YFKF 2RSMA 5LLQA 3RSNA 2OA4A 2ZFUA 2A6TA 5E1WA 3QWLA 2V8QB 4LIVA 4GXOA 2MKNA 2PQ8A 2HYGD 1KZHA 2LO3A 4FTHA 4L5NC 1USSA 3SEZA 3S1NJ 4L5EA 1YS6A 2CQ7A 2LREA 2L9RA 4PFOA 4X0GA 2I9IA 2VQEE 5LRSA 3GW2A 3BIDA 2KJBA 2XVCA 1QVTA 1MMSA 3WTWC 1F9NA 4WXDA 5ED4A 1UHZA 3U9GA 4IOAF 3HB9A 1LE8A 5JFRA 5DYMA 4IJDA 5HDKA 3IWBA 5DD8A 3ZOQB 2EA2A 2EV0A 6PAXA 1WJAA 2LUQA 3EQLF 4LF8E 1SFUA 1WJBA 3ZXSA 2B7TA 2LKSA 1WKMA 1ZYRF 4P9FA 3HOYJ 5BMZA 3ZMSA 5AONA 2R7TA 1SVOA 4WPYA 4XKBA 3S2HJ 2EN6A 2FBHA 2ELYA 4MFEA 2OJED 3M99B 4WF2A 2DMIA 5F08A 2EOHA 4Y52J 1PUFB 3X2QH 1T39A 1S29A 3DKWA 5A2QK 1OCCH 4A6EA 2BY3A 2M5WA 1I3QJ 3BY6A 2PEXA 3L1PA 1U9NA 2E2JJ 2XSDC 3BZ6A 2A5WA 3ZQGA 3DP7A 3ABKH 2XPUA 1IXSB 1IG7A 2VPLA 2EQ3A 2EOOA 2DLLA 2BHYA 5M5XJ 1V5GA 1FEXA 5AC4A 2L7ZA 4MIMA 4V19K 2YTFA 1ZG5A 4P7DA 1FOWA 3C6MA 2VT3A 1ZLJA 2L5QA 4OX9E 3ZQ7A 3OYGA 2EBIA 2GIVA 1O7LA 3RKYA 5DUIA 2LD5A 1RNLA 3JW4A 1SC7A 2DQRA 3DPLC 4A0ZA 2UXBE 3HSEA 1BJAA 3ONQA 4L9VA 2UXCE 2IS4A 2R76A 3F6GA 2Q2EB 2DSYA 2V26A 4AWXB 1A31A 2CWEA 1YTYA 3MMYB 4BBYA 2FEZA 1APLC 3W6VA 4P5OA 2HPMA 3C4TA 5J1RA 1A1LA 1YE9A 2LRSA 2BXZA 2HOTA 1D3YA 5DM7F 4HNVA 2KOUA 5D5VB 4F6MA 4OMZA 4KN7X 4ZZDA 4RB1A 1KA8A 4N0BA 2VBXA 2EIJH 2L33A 1VQMI 4RDUA 5J1YA 5CVVA 4IHVA 2EM5A 2L2MA 4JI3E 3WU1B 3IHUA 5E18F 4ZDOA 2RQPA 3PNTA 1TWGJ 2EK5A 2VKHA 2A25A 3FDYA 1BL0A 1XSXA 4A3MJ 2JA7J 4DV3E 3BTJA 3I59B 1I94E 2LOOA 5BNGA 3GTGJ 4D7MA 1LVAA 1X3UA 1BOAA 3OYEA 4GKJE 4I09A 3SQNA 4J19A 1BI1A 5F3WA 4NXNE 4IJAA 2MSYA 3OYLA 1PUEE 3LA2A 1RESA 4BXXJ 4DBQA 2DYRH 3GTKJ 2RKHA 1G2HA 1LJ9A 1X3CA 1AA7A 3CO7C 5KL4A 3F8BA 4OIRF 2VKEA 4EJOA 1T95A 1VQ5I 2EOJA 2V88A 1FX7A 3A01A 2CV1A 2X6YA 2JSCA 4U7BA 1NEIA 4G6TB 2VIXA 4CYDA 2KHMA 3GO5A 2HJJA 5DD4A 2LR8A 3NWSA 1I1GA 3JCUC 4M3FA 1IBME 4L9NA 2LVSA 3Q0VA 3VWBA 1OFCX 1SVMA 2DK8A 1P9QC 5FFXA 5IOYA 4AQYE 1WJDA 3BZCA 4HX4A 1MNMC 4BE2A 3KE2A 4DUYE 1ZGJA 1CGPA 2L9NA 1MD0A 2BVLA 1FOKA 1HR0E 2CSHA 3VEPA 2EFNA 4XLCA 2V86A 2WY8Q 1FTTA 1DQUA 4CCOA 3T1HE 1TWHJ 2EP3A 3LOCA 3VYSB 1WJ5A 1BBGA 2GPIA 5M3FJ 2X1DA 2AHQA 2XGDA 4JI2E 3C7JA 1R4NB 3J81C 4B3RE 4BL0B 2E7XA 3HTXA 5IT9Z 1TT5B 3UNGC 5GPCA 1I1SA 2QQ9A 3CUQC 4RBOA 2DFHA 3DCFA 5BQTA 4DBRA 5JHUA 3FZVA 4DIQA 4DR4E 1BB8A 3PQJA 1PDAA 3CMMA 4NB5A 4R2PA 2M8EA 4OOIA 1LPQA 4TUIA 2W25A 5J6XA 5C44J 2YX4A 2GA2A 1T08B 2R5YA 2YU8A 4N9IA 4C3HJ 2EN8A 1MBHA 2VPRA 3LAPA 2GWRA 3EYYA 1GTKA 1ON2A 4BHPA 3OTOE 2CG4A 2Q8UA 4J8ZA 5AC5A 1GVJA 2EPFA 2K3FA 3P5JA 1VQNI 2IGOA 3NAUA 2R7RA 3ZQQA 3OWTA 2PJRB 3P9CA 2YRKA 2WAEA 2J5PA 3I53A 4EJUA 5KHDA 3WTXC 1P2FA 1V3FA 2N8GA 4C3IJ 5A2QZ 2YZTA 1ORKA 4OOGC 2IEKA 2F6CA 2LY9A 2O8XA 2EPCA 2VQCA 2QBYA 2Y0SN 5D5XB 5E17F 2I13A 4G94A 3O8HA 4R03A 4RB3C 4RH8A 1JKOC 3S16J 4ZDPA 4MEXF 1WJPA 2A3SA 4H0EA 5LGTA 2UXDE 3K7AJ 4IHWA 4CGZA 3BJ6A 3F23A 2B0LA 1S9HA 1BBYA 4JX4A 4Z2YA 4IX7A 1ETOA 4MQ9F 2QA4I 2BW3A 1B72B 3U21A 2FU4A 1Y39A 4JI4E 3HSRA 3EUKL 1J2XA 1QZEA 5F0FA 1HC8A 2V6EA 1X2MA 2GBYA 3BR1A 3F72A 3W6KB 3CCJI 2EMIA 2L3JA 1I50J 1R23A 2KMUA 4B09A 2X85A 1I6HJ 4UVBA 4IQJA 1P4AA 2MA3A 1TQPA 1D5VA 1GHCA 2NA2A 2VQFE 1MBEA 1XNRE 2XAQA 4RGXA 1LNWA 2YTDA 2VQLA 1G2FC 2YTOA 4RMNA 2LUPB 2K9NA 5CKTA 5LGNA 2WBMA 1LEAA 4Y3OA 3JRGA 1BI2A 3KCCA 3WHCA 1FLIA 4WSPA 1MEYC 3GFLA 2ETHA 1FP1D 3A01B 4BACA 1J59A 1ZQ3P 2LP0A 4LFAE 4DR6E 2V1DA 2CH0A 4M71A 3CUQA 5DCMB 3RI4A 3NEUA 4NC8A 4AYBA 5B5EC 4NXME 1ZKGA 3G1OA 5FRNA 2EQRA 3ZPLA 1B69A 2Y0SA 2I8DA 4X1EA 1W5TA 3SEQA 1A04A 4UNOA 4JI0E 3ZRGA 2ZJQF 4KWYA 4XN0A 1DQ3A 2JY9A 5HLTA 3PSFA 4JI8E 3HJEA 2D45A 3IWCA 5H6QA 4LF9E 2XKOA 3H0GJ 2YX7A 3G1MA 1X2NA 3L2CA 3OOUA 3M7GA 3OSGA 1YRNB 2KP6A 4EM1A 3HL2A 4NDLA 1EJ9A 2OD5A 2K4JA 4IKFA 3LFUA 4GYGA 2EOXA 4PJJA 4P1WA 3DEEA 1MNEA 1WJEA 2GHFA 2KIQA 3M8FA 2VOPA 1T2KA 1E2XA 4KZSA 1S7EA 1AKHB 2EPUA 2R7UA 4NNJA 3WG9A 3H5AA 1GV2A 4CZZA 2K7LA 2EOYA 2EWNA 3R6SA 2QYOA 2DMTA 1DI2A 1XGOA 4A3FJ 1EF4A 2QQ8A 1XSDA 4HG2A 1P6RA 2G9WA 3BJOA 1OLTA 4HEA2 4UV9A 1P7IA 5GAGJ 2Q0OA 1RUNA 1WPKA 2B7EA 1IW7F 3HPSA 5J8CA 1IXRC 4BU2A 2DQLA 2R93J 3CCUI 5LRRA 3BQYA 1DPUA 4DV0E 1Z1DA 5A6KA 3G1LA 4ESFA 1K83J 1HNZE 3LLHA 3VYRB 4ZYEA 2MLGA 5TISC 2GM4A 4XSXF 4ZDLA 2EMZA 1X1CA 2H27A 1MSFC 2EMFA 5EGOB 4R1HA 4BQNA 5IT3A 4H4KC 3I4NJ 2FOKA 3H09A 2CTDA 2JYAA 2XF7A 1DU0A 4XKWA 5K5RA 2KIUA 2P6SA 1JHHA 5EG0B 2LTSA 1ETQA 1STZA 1VTNC 2DDAA 1DGRM 5LHHA 3R0JA 3G3ZA 4P96A 2BHZA 1N75A 3ZMVA 1A5JA 1R5GA 3IP4B 1Y8RB 2COMA 2HFHA 3JR9A 1W36D 5LEKA 3ERMA 2RDPA 2Q8KA 3QPLA 2JA5J 2R7VA 4R79A 4E7LA 1UN6B 2KT0A 5IT9C 2LSOA 1Y1WJ 4FE4A 1PVEA 2LG4A 4DR1E 3PL8A 3TO9A 2LMDA 2NOJB 3C6KA 4LOCA 2AXTC 3M8EA 4HYEA 3RQ4A 3FKJA 2XPWA 2VQGA 2H94A 3BPVA 5JVTA 2O6GE 1HSJA 4LB5A 3WTTC 1A1HA 5L3CA 1U6GA 3I4PA 4B3AA 3WTYC 1ZRCA 1A1JA 3AG2H 4JX6A 4OWRB 2ZMEA 2LDUA 3W2VA 1W5SA 2LTRA 3UK3C 1HF0A 1EV7A 1T33A 1U5TC 2K9SA 3AKZA 1YITI 1N34E 2VJ5A 4G6QA 1VQOI 1BW5A 2ODRC 2M87A 3F21A 1G3WA 3QYBA 2MC5A 4MNUA 4V2FA 3GLXA 2PJPA 2LH9A 2X6OA 1RC7A 5KK1A 2CUJA 3QYFA 4I7HA 2YTQA 4M3BA 1X48A 4IHSA 2EPNA 2VE7C 2HXOA 1TNTA 4X6AJ 5AE3A 2VL8A 2HQRA 1YW8A 1LUJB 3JSPA 1GXQA 3BP8A 3TW6A 5K1YA 2LY1A 3MKYB 1X1DA 2ZXHA 1ENHA 2VN2A 3ZQIA 5D5UB 1KYWA 1NK2P 3CLQA 3N97A 4F7ZA 5K7ZA 5B1AH 4NQWB 4HLXA 1I6XA 2LJUA 2EZIA 3KZIC 2V9KA 4XORA 4EVIA 3W3CA 1YJWI 4R2QA 1JJ6C 2KL4A 3BG3A 4XBFA 3B6CA 3O3KA 3WU2C 5TRDA 2O5RA 1IN7A 2EMKA 4YRVA 2LK2A 3SZTA 1T8IA 5F1JA 5JI6A 2EORA 2N3GA 5FKNA 2NUFA 2HHHE 4BKXA 2E5NA 3L2UA 1H9TA 2ZO4A 5BPIA 1A36A 1N32E 1DU6A 4AU7A 3ESWB 1SD6A 3ZN1A 4BY1J 2DFIA 3CUOA 5DUKA 1WFXA 4L0ZB 1PP7U 1YW7A 2LRDA 1RKWA 1T0FA 3B02A 4BGDA 1O57A 2DTRA 2GOMA 4OAZA 4X9JA 4X64E 2W24A 4U0VA 3S15J 3ZQHA 4HX8A 4M9XA 1TLHB 2CQQA 3A02A 2Q1ZB 2Y31A 1JGSA 1G3SA 3CDIA 3EETA 2DMPA 1T98A 1P4XA 3MEXA 3BDDA 2YTIA 1HLVA 3D5RC 1JHFA 4LU9A 4MLQA 1RI7A 2L8TA 1G3YA 1R58A 1RR7A 3GEZA 2YTEA 1WWXA 1XGSA 3JREA 4MLVA 4O5GA 3J80K 2VJJA 1YPNA 1V5FA 4B1RA 4GFBA 1HW2A 2TRTA 3D1NI 2EPRA 3RMPA 3RKXA 1I27A 1YYWA 1JE8A 3ZR8X 4QPQA 5EG0A 1IZ1A 1YQAA 3TOAA 4ESBA 4YFNF 2EWLA 1LVKA 3CO6C 5E1ZB 2K85A 3F6OA 5E3MA 2EFWA 4JI7E 3CESA 3EUHC 3HZJA 1MJ9A 3HOWJ 5KL5A 2IP2A 3IV5A 2XF5A 1EKEA 2MKDA 1W0UA 1D0ZA 5LHGA 2LT7A 1XDUA 4PJ0C 5LBQA 3S14J 1LFPA 1TQIA 2QGUA 2JUCA 1J75A 2ESHA 2E72A 3RKQA 2STTA 4FK5C 1BOBA 3ABLH 5DNYA 3ADIA 1K4SA 5EZGA 2WC2A 4QTRA 1WSUA 2K40A 4II3A 4UXNA 4R8HA 3I58A 5EZHA 2EQ1A 2KRHA 3JRAA 3RPUA 1BI0A 3LSRA 4YFXF 4YELA 4RLFA 2WB1A 4RAGA 1ACIA 2HS5A 3QG5C 1HKTA 1ZGAA 2HTSA 2NOGA 4C9YA 1H0MA 2VE9A 1MKMA 3A1YA 4HZFA 4NUBA 4E70A 2EM4A 1FNNA 2LYCA 4HSRA 4Z6YA 3SHFA 4DJAA 1X19A 1XMKA 2EFQA 3SZGA 4ITVA 1ZARA 4RLQA 1R1TA 1BIBA 4A3CJ 3FX3A 1YYVA 4KN4X 2LE2A 1Z1BA 1T0FC 1FJLA 1X4PA 1TC3C 1TF3A 4FISA 2DA5A 1AKHA 4AVPA 2CQNA 3V7CA 5J4YA 2UWMA 5KNLA 2EZHA 1ZLKA 4X62E 4XLAA 1X1BA 2OU2A 3OYKA 4KJZA 3W2AA 3GZ6A 3NRVA 2QWWA 3THNA 2A6EF 1ZU1A 2F4IA 2QM3A 4A69C 2FV4B 1YJNI 2L3CA 4DR7E 1N33E 1S5LC 5E1XA 1UCRA 2LTPA 1REPC 4DGWB 3S17J 2LJHA 2KONA 3HKZN 5F1RA 2Z1DA 2ID3A 2YTNA 2CMPA 2DA4A 2CU7A 5HDNA 1SFOJ 4LLNA 4XOPA 3HQ1A 3P7NA 1NK3P 4A6DA 3HOUJ 1YSAC 2YPRA 5JR3A 2MGQA 2LF7A 3J7ZI 3OY9A 1OISA 3QU6A 2M30A 3OIPA 4MFDA 1STUA 3NWTA 2HXIA 1SEUA 3H35A 2MYSA 5IYCJ 2A61A 1D1CA 1Q1HA 2EPAA 4I6ZA 2E34A 3ZQCA 2FJ1A 4BUPA 2HGCA 2DLQA 3KYDB 4UUSB 2XROA 2Y30A 1VQKI 1WH7A 3S2WA 5E3LA 5K7HA 1OMIA 4N4OB 3T1BA 3MKWB 3IAM2 4M6YA 5DDGA 3MQ0A 1JXSA 2E71A 2BOLA 4HV5A 1WJCA 1JT6A 1R22A 2L54A 1G4DA 1TW3A 3HOZJ 3CDLA 1MMGA 4BQOA 4E6KG 5FFZA 4A3BJ 4JV5E 2VBYA 2JA6J 5FJ8J 5FLXZ 2KKOA 2WA0A 2K4BA 2IXSA 3IL2A 3DWLE 3CMYA 3KP4A 2R0QC 1R4MB 4XONA 2WY7Q 2A68F 2LF8A 4HAMA 1P7JA 1TWCJ 1SMTA 2WV0A 3ELKA 3L00A 2WV1A 4WYQB 5IP7J 3AG4H 2RPCA 2EINH 3E6CC 4BC7A 2LKPA 2EIMH 4Q28A 4CUGA 2D9HA 1QHHD 3LSIA 3UKGA 3VSLA 4DYQA 4HDVA 2PMZN 3SDBA 3VODA 3ADLA 1JT0A 2L2OA 3F0CA 4UVAA 3HPHA 5J1UA 4NC7A 5JLWA 2L4MA 3I3LA 1Y6IA 1LE8B 5LGUA 3LA7A 4XLFA 1P4WA 3BR0A 4RGUA 4FE7A 2GLOA 2VUMJ 2L2KB 2JA8J 1B9MA 1XCVA 2V87A 3FF5A 2GLIA 1B4AA 2HQ5A 1R1UA 1Z9CA 3K2ZA 4PCQA 2CUEA 1K78B 3QPTA 4R2AA 1IN8A 1X3ZB 1BW6A 2BGCA 1U5TA 4M30A 5HNHA 3S93A 4GO1A 3V4GA 2K9QA 4XRMA 3QU3A 3BG6A 3E6BA 3GF2A 1HOMA 1RUOA 5FKLA 4EQQA 2R7XA 2HKXA 1XB4A 4IRHA 3TBIA 4LG0B 2VF1A 4KYWA 2L6MA 4BMJA 5DM6F 2Y0MA 3S3MA 2EM0A 2ZFWA 1FIPA 3RTRA 2NVUB 1MJBA 1IN5A 2E19A 2R7ZJ 1KU3A 2PJRA 2JPCA 3C3WA 3BZKA 5CPRB 2W00A 3HRTA 2VE8A 1MBKA 2HOEA 1JK1A 1ZAOA 4GKKE 2OPTA 3TP3A 1VQ8I 4A3EJ 2P81A 2DJIA 2QQAA 1G6NA 4CYCB 4KIGA 1TNSA 4PSXA 2JTVA 2OTJI 1WGXA 3PIOF 5EEHA 4I02A 5JVGF 1UELB 3KPHA 3KIOA 4KIBA 2L3DA 1QPMA 1OCRH 3DBRB 3WGIA 3CF5F 1FPQA 2VODA 4B3SE 3U1DA 1F5TA 1GQEA 1J09A 2IPQX 1MBFA 5ILSA 4J00A 2XPVA 1UFMA 5GTIC 3O8GA 1GV5A 1D0XA 2KISA 2KFDA 4MTEA 1K78A 2UXNA 2NVTJ 2KRCA 1FT9A 1R1VA 2L2NA 1FTZA 1ZR2A 1XNQE 1A6QA 3NQOA 1O3SA 2NUGA 1F1ZA 1HW1A 1MH4A 4C2TA 2MD0A 3F6VA 3SZPA 4IXAA 4CH7A 2CFXA 1SD7A 3DKXA 2EZLA 2MW8A 1O3QA 4XL9A 2PRTA 5E8IA 2BXYA 2B9DA 1R00A 1T4NA 4K2EA 2HC5A 2ACJA 4E4HA 4M73A 4LG3A 2ZCWA 3OIQA 2CW7A 3GFJA 1TQMA 1Z21A 5H2FC 1SMYF 2EOQA 4I8OA 2JXPA 2FOWA 1YX5A 2D1VA 3HC7A 3FK6A 2HPIA 3FXRA 3M07A 4MGRA 4AIKA 1X6EA 2Y48A 3DJWA 4HEIA 4YHHE 5IOZA 1X6FA 1Y0NA 3K4JA 3RYPA 2R7SA 1KQ8A 1U2WA 4NHRA 2BV6A 2EMLA 2HR3A 1QPIA 1UG0A 4KFCA 4DNCA 4ZYDA 3AFHA 4CDGA 1FY7A 5CVRA 2PN6A 3V42A 1YRNA 2ZB9A 3TW7A 4ENNA 4BQAA 2JR1A 2CQXA 5H6RA 5ICGA 1KU9A 2KDZA 3GTLJ 2N3HA 1S6LA 1X4OA 4HW0A 2ZJ2A 4PZJA 3WTSC 1MNDA 4BHBA 4C2MJ 5CQGA 1Z7UA 1RMDA 2EN2A 2M7BA 3GX4X 3ROUA 1QHGA 1SVLA 2O9LA 1JGGA 1YFHA 2L02A 3BR3A 5A6JA 5CJ9A 3S1QJ 3C4BA 3JAMC 2YT4A 2DA2A 3W2WA 2RN7A 1Y0UA 2AQFA 4XMYA 4KHPE 4PGGA 1FC3A 4LD5A 1O3RA 2V79A 4JYAE 4F2JC 3LSPA 3CMAI 1WQ2A 1SD4A 4XLPF 3CCYA 1HNWE 4IRIA 2B7VA 2DRPA 2HNHA 2BEOA 3E5XA 2RTXA 3TQNA 3M4OJ 5IYBJ 2JVHA 3RZOJ 2V9PA 3DPTA 4HV6A 1F2IG 1MZBA 2L0KA 2OZ6A 2OUMA 1AHDP 1B8IB 2LBFA 4EJWA 5HLHA 1PKPA 2ADRA 3BR2A 3JSOA 1XD7A 3GMEA 2KDOA 5ILUA 4A5NA 3MCZA 1E3OC 3EPZA 1X5WA 5KL2A 3V8JA 4A3JJ 4KT6A 2XHKA 4W97A 3KYLA 3O6BB 4DV7E 2HOSA 3ABMH 4ZYHA 2IAIA 2H6CA 4O3MA 4R2SA 2HGHA 1MMAA 3G6EI 2R5YB 3HRUA 4E7KA 3KEOA 4ZTFA 4O4KA 3K4KA 3HRSA 3H3UA 2JMWA 1ODDA 2CRGA 3DEUA 3DF8A 4XN3A 4PJLA 1NTCA 3DTKA 3K69A 4F9CB 1KJKA 5EGOA 3QPSA 1SFKA 5IP6A 3PO3J 5LD2C 3CLOA 2IGMA 3HGYA 5DTDA 3AG1H 2X9DA 2CT1A 3VYXA 3IWDA 2EJRA 3PQKA 3S3NA 1EH6A 3VYUB 1IBLE 3EPHA 2M1SA 1IUFA 2FD5A 4CCMA 1GT0C 2DT6A 4CCKA 2M0MA 1PJQA 1B9NA 2IA2A 3LNQA 2B9SA 2E1MB 3IH3A 2P4WA 5H20A 2L7KA 3E7LA 4G8XA 2DA1A 2BW3B 3CF2A 5DV5A 2ID6A 2LNBA 2EN3A 1BR4A 5KL6A 2MC4A 2VB6A 2IHR1 3M3YJ 2RS6A 5KL7A 3V7SA 4RAYA 3QOEA 1MMNA 3L7WA 3TP0A 5JHFA 4DV4E 2CO5A 4LGWA 1MDMB 2F5DA 3B73A 2R3SA 2ENAA 1XDSA 1W7PA 3LWFA 2HDCA 3CC2I 3ERED 1VFCA 2Y9YA 4F92B 5J40A 2YRMA 4HNTA 3GTMJ 2QLZA 2KIMA 4JI5E 1BR1A 2VJIA 4XM3A 1BC8C 5D4RA 2X1EA 1OR7A 2QCOA 3KLNA 2OV7A 2XV4S 3QRFF 5KL3A 4JK1X 3DU5A 3GLLA 2MDGA 1FMVA 1WHUA 3SJMA 1RZ4A 5E8GA 1GZ6A 2FNAA 1VZ0A 4NBQA 3CD6I 1UHMA 3E3VA 5ICEA 1GVDA 1ZR4A 4KICA 1AU7A 2DMQA 4PK4A 4YIRX 2NNYA 2IBDA 2ZMEC 3HTUA 1WI9A 3VFZA 3OSFA 4A3DJ 1V4RA 4L0YB 2XRNA 3GTOJ 3MZHA 2TDXA 4ZH4F 4BXFA 1KQ0A 2EOFA 2ME6A 1IAWA 4L9TA 1IUYA 1N36E 3FISA 4XRSA 4HF0A 3RPQA 3OS1A 1D8JA 2ELJA 4HOBA 5B1BH 2EOSA 3WHBA 1VQ4I 1ERDA 5IYDJ 3F8FA 4KIFA 3AL0B 2N8XA 1V55H 2VC1A 3I71A 3IAS2 4BYYA 1ETWA 1RKTA 1K7AA 1ZBTA 3F8CA 4YG2F 2QSHX 4LF6E 1S72I 1XSVA 1KYQA 2X51A 4ANJA 1GUUA 1BR2A 3T5XA 3I55I 1R5HA 4JBAA 2JRMA 2VRDA 5K7FA 2HVSA 2DO7A 3P9IA 2P8TA 4WWCA 2DOEA 4LF7E 5LMUE 1DGWY 1X1AA 1DDNA 1QA6A 4UHTA 4ZYAA 5F0HA 4ETSA 1IMUA 2EFPA 4U0YA 5M3MJ 3OYIA 3JRHA 2JK3A 3G2BA 2HQAA 2V9VA 5ADZA 2WAQA 3MD2A 1ZREA 4X8WA 2EM2A 3BTIA 1B1BA 4D9JA 4BC9A 3OR2C 1H89C 3L2VA 2DAOA 4RGSA 3N4MA 2XC7A 5FKMA 1NH3A 3C18A 4JYKA 2YRHA 2H1KA 4TUGA 2E7WA 1ZN2A 2V1XA 2YUSA 4AIJA 4BDZA 1MSEC 1QU3A 2YSPA 2JP9A 2UUCE 4Q35B 2FRHA 2VASA 3HHGA 3K4MA 3M1CA 3BJAA 4HQMA 2V85A 3VK6A 4BQQA 2YTJA 2XAGA 1JI8A 3ECRA 1OR7C 3FXOA 5FGMA 3PFIA 2Z33A 4W1UA 2EMAA 2QKLB 3Q0WA 1FYLA 2PLYA 1ZRDA 5JLXA 2EFOA 2XASA 1YHQI 4C3JJ 4CO8A 4Y13A 3JTZA 4JOMA 3N05A 4Q4ZF 1PJRA 1VI0A 2EM7A 1FKAE 3E6DA 2HTJA 4LK1F 5IPAA 3H5NA 1UZCA 1HSTA 4P55A 2ELZA 2FGGA 1Y8QB 4CCNA 3ZCOA 4XKCA 2OQGA 2VBWA 3ULQB 3OOPA 4XQFA 4BBSJ 4WFTA 4LLGF 4PSWA 1KYZA 2EOIA 3JAMK 2WAQN 4ZC3A 4OMYA 2VOOA 4X66E 5FLXC 1PYVA 2FQ3A 2DT5A 3F3XA 3OMYA 1JJ8C 2KPMA 3WTVC 3H92A 1VQ7I 2MG4A 1U9OA 2B3TB 5A69A 2L92A 1E17A 1YS7A 1AWCA 4KISA 3LA3A 2RAEA 2EMYA 5BPDA 3R61A 3K4LA 1SFEA 3KFWX 4XSZF 3HUGB 3ML6A 4A2UA 1P92A 3OYMA 3TO6A 5EF6A 1KU2A 3Q3SA 2NABA 1DGCA 2DJNA 2FSWA 2M0CA 3JTHA 3WE3A 4HDUA 1YIJI 2V1UA 4DW6A 3GUDA 2XIGA 3HG9A 4LFUA 4HQEA 4BJTA 4A0YA 1B6AA 3PFYA 1JUPA 1ONVA 4XOTA 3LMMA 3TMOA 3TEDA 2K4VA 4M0VA 3BT9A 3JRCA 3ZQFA 1ZHFA 2KZVA 5IWAE 2ZJRF 4F9AB 1VNDA 3CJQB 2FF4A 5TSEA 1Z67A 4PJNA 3H9GA 2JOBA 4N4RB 1MBJA 2GIZA 2LVHA 3K0LA 5LHIA 3SYTA 1YUJA 1BI3A 1BN5A 3SFIA 3LSTA 3O2PE 1R5ID 4RGRA 2PX9A 2ZC2A 2YU5A 4I98B 1YUIA 1TL8A 2VBZA 2DN0A 1BBOA 3GFMA 4D5FA 4NC6A 2DFFA 2EM3A 3JTGA 2EIKH 4CCJA 1R36A 1D8KA 5BOXA 2M9HA 3K10A 2HKOA 4M6VA 3BOQA 4CSWA 3WTZA 2ODRD 5AIQA 4NHJA 3UR3C 5F64A 4XKVA 4F91B 3L2WA 1LDJA 3HXLA 1LFUP 1Z6TA 2WZOA 3JRBA 2RC4A 5E3OA 2QEXI 4G7HF 2KIFA 1N3GA 3MN2A 2EOEA 1HW5A 2ENHA 2YSOA 1LLMC 1HKQA 3HTSB 5CVJA 1UHWA 4G12A 4WSGA 4IF4A 2EOZA 4AYBN 2M7AA 3S1RJ 3CCEI 1A6IA 2NNNA 2JSPA 4S05A 4CYCA 3CC4I 1BM9A 1D1AA 2CV0A 1IV8A 4XNFA 2ADUA 2OCEA 2EV6A 4A3KJ 3K1PA 3HOXJ 1W7PD 4E7ZA 3CJNA 4DZJA 2ZSHB 4KUMA 4WCGA 3IC7A 1FYKA 2A6HF 4EM0B 3KLOA 3EPLA 4IVNA 4IO9F 2UUAE 2L7MP 2Z9OA 2EH3A 2HOAA 1YYKA 3T1YE 2K27A 1BJZA 2R7QA 1HXDA 1HDPA 4ENKA 3CP2A 4N9HA 4DQ2A 4ZTJA 1FIAA 3WE2A 2EB7A 2X6XA 4EGZA 2YWQA 1YLFA 4DZPA 2FUG2 3K2AA 1FBUA 4Q48A 1P47A 2HVRA 2YTGA 4O6JA 4IEJA 2XGCA 1IXCA 1Z7LA 3FXJA 3T8TA 2YR2A 3RYRA 3HYIA 4HF2A 1AAYA 3OYAA 4UUVA 1QVUA 1G59A 2PMHA 2WBUA 1VQPI 4AIHA 5ILVA 5GP9A 2EM9A 4FQGA 3DXJF 4HPQA 3HPZA 2XRLA 2DLKA 3L09A 3Q0UA 1HKSA 3F8MA 3IKTA 4L9JA 2E1MA 4B3XA 4R2DA 1WI3A 2NS0A 4A5MA 3THOB 4OAYA 5AE1A 4ZJZA 1KQ9A 3QAHA 2NYXA 1JKQC 2HZTA 1S7OA 1ZG1A 2EMBA 5E20A 1OYIA 2IA1A 2L9SA 2Z3YA 3LQQA 2WWYA 3OL3A 2VLAA 2CSOA 1FJGE 4O5VA 4M2ZA 4Y33A 3MZYA 1T4OA 2F5VA 2HU9A 3HEFA 2GXBA 2LCEA 4RM3A 3MHHC 2V6CA 5HVQC 5EYRA 2CYYA 4QSHA 2O61A 3RIRA 1F4KA 1HA8A 3U2RA 2M2EA 2AS5F 1WCMJ 1G2DC 2G7UA 2M4GA 4RB0A 4AC0A 1SD5A 1Z05A 2FMYA 3PNVA 5L3BA 5K5OA 3MKLA 2YS9A 3VYYA 2F5CA 3S32A 1VF9A 2JOXA 2XAUA 1NG6A 2GXGA 2I10A 2Y75A 5E79C 5D5WB 1F43A 2H6BA 3BPXA 3QQAA 4M3EA 1L0OC 1Z6RA 1QZZA 2I5UA 2O0YA 4RAZA 1ZELA 4U88A 2DTZA 1V54H 4YIIA 1YZ9A 5L3FA 4LFCE 2HZDA 2EMHA 1XMXA 3F9KA 2M45A 1X58A 2H8RA 4DYRA 1J7KA 3FK7A 5FO5A 4LMYA 4IHTA 4X65E 3E0JB 4M9VC 3MWMA 2EPMX 3Q5FA 2D5VA 4IHYA 2XB5A 3RCOA 1MDMA 3EPKA 2QSGX 4JI1E 2ENCA 3M1EA 1IF1A 1LKXA 1W5CC 4KMFA 3LSGA 2WTEA 3WGHA 3ZGKA 3FBIB 3L2QA 3ISPA 2EV5A 3FXUA 3TGNA 4M74A 4EM2A 2F5EA 2P7CB 2KZGA 5EDNA 2W82A 2CQKA 4E7SA 4Q5SF 1A1GA 1A1IA 1EH7A 2CS3A 3J7YJ 1LFBA 1V5EA 1X47A 1UBDC 3M9AA 3IWFA 3KP7A 2HWVA 2E60A 3H9JA 1TTYA 2F2EA 2JVGA 2NRAC 1IGNA 5HS8A 2XB0X 2C6YA 2LKXA 4HRIA 3BTLA 4PGHA 1U5TB 4IL6C 4IQ4A 5AIPA 1USTA 4LITA 1MIJA 1NG7A 3LFKA 5TGTA 2M3AA 1OCOH 5CYVA 4YIFA 4KT5C 3FKIJ 1OKRA 2L01A 4YEJA 4DR5E 2V89A 5LMNE 1G8XA 3S3OA 3MHSC 1OQYA 1OYYA 2ZSIB 5HLGA 5A2QC 1WJFA 2IA0A 4A3GJ 5L3GA 2EA4A 1JUSA 3EUAA 4Y7NJ 2NXNB 3HGGA 1ZH5A 2FQ4A 3A2KA 1QZYA 3EDPA 4FX0A 4XLNF 3K4CA 3NARA 2E1OA 4HNUA 1FZPB 3HBLA 2JWOA 4OINF 4BHCA 1TF6A 4D7NA 2W85A 3PNYA 3ZMZA 3V7RA 2DMYA 4KDPA 2QKMB 2YU3A 2FBKA 5FD6A 2E5ZA 2NUEA 3HOSA 2EPKX 1IDZA 4EGYA 1RR8C 4U7DA 2F4MB 1S3JA 2EMWA
chains in the Genus database with same CATH topology
3Q9SA 3FMRA 5CVIA 1UB9A 3I64A 1PDNC 3RJPA 3ZMUA 2BE5F 3IRQA 2P5LC 2ZNYA 4ENMA 3KP6A 3ABTA 3HOTA 4L5JA 1L3LA 3E6MA 4UVCA 2X4HA 3WODF 5J8FA 3WTUC 3HRMA 4HA8A 2ISZA 3FHZA 3TKYA 2RGVA 2JPBA 4MTDA 3TDZC 2QQBA 2O03A 3HHHA 2NAZA 1IRFA 4OIOF 5FD5A 1LQ1A 3IKVA 3ECHA 1ZRFA 1FWZA 3KZZA 5D4SA 3KP5A 4Y15A 4Y17A 4GYIA 1ULYA 4OIPF 2MD5A 2UXXA 5HLIA 4CXFA 3GXOA 2OBPA 4EV0A 1K6OA 2Q2EA 1Z91A 3D5LA 2A5YB 4TV7A 4FX4A 3MFKA 3HUGA 2MLKA 1NHAA 5EEGA 5D8KB 3FMQA 3EUHA 5D8LB 4B8XA 3KP3A 2L4AA 4KMUX 1CF7A 2UZKA 2G7HA 3T0YA 1T6SA 2VXZA 1AOYA 2MH9A 3C1DA 3DQVC 3FXQA 4BXUA 4EMSA 4P9UA 2IT0A 1LEBA 2FBIA 3G73A 3QP5A 1FSEA 2O3FA 3J80Z 1FSHA 2D1HA 2YSRA 2IJLA 1ON1A 3JAMZ 3IRRA 4HX7A 2PI0A 1QGPA 4WXCA 1K79A 2STWA 2MBFA 3R4KA 1CF7B 3E97A 3CUQB 5DCMA 1SAXA 1LB2A 4A12A 1J9IA 3GFIA 3RKWA 1J5YA 2D2WA 4CICA 2PG4A 4ZYGA 5K5QA 3ZMDA 1J0RA 2FNPA 5HS9A 1QNTA 2ISYA 1BC7C 3J81Z 2H09A 2ZNZA 4LJZF 3BROA 3EYIA 2OQRA 4FT8A 4KA4A 3RDIA 2IW5A 2F5FA 2E1NA 1GXPA 1DP7P 4I2OA 4UV8A 1QQIA 3GWZA 5HOOA 5ERIA 3I59A 2XAJA 5BS6A 1U8RA 2PMUA 3ABUA 2K86A 4M9SA 5HDGA 1PP8F 1G3TA 4BAYA 2ESNA 2DK5A 4WXHA 2BBYA 1XMAA 3BWGA 4QWQA 4WK8F 5FLXK 2DW4A 4ZZLA 3ZMTA 5DEQA 3KETA 4D0PA 3IWZA 3E5UA 4HBLA 2R7FA 4RS8A 4MEYF 1DUXC 4LG0A 5LEJA 5HS7A 3T8RA 4S04A 2W57A 1SFXA 4QLCU 4LB6B 2QVOA 3D0SA 3F8NA 3TDUC 2W84A 3E5QA 5FB2A 1QBJA 1QO0D 2XAFA 3HSFA 3SXYA 3GVAA 1RIOH 1U78A 3Q9VA 4LLLA 4ASNA 4L18B 2XAHA 4L5IA 2MH2A 3W6JB 2FE3A 2XUBA 5D6EA 4ESJA 1MJAA 2X0LA 2KRFA 2R7DA 5L3EA 4AD9A 3J7AO 3GZ5A 2VT2A 2RV8A 1TBXA 2P6TA 3I54A 1XCBA 3F22A 5TJJA 4A0XA 1IN6A 2K02A 2RVCA 3QP6A 2JZYA 1C0WA 1HBXG 3VB2A 4RB2C 2DPUA 2QENA 1TW2A 3KZYA 4I0BA 2M1BA 3KP2A 2DU9A 2ZMEB 2OZUA 2P5KA 5D6FA 2JT1A 2DBBA 5KVRA 2ZXJA 2QBYB 1S8NA 1W4MA 5F6FA 3CTAA 3QOPA 3TOBA 3COAC 5IT9K 2OAZA 2ELHA 2FA5A 2CW0F 1OPCA 4ON0A 4JQFA 1FYMA 4NQWA 4GCVA 3V8KA 5ICFA 2IRFG 3ECOA 3TO7A 4G9YA 1HQCA 1KU7A 2HYFA 4KNYA 3DFGA 3I0TA 1U3EM 5ICCA 3HIFA 2Z5UA 2DI3A 1H9GA 3K1MA 4IRGA 3R60A 3WGGA 4I0AA 2FMLA 2VONA 1S7AA 1FP2A 1FBSA 3K1NA 5CLSA 2RNJA 2ZBKA 1BIAA 1O7FA 2P5VA 1YIOA 2CGPA 2PFBA 3K9TA 3DV8A 3FMSA 3MAJA 2XKPA 3ZP5A 1FBQA 1R7JA 2GZWA 3CDHA 1XGMA 4M9ZA 3L9FA 1XGNA 4EJVA 4WX9A 4M6XA 4G6DA 4HF1A 3VOEA 1OYWA 4PDKA 4MHGA 1DPRA 5L3DA 4BH9A 4ENJA 3I5UA 3FM3A 1XN7A 2P7VB 2DPDA 4BNCA 3FM5A 5DCFA 3H3ZA 4EJTA 3OV8A 3GYHX 1MGTA 2KJCA 3KEQA 2FXAA 1B59A 2Z99A 2A69F 2JRTA 1W7PB 2GQQA 4Q47A 2GAUA 3QPHA 2HEOA 4IPAA 3ZN0A 4GGGA 4G7ZF 4I01A 2AXLA 1LDDA 1T38A 1IRGA 3LAJA 1KGSA 2GA1A 2IVMA 4FHTA 2ZKZA 1O3TA 4G7OF 2HQNA 2BYVE 2A07F 3AAFA 5CVUA 3V8LA 3LQRA 2XGXA 4OIQF 2QUFA 4LK0F 4HLYA 2MC3A 1EH8A 4M72A 4CHUA 1YO5C 2J5OA 1IN4A 1YG2A 4U0WA 4XRFA 2QZ8A 3P9KA 1LDKB 3WU0A 2PBIA 1I5ZA 3R0AA 1ZG3A 1YW9A 2VC0A 4MQVA 3J81K 3SFZA 4OU0A 2E1CA 3REOA 1WRJA 3FWEA 4YFKF 5LLQA 2OA4A 5E1WA 4GXOA 2PQ8A 2HYGD 1USSA 1YS6A 5LRSA 3GW2A 2KJBA 2XVCA 3WTWC 1F9NA 4WXDA 5ED4A 3U9GA 5JFRA 5DYMA 5HDKA 5DD8A 2EA2A 2EV0A 6PAXA 3EQLF 1SFUA 1WKMA 1ZYRF 4P9FA 5BMZA 3ZMSA 5AONA 2FBHA 4WF2A 1T39A 1S29A 3DKWA 5A2QK 4A6EA 2M5WA 3BY6A 2PEXA 3BZ6A 3DP7A 1IXSB 2DLLA 1ZG5A 2VT3A 1ZLJA 3ZQ7A 3RKYA 2GIVA 1O7LA 5DUIA 1RNLA 3JW4A 2DQRA 3DPLC 4A0ZA 3HSEA 1BJAA 4L9VA 4AWXB 2CWEA 1YTYA 2FEZA 4P5OA 1D3YA 5D5VB 4OMZA 4KN7X 4ZZDA 4RB1A 1KA8A 4N0BA 2VBXA 5CVVA 3WU1B 3IHUA 5E18F 2RQPA 2EK5A 1XSXA 3I59B 1LVAA 1X3UA 1BOAA 4I09A 3SQNA 1BI1A 4IJAA 1PUEE 3LA2A 2RKHA 1LJ9A 3CO7C 3F8BA 4OIRF 4EJOA 1FX7A 2JSCA 4U7BA 4CYDA 3GO5A 5DD4A 1I1GA 4L9NA 2DK8A 5FFXA 4HX4A 3KE2A 1ZGJA 1CGPA 1FOKA 1MD0A 3VEPA 2EFNA 3C7JA 2E7XA 5IT9Z 1I1SA 2QQ9A 3CUQC 5BQTA 5JHUA 3FZVA 3PQJA 4NB5A 2M8EA 4OOIA 5J6XA 2W25A 2YX4A 2GA2A 4N9IA 3LAPA 2GWRA 3EYYA 1ON2A 4BHPA 2CG4A 1GVJA 3P9CA 2J5PA 3I53A 4EJUA 3WTXC 1P2FA 1V3FA 5A2QZ 2O8XA 2QBYA 5D5XB 5E17F 4G94A 4RB3C 4MEXF 2A3SA 4H0EA 5LGTA 4CGZA 3BJ6A 3F23A 2B0LA 1BBYA 4Z2YA 4MQ9F 2FU4A 3HSRA 1J2XA 3W6KB 3F72A 1R23A 4B09A 4UVBA 1P4AA 2MA3A 1TQPA 1D5VA 1GHCA 2XAQA 4RGXA 1LNWA 5LGNA 1LEAA 1BI2A 3KCCA 1FLIA 3GFLA 2ETHA 1FP1D 1J59A 2V1DA 3RI4A 3CUQA 4M71A 5DCMB 3NEUA 3ZPLA 1W5TA 1A04A 4UNOA 2D45A 5H6QA 2XKOA 2YX7A 3L2CA 3M7GA 4EM1A 2OD5A 2K4JA 4GYGA 3M8FA 2VOPA 1T2KA 1E2XA 3WG9A 4CZZA 2K7LA 2EWNA 3R6SA 2QYOA 1XGOA 1XSDA 1P6RA 2G9WA 3BJOA 4UV9A 2Q0OA 1RUNA 1IW7F 5J8CA 1IXRC 2DQLA 5LRRA 1DPUA 1Z1DA 4ESFA 4ZYEA 2MLGA 4XSXF 2H27A 4R1HA 5IT3A 2FOKA 5K5RA 2KIUA 2P6SA 1JHHA 1STZA 1VTNC 5LHHA 3R0JA 3G3ZA 4P96A 3ZMVA 1R5GA 2COMA 2HFHA 5LEKA 2RDPA 2Q8KA 4R79A 2LSOA 3TO9A 3M8EA 4HYEA 3BPVA 2H94A 5JVTA 2O6GE 1HSJA 4LB5A 3WTTC 5L3CA 1U6GA 3I4PA 3WTYC 1ZRCA 2ZMEA 2LDUA 1W5SA 1EV7A 1U5TC 4G6QA 2M87A 3F21A 1G3WA 4MNUA 3GLXA 2PJPA 5KK1A 4I7HA 4IHSA 1TNTA 2HQRA 1YW8A 3JSPA 1GXQA 3BP8A 5K1YA 2VN2A 5D5UB 1KYWA 3N97A 4F7ZA 4HLXA 1I6XA 4EVIA 4XBFA 5TRDA 3O3KA 1IN7A 3SZTA 5JI6A 1H9TA 2ZO4A 5BPIA 1SD6A 3ZN1A 2DFIA 3CUOA 5DUKA 4L0ZB 1PP7U 1YW7A 1T0FA 3B02A 1O57A 2DTRA 2W24A 4U0VA 4HX8A 4M9XA 1TLHB 1JGSA 1G3SA 3EETA 1T98A 3MEXA 3BDDA 1JHFA 1RI7A 1G3YA 1R58A 3GEZA 1XGSA 1WWXA 3J80K 1HW2A 3RKXA 1I27A 1JE8A 1IZ1A 1YQAA 3TOAA 4ESBA 4YFNF 3CO6C 5E1ZB 2EFWA 3F6OA 1MJ9A 2IP2A 5LHGA 1XDUA 5LBQA 1TQIA 1J75A 2ESHA 2STTA 2WC2A 1WSUA 4UXNA 4R8HA 3I58A 3RPUA 1BI0A 4YFXF 2HS5A 1HKTA 1ZGAA 2HTSA 1H0MA 2VE9A 1MKMA 4HZFA 4E70A 1FNNA 3SHFA 2EFQA 1XMKA 1ZARA 1R1TA 1BIBA 3FX3A 1YYVA 4KN4X 4AVPA 3V7CA 2UWMA 1ZLKA 2OU2A 3GZ6A 3NRVA 2QWWA 2A6EF 2QM3A 5E1XA 1UCRA 1REPC 5F1RA 5HDNA 4LLNA 3P7NA 4A6DA 2YPRA 5JR3A 2LF7A 3QU6A 2M30A 2A61A 1Q1HA 2HGCA 2XROA 3S2WA 1OMIA 3T1BA 4M6YA 5DDGA 3MQ0A 1JXSA 4HV5A 1R22A 2L54A 1G4DA 1TW3A 5FFZA 2VBYA 5FLXZ 2KKOA 2K4BA 3IL2A 3KP4A 2A68F 2LF8A 4HAMA 1SMTA 2WV0A 3ELKA 3L00A 3E6CC 2LKPA 4HDVA 3VODA 4UVAA 2L4MA 5LGUA 3LA7A 1P4WA 4RGUA 1B9MA 1XCVA 3FF5A 1B4AA 1R1UA 1Z9CA 3K2ZA 4PCQA 1K78B 3QPTA 1IN8A 2BGCA 1U5TA 4GO1A 3V4GA 3QU3A 3E6BA 3GF2A 1RUOA 4EQQA 2HKXA 1XB4A 4IRHA 4LG0B 4KYWA 2Y0MA 2ZFWA 3RTRA 1MJBA 1IN5A 1KU3A 2JPCA 3C3WA 3HRTA 2VE8A 2HOEA 1ZAOA 2QQAA 1G6NA 4KIGA 1TNSA 2JTVA 5EEHA 4I02A 4KIBA 2L3DA 1QPMA 3WGIA 1FPQA 2VODA 3U1DA 1F5TA 2IPQX 5ILSA 1UFMA 4MTEA 1K78A 2UXNA 1FT9A 1R1VA 3NQOA 1O3SA 1F1ZA 1HW1A 3F6VA 3SZPA 4IXAA 2CFXA 1SD7A 1O3QA 5E8IA 1R00A 4K2EA 2ACJA 4M73A 2ZCWA 3GFJA 1TQMA 1SMYF 2D1VA 4MGRA 3FXRA 4AIKA 2Y48A 3RYPA 1KQ8A 1U2WA 2BV6A 2HR3A 4KFCA 4DNCA 4ZYDA 4CDGA 1FY7A 5CVRA 2PN6A 4ENNA 4BQAA 5H6RA 5ICGA 1KU9A 1S6LA 4HW0A 2ZJ2A 4PZJA 3WTSC 4BHBA 1Z7UA 3GX4X 3ROUA 1YFHA 2L02A 5CJ9A 2RN7A 1Y0UA 4PGGA 1FC3A 4LD5A 1O3RA 2V79A 1WQ2A 1SD4A 4XLPF 4IRIA 2BEOA 3E5XA 3TQNA 3DPTA 4HV6A 1MZBA 2OZ6A 4EJWA 5HLHA 3JSOA 1XD7A 5ILUA 4A5NA 3MCZA 3V8JA 2XHKA 3O6BB 4ZYHA 2H6CA 4O3MA 3HRUA 3KEOA 3HRSA 3H3UA 1ODDA 3DEUA 3DF8A 3K69A 3CLOA 2EJRA 3PQKA 1EH6A 1B9NA 2IA2A 2P4WA 5H20A 4G8XA 5DV5A 2LNBA 3V7SA 4RAYA 3L7WA 2CO5A 4LGWA 1MDMB 2F5DA 3B73A 2R3SA 1XDSA 1W7PA 3LWFA 2HDCA 3ERED 2QLZA 2KIMA 1BC8C 5D4RA 1OR7A 3KLNA 2XV4S 3QRFF 4JK1X 1RZ4A 5E8GA 2FNAA 1UHMA 3E3VA 5ICEA 4KICA 2NNYA 3HTUA 3VFZA 1WI9A 1V4RA 4L0YB 2XRNA 3MZHA 2TDXA 4ZH4F 1KQ0A 1IAWA 4L9TA 1IUYA 4HF0A 3RPQA 1D8JA 4HOBA 3F8FA 4KIFA 2VC1A 3I71A 4BYYA 1K7AA 3F8CA 4YG2F 1XSVA 3T5XA 1R5HA 4JBAA 2DO7A 3P9IA 2P8TA 4WWCA 1DDNA 4UHTA 4ETSA 2EFPA 4U0YA 2V9VA 1ZREA 1B1BA 2DAOA 4RGSA 3N4MA 3C18A 2E7WA 1ZN2A 2V1XA 4AIJA 2FRHA 3HHGA 3BJAA 4HQMA 2XAGA 5FGMA 3PFIA 2Z33A 1FYLA 2PLYA 1ZRDA 2EFOA 2XASA 4CO8A 4Y13A 4Q4ZF 3E6DA 2HTJA 4LK1F 1HSTA 4P55A 2OQGA 2VBWA 3ULQB 3OOPA 4LLGF 1KYZA 3JAMK 4OMYA 2VOOA 2FQ3A 2DT5A 3F3XA 3WTVC 3H92A 1E17A 1YS7A 1AWCA 3LA3A 5BPDA 3R61A 3KFWX 1SFEA 4XSZF 3ML6A 4A2UA 1P92A 3TO6A 1KU2A 3JTHA 2FSWA 2V1UA 4HDUA 3WE3A 3GUDA 2XIGA 4HQEA 4LFUA 4A0YA 1B6AA 1ONVA 1ZHFA 2FF4A 3K0LA 5LHIA 1BI3A 1BN5A 3LSTA 3O2PE 4RGRA 4I98B 2VBZA 3GFMA 3JTGA 1R36A 1D8KA 5BOXA 2HKOA 3BOQA 3WTZA 5AIQA 4NHJA 5F64A 1LDJA 1Z6TA 2RC4A 4G7HF 2KIFA 1HW5A 1HKQA 3HTSB 5CVJA 1UHWA 4IF4A 2NNNA 4S05A 1BM9A 2ADUA 2EV6A 3K1PA 1W7PD 3CJNA 4KUMA 4WCGA 3IC7A 1FYKA 2A6HF 4EM0B 3KLOA 4IVNA 2Z9OA 2K27A 1HXDA 4ENKA 4N9HA 4DQ2A 3WE2A 2EB7A 4EGZA 1YLFA 1FBUA 4Q48A 4O6JA 1IXCA 3T8TA 2YR2A 3RYRA 3HYIA 4HF2A 4UUVA 2PMHA 4AIHA 5ILVA 3DXJF 3L09A 3IKTA 1HKSA 3F8MA 4L9JA 4A5MA 2NS0A 1KQ9A 3QAHA 2NYXA 2HZTA 1S7OA 1ZG1A 5E20A 1OYIA 2IA1A 2Z3YA 3LQQA 2WWYA 2CSOA 4O5VA 3MZYA 2GXBA 2V6CA 5HVQC 2CYYA 2O61A 3RIRA 1F4KA 3U2RA 2AS5F 5L3BA 5K5OA 2G7UA 4RB0A 1SD5A 1Z05A 2FMYA 2F5CA 2GXGA 2Y75A 5D5WB 2H6BA 3BPXA 1L0OC 1Z6RA 1QZZA 2O0YA 4RAZA 4U88A 4YIIA 5L3FA 2M45A 1J7KA 5FO5A 4LMYA 4IHTA 3MWMA 3Q5FA 1MDMA 3M1EA 1IF1A 4KMFA 2WTEA 3WGHA 3ISPA 2EV5A 3FXUA 3TGNA 4M74A 4EM2A 2F5EA 2P7CB 2CQKA 4Q5SF 1EH7A