4ZYHA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119l variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
148
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPLHRVIAENGIGGYSRGVKLKRALLELEGVKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
total genus 44
structure length 148
sequence length 148
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyhA01
5K5QA 3KP4A 2A6HF 2QENA 2PJPA 1BBYA 4A6DA 3HSRA 3M9AA 3KZYA 1SD4A 5KVRA 3PQKA 1R23A 5F64A 3W6JB 4KIFA 1JHFA 4KN7X 4HA8A 2G9WA 2XHKA 5TRDA 5FFZA 4U7DA 4KDPA 5F1RA 1V3FA 1I27A 2EB7A 2O3FA 1ULYA 4CO8A 5A2QZ 3C3WA 4UHTA 2ZNZA 4I7HA 3GZ6A 4XRFA 4XSZF 3F8NA 2F5FA 4BQAA 2E1NA 4CDGA 5CVVA 4XBFA 1KQ9A 2DPUA 2LSOA 1T0FA 4EM0B 4YFNF 2AXLA 4DNCA 1B6AA 4FX0A 2H6CA 4UVCA 3P9IA 1Z9CA 1P2FA 1R00A 2KJCA 4R1HA 1WQ2A 4G7ZF 4EGYA 5D8LB 2LDUA 3HIFA 2XROA 2FXAA 2Y48A 5E17F 1IXRC 4EVIA 3J80Z 2ISZA 2BGCA 3ZMTA 1DP7P 1WWXA 3HSFA 4HF0A 1SD6A 4IRIA 3L7WA 5JVTA 3HOTA 2DQLA 3QRFF 3DFGA 2K86A 2D45A 1U78A 1FNNA 2FE3A 3C1DA 3EQLF 2W57A 1XGOA 1HSTA 1KU2A 1XMAA 3GW2A 3ZMVA 1HKQA 4KNYA 1CF7B 4EJOA 1B4AA 3EYIA 2RDPA 5HVQC 2EA4A 1G4DA 1D3YA 2JRTA 4R8HA 5IT9Z 5BMZA 1QNTA 3HSEA 2YPRA 4WXHA 4BNCA 4RB0A 4L9VA 5J6XA 2OBPA 4KMUX 4ZH4F 2QBYB 2A61A 1L0OC 3R0JA 2VC0A 4LLGF 3KLNA 1J2XA 1USTA 1AWCA 4A0ZA 1FSHA 4UVAA 3R0AA 1TW3A 3QPTA 1V4RA 2O0YA 3B73A 2LF7A 4FX4A 2CGPA 5JHUA 2OA4A 2FBHA 2CFXA 3LQRA 3R6SA 5LEKA 1D5VA 4OIRF 5BQTA 2D2WA 2ACJA 5ERIA 4AVPA 2M1BA 5K5OA 3ISPA 1YW7A 3COAC 4G7HF 2C6YA 5D6EA 4M9SA 2NNYA 4HX4A 3FZVA 2YX7A 3ZMZA 2J5OA 4YIIA 3I59A 2E1CA 3BPVA 3QPHA 1FC3A 4Q47A 2VBZA 4WX9A 3I71A 5HDNA 4ENJA 4O6JA 3AAFA 1HBXG 3F3XA 2H09A 5CLSA 2IRFG 3LA3A 3I5UA 3BY6A 2QBYA 3K0LA 2XUBA 4HOBA 4YFKF 3E5XA 2VE9A 4LG0A 2EFPA 3M8EA 4RGSA 3LAPA 4Q5SF 3IWZA 2JT1A 3KP5A 4RB2C 1K6OA 2LF8A 4A6EA 5LRSA 4Q48A 1IXCA 4HAMA 4N9IA 3C18A 4K2EA 1RUOA 2W24A 2GZWA 3CUOA 3KLOA 3QOPA 2IT0A 5H6QA 1W4MA 1ONVA 4PGHA 3E6BA 4AIKA 3KZZA 3TO6A 5ICCA 3GXOA 2L02A 1FPQA 4I09A 2JSCA 4RS8A 1BI3A 4XLNF 1MKMA 4BAYA 3CO6C 3DXJF 1TBXA 4HBLA 1O57A 3IRQA 1HW5A 2CYYA 2HS5A 2QQ9A 4GO1A 4MHGA 4IRGA 1TQMA 2PMUA 4EV0A 4Z2YA 4D0PA 2DK5A 5JI6A 2CO5A 1MDMB 4WK8F 2GA2A 1FYLA 2OQRA 4I0BA 3MCZA 1HKSA 4ESFA 1SMTA 1SD5A 2ELHA 1U5TC 2XKPA 2VT3A 1I1GA 1B9NA 1S3JA 5JFRA 1LDDA 3H3ZA 4IF4A 1B9MA 3EDPA 3U9GA 1TNSA 2ZMEA 3ELKA 2OU2A 1REPC 1U2WA 2W84A 1R58A 2WTEA 4CHUA 4WXCA 3I54A 4I01A 2ZKZA 1STZA 3I0TA 1I5ZA 4U0YA 2PBIA 1Q1HA 4RGRA 1EV7A 3LFKA 2CW0F 5F6FA 1LNWA 3F8MA 2O8XA 2ZMEB 3TO7A 3DP7A 4Y15A 2R7FA 3K1NA 3RTRA 2AS5F 1E17A 2R7DA 2Y75A 3I53A 3TDZC 4L0YB 1FWZA 3BROA 1IN7A 4G8XA 1T98A 1SFXA 3D0SA 3T8TA 3E5QA 2HKOA 4N9HA 3O3KA 1LDJA 1KQ8A 1TQIA 5E1ZB 4P9UA 3IRRA 2ESNA 2HQRA 2YX4A 1ZLKA 1SMYF 2WC2A 2ADUA 1J5YA 4U0VA 5J8CA 3J81K 5DCMB 3BPXA 3N97A 1UB9A 3IWFA 5ED4A 5L3GA 2HOEA 1FT9A 4OMYA 2HTJA 1QGPA 2EJRA 3WTXC 3OV8A 2PI0A 1PP8F 3ZMDA 2PFBA 5BOXA 4WWCA 3ABUA 2CSOA 4LG0B 5H20A 2A6EF 1LEAA 1IN5A 2JPCA 1P4AA 1ZRFA 2UXXA 5JR3A 3W6KB 5HLHA 2DTRA 5D8KB 1FYKA 1GHCA 2CWEA 1JHHA 1USSA 1O7FA 3WGHA 3FM3A 3ML6A 4L9NA 4P55A 2FBKA 2LNBA 4GXOA 4L9TA 3LA7A 3KP6A 3JW4A 4U88A 4M6YA 3VFZA 1ZRCA 4L9JA 1OYWA 1S8NA 3U2RA 4LK0F 4OINF 4XSXF 3JTGA 1E2XA 1IRFA 4N0BA 2IVMA 3QU3A 3WTSC 3BJ6A 5DCMA 1I6XA 1YLFA 3K1PA 4CYDA 1FX7A 1U3EM 4G6DA 1BC8C 2YU3A 4IXAA 2EV5A 2QM3A 1TLHB 2PEXA 2IJLA 3JAMZ 3WU1B 2ISYA 5K1YA 3ZMUA 2EFNA 4LGWA 2FMYA 4EJWA 2G7HA 2YR2A 3V7SA 2PN6A 3JSPA 4MGRA 2PQ8A 1LJ9A 1H9TA 2X4HA 2Q8KA 3C7JA 2QLZA 3FF5A 4P5OA 2NAZA 3RIRA 5HDKA 3WTYC 4IRHA 1CGPA 2EFQA 3V7RA 4PGGA 3QAHA 4M9ZA 2W25A 1S6LA 4ESBA 1S7OA 4PCQA 1RIOH 4RGUA 3I64A 4A0YA 5L3FA 2QZ8A 3E5UA 2M30A 4OIOF 1IF1A 2GXGA 1PUEE 1BM9A 1T39A 5FGMA 5HDGA 1H9GA 1XGNA 2NRAC 4OIQF 4YIFA 1TNTA 1ZLJA 2FNPA 2COMA 2V1UA 3V7CA 1F5TA 3WGGA 3DQVC 1FBSA 1FP1D 4QLCU 4FHTA 4P9FA 3GVAA 2JTVA 1W7PD 2F5DA 4KN4X 4UV9A 3CJNA 2DBBA 2Z3YA 4UUVA 1FOKA 3R60A 3D5LA 2R3SA 4RAZA 1R5GA 3NEUA 2HGCA 5IT3A 1PDNC 4G7OF 2Z9OA 1DDNA 1KYZA 5LGTA 3WTTC 5D5VB 4HQMA 2UWMA 1DUXC 4ENMA 1YS6A 5FD6A 4BHBA 4KICA 1Z05A 3RPUA 4RB3C 2FF4A 4IHTA 1ZRDA 2EV6A 5LGNA 3HRUA 2BV6A 1DPUA 2QQBA 2IP2A 3TQNA 2P6SA 4NB5A 2OAZA 1VTNC 4L18B 4UNOA 3WU0A 1HW2A 4WXDA 3O2PE 3RPQA 3Q5FA 2E7XA 1KGSA 3KCCA 3ZPLA 2KIMA 4GCVA 4EJVA 1ZHFA 1D8KA 4Y13A 1S7AA 5LHHA 3MWMA 2PLYA 1T6SA 1J75A 1IN6A 3GYHX 2MD5A 1LVAA 5HLIA 2KRFA 5KK1A 2V6CA 2XAFA 2VC1A 2O61A 3L2CA 3HTUA 2E7WA 4P96A 3L9FA 3IL2A 5LRRA 2IA1A 3SZTA 5FLXK 3HOSA 1YW9A 2RQPA 4OU0A 4ETSA 5LHIA 2GXBA 3K9TA 4HLYA 4ZZDA 3HYIA 4KFCA 2ETHA 5D4SA 1YW8A 3BWGA 1FY7A 1I1SA 1WI9A 2EV0A 3CO7C 2VONA 4OMZA 2OD5A 3BDDA 3HRSA 2XV4S 3MEXA 5CVJA 1IXSB 3VB2A 2EFOA 1G3SA 4AWXB 5E1WA 4HLXA 3M7GA 2XGXA 4L0ZB 1RI7A 1BC7C 2IPQX 4MQVA 1GXPA 3K69A 1F1ZA 1LQ1A 1OYIA 4LB6B 1Z7UA 2H27A 1XGMA 3SHFA 4BHCA 2QWWA 2MLGA 5E8GA 2BE5F 5TJJA 3BJAA 4CICA 4MTDA 3TDUC 3EYYA 3VEPA 1LDKB 2KKOA 5DUKA 1ZARA 2FMLA 3F72A 1EH7A 4MQ9F 3HHHA 1MJAA 4DQ2A 2STWA 3ROUA 1FYMA 2UZKA 1W7PB 1GXQA 2DAOA 1K7AA 3BJOA 1FSEA 1FBQA 1YIOA 3HRMA 1BI0A 3RKYA 1G3WA 3WE3A 3IC7A 2B0LA 3QU6A 2RV8A 3WTVC 1HSJA 3M1EA 3ZN1A 1AOYA 4EJUA 4LLNA 2QQAA 2P8TA 1XSXA 3P9CA 3ABTA 5CYVA 4LJZF 1HQCA 4HX8A 2H6BA 2VODA 3DF8A 4HW0A 3L00A 4GYGA 1FP2A 1KYWA 1BOAA 1DPRA 2GA1A 2XAGA 4UV8A 3T1BA 4HYEA 5DV5A 4RAYA 1XB4A 1R1VA 1FLIA 3H3UA 3OOPA 5DUIA 1K78B 1MZBA 3ERED 4ZZLA 1O3QA 2PG4A 2VBYA 3I59B 3MAJA 2ZCWA 3E3VA 1IAWA 4JQFA 1SFEA 2P7VB 4EGZA 2JZYA 2HQNA 2FNAA 4MEXF 2HEOA 1YQAA 3RKWA 1JXSA 1ZAOA 3BZ6A 1MDMA 1FBUA 2MC3A 4RB1A 1R5HA 4M71A 1P6RA 2FRHA 3K1MA 3KP7A 3R61A 1YYVA 1KQ0A 1XD7A 1CF7A 4YG2F 1U5TB 5CVUA 1IRGA 1RZ4A 2DW4A 2HZTA 2HTSA 1OKRA 4LLLA 4EQQA 4IJAA 4ZYDA 1BIBA 2J5PA 3CUQB 3CTAA 5E20A 4UXNA 3GF2A 4AIJA 2EWNA 1U8RA 3WTWC 4U7BA 3GFJA 4M72A 1QZYA 2FBIA 3IKVA 3FMRA 3NQOA 4EM2A 3GUDA 5E8IA 2RVCA 1W5SA 2MH2A 5EEHA 2IA0A 5D5UB 3ZQ7A 2RKHA 2DLLA 4E70A 1SD7A 2XAJA 1O7LA 2DT5A 3J80K 1ZGJA 3E6MA 1G6NA 1C0WA 2STTA 1HW1A 1MD0A 2DI3A 5E18F 2Z5UA 3HHGA 2QYOA 2ZJ2A 1IZ1A 5FFXA 4IPAA 3J81Z 5FO5A 4NQWA 1XN7A 2DK8A 4KUMA 4R79A 2GQQA 3NRVA 4I98B 3CUQA 5L3BA 4HDVA 3VOEA 5HS8A 4ESJA 3GFMA 2P5KA 4MEYF 4M73A 2CG4A 5CVRA 1P92A 5L3DA 3F8BA 2WWYA 3GFLA 1SAXA 1ODDA 2MH9A 4KYWA 2EFWA 1G3YA 3REOA 3DV8A 3GEZA 1U6GA 4XLPF 4ON0A 1OMIA 1ZREA 3PQJA 3KP3A 1TQPA 2FU4A 2EK5A 3FXQA 2K4JA 4BHPA 2HDCA 4GYIA 2P5LC 3FX3A 2XVCA 3EUHA 3RKXA 2ZO4A 3FMQA 1ZG1A 1QBJA 2RC4A 4HF1A 5IT9K 3SZPA 3LAJA 2K4BA 2P6TA 2M87A 3DEUA 1J7KA 5LEJA 4M9XA 5CVIA 4OOIA 2KIUA 3WG9A 3FXRA 5L3EA 4WF2A 2VN2A 2P5VA 3SFZA 4A5NA 1HXDA 1R7JA 3LQQA 1RUNA 2Z99A 1HKTA 2HR3A 5LHGA 3ECHA 2RNJA 1O3TA 4AD9A 2YSRA 3FWEA 4F7ZA 4CXFA 3KETA 1EH6A 3RJPA 3Q9SA 2IA2A 4RGXA 1YS7A 3RI4A 3GZ5A 3P7NA 3TKYA 3LA2A 1ZG5A 5ICGA 2DPDA 4KMFA 4LD5A 4EJTA 3ZP5A 1BN5A 5J8FA 3E6DA 2L4MA 3J7AO 2P4WA 3RYPA 5BPIA 5A2QK 3S2WA 5AIQA 2VT2A 2ZBKA 3MFKA 2V79A 1EH8A 2OQGA 1Z6RA 4HV5A 1MJ9A 2O03A 3L09A 2RGVA 4H0EA 5L3CA 2L3DA 2M5WA 3QP5A 2ZXJA 3DKWA 1LEBA 1Z1DA 5DD8A 5DDGA 1ON1A 2JPBA 2FQ3A 3TGNA 4UVBA 3F8FA 4ENNA 1ZN2A 4FT8A 5H6RA 4G9YA 4KIBA 5LBQA 1J9IA 2FOKA 3WGIA 1WKMA 4AIHA 5LGUA 3CLOA 3V8KA 4EM1A 2OZUA 4LMYA 4O5VA 4GGGA 1A04A 2XIGA 2DQRA 3FMSA 2O6GE 1OPCA 1XCBA 1YFHA 2OZ6A 3I4PA 4PDKA 3ZMSA 1QO0D 3GO5A 3LWFA 3QP6A 5EEGA 2XKOA 3MZHA 2GIVA 2CQKA 3FM5A 4HQEA 3T5XA 3H92A 2Q2EA 1O3RA 1WRJA 3KE2A 3JAMK 4O3MA 1P4WA 2WV0A 2VE8A 2MLKA 1F4KA 3ECOA 4M6XA 4U0WA 4YFXF 1UHMA 2DO7A 3E6CC 1GVJA 2HFHA 3R4KA 5DEQA 4L5IA 1K78A 5HS9A 1TW2A 1XSDA 4ZYEA 1Y0UA 2DFIA 2G7UA 5DD4A 2QUFA 1RNLA 2HYGD 4BXUA 1QZZA 4QWQA 4G6QA 2A5YB 2V1DA 5FB2A 2M8EA 2MBFA 2EA2A 3V4GA 1FZPB 3IKTA 2GWRA 4B09A 1B59A 1F9NA 1ON2A 1XDUA 5DCFA 3WE2A 1QPMA 3KP2A 1G3TA 4LK1F 3KEOA 2VOOA 3MQ0A 5FD5A 1R36A 2NNNA 4Y17A 3G73A 1IW7F 3BP8A 1H0MA 3ZN0A 2Z33A 5E1XA 2V1XA 4KA4A 2K7LA 2RN7A 1XDSA 4BH9A 4A0XA 2NYXA 3I58A 5AIPA 3V8JA 3DPTA 3RYRA 4I02A 2FEZA 5ILUA 5K5RA 1IN8A 3CUQC 2GAUA 2PMHA 4JK1X 4Q4ZF 3F6VA 2A69F 1L3LA 5BPDA 4OIPF 3O6BB 1NHAA 3ULQB 4CZZA 3EETA 4HZFA 3SXYA 3T8RA 3HTSB 1OR7A 2A68F 3GX4X 3TOAA 2A07F 4KIGA 2XAQA 3TO9A 2ZNYA 2D1HA 1O3SA 3KFWX 1JGSA 3JSOA 1ZYRF 4HV6A 1WSUA 1U5TA 4ENKA 2X0LA 2BYVE 4TV7A 4ZYHA 4IVNA 1BI1A 3G3ZA 3WODF 1S29A 4HX7A 3T0YA 5AONA 3SQNA 3FXUA 4EMSA 1TTYA 1W5TA 5ILSA 1K79A 4CGZA 1JE8A 3Q9VA 1BJAA 1LB2A 1B1BA 4G94A 5D5XB 5D6FA 3FHZA 1UFMA 3IHUA 2L01A 1YTYA 4ZYGA 4M74A 1Z91A 3F8CA 4KT5C 5BS6A 2M45A 2P7CB 3P9KA 2FSWA 2MA3A 1W7PA 5HOOA 2QVOA 5D4RA 1QQIA 4S04A 3WTZA 5ICFA 2ESHA 3GFIA 1ZH5A 3JTHA 4S05A 1KA8A 1UHWA 4JBAA 2A3SA 2W85A 3U1DA 2H94A 1X3UA 2HYFA 5ICEA 3F21A 3DPLC 2VXZA 2TDXA 1YO5C 2NS0A 3BOQA 5CJ9A 4PZJA 1KU3A 2K02A 3E97A 2HWVA 2UXNA 2KIFA 3F6OA 1J59A 1P4XA 4I2OA 1KU9A 1R1UA 1PP7U 1J0RA 3CDHA 1SFUA 2VBWA 4MTEA 6PAXA 4LFUA 4B8XA 3MZYA 3F23A 2HKXA 1ZGAA 3N4MA 1OYYA 1XCVA 2XRNA 1R1TA 5ILVA 1D8JA 1Z6TA 2Y0MA 2BEOA 3HUGA 1UCRA 1XGSA 3V8LA 2LKPA 2L4AA 5HS7A 4HF2A 1KU7A 2DU9A 5HLGA 5LLQA 1T2KA 4ASNA 3VODA 2KJBA 1XMKA 4NHJA 2F5EA 4A12A 4A5MA 2ZFWA 3K2ZA 3TOBA 3WTUC 1XSVA 1MGTA 4BYYA 2L54A 2K27A 4WCGA 3GLXA 3GWZA 2VOPA 4L5JA 3B02A 1R22A 1BIAA 3HRTA 1IN4A 2V9VA 2Q0OA 3F22A 3PFIA 5FLXZ 1IUYA 2D1VA 1ZG3A 1T38A 4A2UA 2BBYA 3KEQA 1BI2A 1MJBA 3LSTA 5D5WB 4LB5A 2IW5A 4MNUA 4HDUA 2XASA 2XAHA 3M8FA 1YG2A 2FA5A 5DYMA 4I0AA 4IHSA 2F5CA 2VBXA 3RDIA 2F2EA
chains in the Genus database with same CATH superfamily
5K5QA 2DA7A 2LK2A 2JXPA 3KP4A 2A6HF 2QENA 2QKMB 2JVHA 3H36A 2PJPA 1BBYA 3FBNB 2KMUA 4A6DA 1NH3A 2DODA 3HSRA 3M9AA 3KZYA 1ETWA 2XC7A 1JK1A 2R5YB 1SD4A 2JP9A 4DV5E 5KVRA 2LOOA 2NOGA 4BJ5C 3PQKA 1R23A 1XPXA 5F64A 5E79C 3W6JB 2QEXI 2EM2A 4KIFA 1PJRA 1JHFA 2BOLA 3A02A 1AA7A 4KN7X 1XMXA 1ERDA 3MKLA 3CD6I 2KPMA 2EMZA 4WSGA 3PUFA 4HA8A 2IGNA 5EF6A 3RSNA 2G9WA 1IO2A 2XHKA 5TRDA 5FFZA 4DV1E 4U7DA 4AC0A 1JKQC 4KDPA 5F1RA 1A36A 1V3FA 2EPRA 4LITA 1I27A 4FQGA 1FOXA 2EB7A 2OV7A 4RDUA 2TCTA 2XAUA 1AHDP 4IHSA 2O3FA 1ULYA 4NC6A 4CO8A 3OYMA 2K9MA 2EL4A 2KQRA 3C2BA 2EE8A 3BR5A 5A2QZ 3C3WA 5GTIC 4UHTA 2ELJA 2ZNZA 3BTIA 4I7HA 4XQFA 2LRSA 3GZ6A 4XRFA 4XSZF 3F8NA 2F5FA 4BQAA 3OS2A 2E1NA 3B6AA 3K7AJ 5LD2C 2JMWA 2QA4I 4CDGA 4F93B 5IP7J 5CVVA 4XBFA 5KAIC 1KQ9A 2DPUA 2LSOA 1T0FA 2XRLA 4EM0B 2IS4A 4YFNF 2FOWA 3HOUJ 2WB1N 4IHWA 1RC9A 2AXLA 3JRCA 3FXMA 2EPCA 4DNCA 2EMLA 2LUPB 4B48A 2EOYA 4LF5E 1B6AA 4FX0A 4DZPA 2H6CA 2Y31A 3L2WA 2BHYA 2MSYA 1JUMA 4UVCA 3P9IA 2ZJPF 1P2FA 3HKZA 1P9QC 4DOZA 1Z9CA 4M9VC 1R00A 2KJCA 3BG3A 4R1HA 1HLVA 1WQ2A 2ODRC 1A35A 1S5LC 2BBGA 4G7ZF 3CESA 2EZLA 4EGYA 4DBRA 2H8WA 3E7LA 5D8LB 2LDUA 1ZR4A 5EGOA 2L2MA 3HIFA 3CCYA 2XROA 1JTXA 3CC2I 2FXAA 4YY3E 2Y48A 4PUSA 1Y8RB 5E17F 3DTKA 3KIOA 2MDRA 1IXRC 1VQ6I 4EVIA 3J80Z 2LMDA 1N77A 3TL4X 3OR2C 2ISZA 2CQ7A 5F27A 4YIRX 3OYIA 2BGCA 1Z67A 3ZMTA 1ZU1A 2V85A 1DP7P 5KL4A 1Z1BA 2ECBA 4UUSB 1WWXA 3HSFA 2ADRA 1KJKA 2RS7A 4HF0A 5F04A 3HM5A 4A3KJ 2HGHA 1SD6A 4IRIA 3L7WA 2R7TA 4F6MA 5JVTA 1D0ZA 3HOTA 4W1UA 4PSXA 2DQLA 3QRFF 2O9LA 3A01B 3DFGA 4R2SA 3ZQFA 3DCFA 3QWLA 4PJLA 1TWFJ 3VWBA 2K86A 4FTHA 2D45A 1OJLA 3G1LA 1U78A 1FNNA 2FE3A 3C1DA 3EQLF 2W57A 5M5WJ 1XGOA 2KIQA 1HSTA 5AE3A 1KU2A 1MMGA 4DR5E 4PSWA 3PO3J 1XMAA 3GW2A 3ZMVA 1HKQA 4KNYA 1CF7B 5JLWA 1STUA 2GBYA 4EJOA 1B4AA 3LSIA 3G71I 3EYIA 4RMNA 2CV0A 1A1HA 2B7EA 2RDPA 5HVQC 2EA4A 3EUAA 3WU2C 1IC8A 1G4DA 1D3YA 2JRTA 4R8HA 2V9KA 5IT9Z 5BMZA 1QNTA 3HSEA 2YTEA 2YPRA 4WXHA 1T4LB 2EQ3A 2MG4A 4BNCA 4RB0A 2IAIA 4L9VA 5J6XA 4BE2A 1JKRC 2R92J 2JWOA 5KL3A 2NABA 1B69A 1Q1VA 2XDVA 2OBPA 3QYEA 4KMUX 2EPUA 1DP3A 4CCOA 4ZH4F 2QBYB 2A61A 1L0OC 3R0JA 4ZYAA 4IKFA 2VC0A 4LLGF 2X1CA 3QPLA 3KLNA 3PNYA 4NXME 1F2IG 1J2XA 1USTA 2L7KA 3UR3C 3BTLA 4A0ZA 1AWCA 1FSHA 3T1YE 4UVAA 1SAUA 4BS9A 1BR1A 2DN0A 1SVLA 3R0AA 2FV4B 3VSLA 4IQ4A 3ADIA 1TW3A 3QPTA 1JJ8C 1V4RA 1Z0XA 2O0YA 3B73A 2HPMA 3MHSC 2FJ1A 2W00A 1B8IB 1DU0A 2LF7A 1NTCA 4FX4A 2CGPA 5JHUA 2BZTA 2OA4A 2FBHA 2CPNA 2CFXA 5EEAA 1RR7A 1POGA 3QG5C 4X9JA 2X6XA 2AO9A 3LQRA 3R6SA 1SANA 2JQ7A 5LEKA 1SVMA 2EMWA 2LH9A 1D5VA 1DGWY 4OIRF 5BQTA 4O5GA 4EEFG 2D2WA 2ACJA 3BT9A 5ERIA 4JI6E 1X5WA 4AVPA 2M1BA 5K5OA 3ISPA 1V55H 2EOJA 3CCQI 1YW7A 1OCZH 3COAC 4G7HF 2C6YA 2YTJA 1XNQE 2E2IJ 4NNJA 3OYDA 5ADZA 4XIDA 3ZOQB 2GOMA 5D6EA 1SEUA 1VQ9I 3D5RC 4RLFA 4L5NC 2M0CA 1IQSA 4M9SA 2L0KA 4C2MJ 4D5FA 2NNYA 4X65E 3BG5A 4HX4A 1R6RA 2LY2A 3FZVA 4BEHB 1WH5A 3HOVJ 4B3XA 4OWRB 4Z6YA 2YX7A 3S16J 3ZMZA 1TF3A 4RAFA 2J5OA 4V2GA 4V19K 3EUHC 4YIIA 3BG7A 4E4HA 3OY9A 3I59A 3OMYA 1GUUA 2DA6A 2E1CA 2ZFUA 1YIJI 3H0GJ 1B72A 3BPVA 3QPHA 1FC3A 1XMOE 4Q47A 4HEIA 1UELB 3DEEA 4DV7E 2VBZA 4WX9A 3W2AA 1IMUA 1MSEC 3I71A 1ZBTA 5HDNA 4ENJA 4O6JA 3AAFA 1HBXG 3F3XA 2H09A 5CLSA 2IRFG 3LA3A 3I5UA 2HJJA 3S93A 3BY6A 2DMPA 2UUZA 3GCMA 2QBYA 3K0LA 5C44J 2XPVA 2XUBA 4HPQA 2W7NA 4HOBA 3QYFA 4YFKF 3E5XA 2VE9A 4LG0A 2X51A 2EFPA 2L7MP 3M8EA 2CUFA 4RGSA 3LAPA 2R7RA 4Q5SF 2OTJI 2LKSA 3IWZA 1YYOA 4LF9E 2JT1A 2EMAA 2MD0A 3KP5A 4RB2C 4BUPA 1K6OA 1AKHA 4F91B 2LF8A 4A6EA 2ELYA 2RSIA 5LRSA 2KFDA 3KYLA 4Q48A 1IXCA 3DKYA 4HAMA 4N9IA 3C18A 2WADA 1UG0A 4K2EA 3BR6A 2DXIA 1RUOA 4M0VA 5DM7F 1RPWA 5A6JA 1ZBQA 1MBKA 1IRXA 1V5FA 2W24A 2GZWA 3CUOA 3KLOA 4FCYA 4I8OA 4L8NA 2Y0SN 3QOPA 2IT0A 5H6QA 2RTXA 1W4MA 3BG9A 1ONVA 1VZ0A 3DTEA 4M6VA 4PGHA 3V42A 1YE9A 3E6BA 4AIKA 2YZTA 3KZZA 3TO6A 5ICCA 3ASOH 5FROA 3GXOA 2M34A 1T0FC 2L02A 3B6CA 4X0GA 1FPQA 4I09A 1VI0A 2JSCA 4X66E 1MIJA 4RS8A 3FXOA 3K4KA 3H3VK 1P7JA 2VJIA 1BI3A 1UAAA 1B72B 3AFHA 4XLNF 3RQ4A 1T8IA 3HBLA 1MKMA 4BAYA 2YTGA 3PIOF 3CO6C 3NAUA 5AC4A 3DXJF 1TBXA 3LSHA 1LE8B 3I4MJ 3H9JA 4HBLA 2WAFA 1O57A 3IRQA 2COBA 2E34A 1HW5A 2CYYA 2VJJA 2HS5A 2QQ9A 1ZR2A 1YUJA 4GO1A 4MHGA 4IRGA 2Y69H 4J8ZA 4CCKA 2IBDA 1TQMA 4BQNA 3HOYJ 4JX5A 3H9QA 2PMUA 4EV0A 4Z2YA 4J01A 2PMZN 3IAM2 4E7IA 4D0PA 2DK5A 2I10A 1S72I 4CSWA 2HU9A 5JI6A 3CMEI 1LE8A 3SEZA 2CO5A 4LTYA 1MDMB 4WK8F 2KDZA 2GA2A 1KZHA 2LJUA 2EOQA 2QQ8A 1FYLA 2OQRA 4I0BA 2ELKA 3VHTB 3K6GA 2B7VA 2YTDA 1YSAC 3MCZA 1HKSA 4ESFA 1SMTA 1SD5A 2ELHA 1U5TC 2XKPA 2VT3A 3ZQLA 1WJDA 2HPIA 1I1GA 4R2AA 5J3LA 2EPPA 1B9NA 1S3JA 5A6BA 5JFRA 1LDDA 3G1OA 4DIQA 4DYQA 1DI2A 2EM0A 3H3ZA 4IF4A 1B9MA 2K5CA 3CJTB 3EDPA 3U9GA 4DR6E 1TNSA 4RM2A 2ZMEA 2ZSHB 2EIMH 3ELKA 3KYDB 3L2UA 2LBFA 2V83A 4O4KA 2OU2A 1O0WA 2B63J 1REPC 1APLC 5E3MA 4DYRA 1U2WA 1ETKA 2DJIA 2W84A 4M2ZA 3OL4A 3OL3A 1R58A 2WTEA 4ZDPA 4CHUA 1WHQA 2JA8J 5H2FC 4HG2A 4WXCA 4QSHA 3I54A 4I01A 3AV0A 2ZKZA 1STZA 1ORKA 4NBQA 3I0TA 2R93J 2EN8A 5KNLA 2CSHA 4E7ZA 2WAQN 4DV3E 1I5ZA 2K9QA 3UNGC 2IGMA 1Y1WJ 1OCRH 2EOOA 1IUFA 2JA2A 3LFUA 4U0YA 3OOUA 4LU9A 3I4NJ 4A93J 1WI3A 2PBIA 1Q1HA 4RGRA 1EV7A 3LFKA 4DUYE 5A6KA 2CW0F 2DFEA 2QGUA 2AHQA 3HOXJ 4DJAA 5F6FA 1LNWA 3F8MA 2O8XA 2ZMEB 3DP7A 4W97A 4Y15A 2R7FA 3K1NA 3RTRA 3TO7A 2AS5F 1E17A 2EH3A 2Y75A 2R7DA 1HA8A 1TT0A 3I53A 1JK2A 3BZKA 4GDFA 3TDZC 3RPUD 4L0YB 1FWZA 3BROA 1IN7A 3Q3SA 1AAYA 1YOVB 4G8XA 2DA5A 4II3A 1HCRA 1T98A 1Z77A 1R71A 1SFXA 3KYCB 3D0SA 3QOEA 3T8TA 3IV5A 3E5QA 2HKOA 3MKYB 4IL6C 5A69A 2JJ7A 3VYTB 2V88A 2MKDA 3G2BA 5CQEA 3U1KA 4N9HA 4ANJA 3O3KA 4WFTA 2EPXA 1LDJA 2OC6A 2XF7A 3EPLA 3SDGA 5FKKA 2QKLB 3OYGA 1KQ8A 1TQIA 5FKLA 5E1ZB 3IWDA 4R03A 5IOZA 2BB8A 4P9UA 4F52A 2K9LA 3IRRA 1KYQA 1LPQA 2ESNA 2HQRA 1K4SA 2LG4A 5J4VA 2YX4A 2JA7J 2A25A 2EL5A 1ZLKA 2R7ZJ 2LT7A 5IP9J 3BR0A 3GTQJ 2M7AA 2RPCA 1SMYF 3K2AA 2WC2A 4DR2E 2ADUA 1J5YA 3LSGA 4N4OB 1FMVA 4U0VA 4B3RE 4QPOA 1OQYA 5J8CA 2L2OA 2BY1A 3J81K 3S3NA 2EMFA 5DCMB 3DEWA 5F0FA 3BPXA 3N97A 1UB9A 2LV2A 1X47A 3IWFA 5ED4A 2Q2EB 3IWCA 5L3GA 4LG3A 2K3PA 3K4LA 2HOEA 2YT4A 4CA0A 3AG1H 2VKEA 1FT9A 4OMYA 1WCMJ 4JV5E 3S17J 3H5RA 1J26A 3H0DA 1A6QA 4E7HA 2F8BA 5HODA 5IXMB 1FJLA 2HTJA 5BNGA 1BR2A 2CQNA 1QGPA 2EJRA 2GHFA 3WTXC 3OV8A 1N3GA 2PI0A 1PP8F 2EOFA 3ZMDA 1YJNI 2PFBA 5BOXA 1IBLE 1G2FC 2JUGA 4WWCA 3ABUA 5F0HA 2A05A 2CSOA 4LG0B 2F48A 5H20A 2A6EF 1LEAA 1PKPA 3W3CA 1IN5A 3QQAA 2CQQA 2JPCA 1P4AA 1ZRFA 2CS3A 3PL8A 3Q0VA 2UXXA 2EZIA 2LVSA 1LKXA 5JR3A 2EOIA 2Y30A 4R8OA 1K4TA 4BDZA 5J1UA 3HEFA 3W6KB 1JT6A 5HLHA 2DTRA 2DIXA 4ABZA 4BMJA 4X62E 5D8KB 4P1WA 1FYKA 1WZ2A 2CWEA 1JHHA 1USSA 1O7FA 3WGHA 3FM3A 2RQQA 3ML6A 4LFCE 4B3SE 4L9NA 2HHHE 2CU7A 1YUIA 4P55A 2FBKA 4BKXA 4F6NA 1LLMC 2LNBA 4GXOA 4PJJA 4L9TA 2AXTC 1XG1A 2HXIA 5EJCA 3LA7A 4BE0A 2H36X 3KP6A 3JW4A 4U88A 4BBYA 4M6YA 2E5ZA 3VFZA 1ZRCA 2V8QB 4L9JA 1G8XA 1IG7A 1OYWA 4FE7A 5KL6A 4U87A 4P7DA 2EBIA 1HDPA 1WFXA 4A3CJ 2HI3A 1U9NA 1V5EA 1N78A 2I8DA 1S8NA 2WZOA 2DFFA 1FOWA 1TP4A 2CW8A 3U2RA 2NVUB 4LK0F 4TUIA 4M3BA 4OINF 3C2GA 2EOZA 4XSXF 3JTGA 3MZ8A 1E2XA 4L5EA 1IDZA 2YS9A 2EM6A 3JU0A 1IRFA 2F4IA 4N0BA 1Y1VJ 2IVMA 3C6MA 4BXFA 3QU3A 3WTSC 4K0KE 1EF4A 1EJ9A 3ECRA 3BJ6A 5DCMA 1FTZA 1XNRE 1I6XA 3KZIC 1YLFA 2LY1A 3K1PA 4M3FA 2R5ZA 3J7YJ 3ADLA 4CYDA 1VFCA 2VKDA 2BW3B 4HTGA 1FX7A 3IUOA 1U3EM 2DMYA 4G6DA 1BC8C 4DV2E 2I9IA 3FISA 1IBKE 4R2RA 2YU3A 4IXAA 3S3MA 1UHZA 3AG4H 2EV5A 4F3QA 2QM3A 1TLHB 2R7OA 1W0UA 2YPNA 2WBUA 3JR9A 2PEXA 2IJLA 3MD2A 4CUGA 3JAMZ 3WU1B 3M8JA 2V4JC 3JRGA 2ISYA 2VQHA 5IP6A 2QSGX 2R4GA 5K1YA 3ZMUA 2EFNA 4AUXA 1EKZA 4LGWA 2FMYA 2JOXA 4EJWA 2G7HA 2YR2A 2JA6J 2VXDA 4LF8E 1D1CA 2JUCA 3HKZN 3V7SA 2PN6A 3JSPA 4MGRA 3ZQQA 2PQ8A 1LJ9A 1IJWC 1H9TA 2X4HA 2Q8KA 4IJDA 3KPHA 2YRHA 2OUMA 3C7JA 1E3OC 1YI2I 5C4JJ 2Z2SB 2XGEA 2QLZA 3FF5A 2HDWA 3OIOA 4R2CA 3Q0UA 2R7SA 1SVOA 2M8GX 2NAZA 4P5OA 3RIRA 3JRFA 1MBFA 5HDKA 3HPGA 3WTYC 1R49A 4F54A 3C4BA 1O4XA 4IRHA 2L7FP 5KL5A 2HDDA 1ZELA 4X64E 3BTJA 4A3FJ 4B3ME 2W48A 2ZC2A 4PK4A 5A2QC 1Z3XA 1CGPA 5A6BD 2EFQA 3V7RA 2X1DA 4O24A 2H1LA 4PGGA 2DA3A 3QAHA 4M9ZA 2W25A 2V26A 4LFBE 1S6LA 4ESBA 4DYCA 1S7OA 4PCQA 3EQ1A 2E5NA 5A6AA 2K3FA 5E3OA 2JY9A 3THOB 1RIOH 4RGUA 3I64A 1N75A 4A0YA 4NC7A 4F9CB 5L3FA 5HNHA 2QZ8A 1W1WE 3E5UA 3VYSB 2HOAA 5HNFA 3S14J 1T4OA 2M30A 2DYSH 1AKHB 4OIOF 2MW8A 3A4CA 3CMMA 1IF1A 2GXGA 2LY9A 1BM9A 3M07A 1PUEE 2M4KA 1T39A 1WH7A 3NARA 4C3IJ 2WBMA 3VYUB 5FGMA 5HDGA 3OYBA 1H9GA 1XGNA 1SR9A 4XKWA 5EGOB 2NRAC 4RHBB 2EZ6A 2LCEA 5AASA 4XOPA 2KP6A 4OIQF 3AG3H 4YIFA 1TNTA 1ZLJA 2FNPA 2CV2A 4A3DJ 1DQ3A 2COMA 3I3LA 3V7CA 3PSFA 1F5TA 2PJRB 2V1UA 1NK2P 3WGGA 5B3SH 3DQVC 2CH0A 3GTOJ 1FBSA 1FP1D 5FRNA 4QLCU 4XNFA 4FHTA 4P9FA 1BW5A 3GVAA 2JTVA 2XB5A 1W7PD 2F5DA 4KN4X 4UV9A 3CJNA 4IZZA 5F08A 2DBBA 2Z3YA 4UUVA 1X48A 1U8BA 1YITI 3HQ1A 1FOKA 3R60A 2B9DA 3D5LA 3A01A 1PDAA 2R3SA 2ID3A 4MO7A 4RAZA 4C30A 1R5GA 2UXCE 2WAEA 3NEUA 2NS8A 3S1NJ 2HGCA 4R2EA 4JYKA 3JRIA 2XSDC 2NA2A 5IT3A 4UUSA 1PDNC 2M9HA 3THNA 4G7OF 2YUSA 3PSIA 2Z9OA 4MFDA 2EZKA 1KYZA 1DDNA 1N34E 2O7OA 1GV5A 5LGTA 4KHPE 1QVTA 5D5VB 3WTTC 1QA6A 4HQMA 2L8TA 2E71A 1UHSA 3H5NA 3DWLE 3A2KA 1IDYA 4NC8A 3VYXA 2UWMA 4A3IJ 1DUXC 4ENMA 1YS6A 5FD6A 2L6MA 4BHBA 5C3EJ 4KICA 3A1YA 1Z05A 3RPUA 1RESA 2FF4A 4RB3C 3DJWA 4IHTA 2YSOA 1ZRDA 2EV6A 3OSGA 2LP0A 2P81A 1FIPA 2MKNA 4BC9A 2K9NA 2HQAA 5J1YA 5LGNA 3HRUA 2BV6A 2DJNA 4FASD 1DPUA 2QQBA 3CP8A 2IP2A 2F6CA 3FKIJ 4CYCB 1YPNA 3TQNA 2BY0A 2P6SA 4NB5A 4WYQB 2OAZA 3FXLA 2WB1A 3DTIA 2PMZA 4M3EA 2N8XA 2NUFA 1VTNC 4XKVA 4L18B 4UNOA 3GTJJ 3WU0A 1HW2A 3S32A 4WXDA 3O2PE 3RPQA 4JI4E 2L9VA 3Q5FA 4HNTA 2R76A 2E7XA 1KGSA 3KCCA 3ZPLA 2IGKA 2Y2ZA 1MBGA 1Y8QB 2KIMA 4GCVA 4EJVA 2YU8A 2I13A 5F1JA 2EMIA 2BXZA 2EN7A 2BY2A 1ZHFA 4HNUA 1D8KA 5JLXA 3ZXSA 1E3PA 1S7EA 4Y13A 2KOUA 2TRTA 4DUZE 4X6AJ 1S7AA 1R4NB 3LSPA 5LHHA 4Q35B 3MWMA 4JP0A 2IS2A 2PLYA 1MBHA 1T6SA 1J75A 1IN6A 5K7ZA 3GYHX 2MD5A 1LVAA 2V89A 5HLIA 2HVRA 3G6EI 1AH5A 1JTYA 2KRFA 2KONA 5KK1A 2V6CA 3FHNA 2DT7B 2ID6A 3DLLF 3FKJA 1MNMC 4LFAE 2XAFA 2ZXIA 2VC1A 5KCMA 4OOGC 2V87A 2RNGA 2O61A 4DR4E 3CZ6A 2DT6A 3L2CA 2OF7A 3HTUA 3HB9A 3CCLI 3OYKA 3J7Yp 2E7WA 4LF7E 4ZDOA 1LFUP 2EJ4A 4P96A 1VQOI 1H8AC 4XL9A 3L9FA 3IL2A 2M4IA 2EPMX 5LRRA 2IA1A 2MC6A 3SZTA 2ZXWH 5FLXK 3HOSA 1YW9A 2RQPA 2M4GA 4OU0A 2YTFA 5CQGA 3HUGB 2F4VE 4ETSA 5LHIA 4E7LA 1X49A 2GXBA 1D1BA 3K9TA 5J1RA 3RKQA 1X3ZB 4ZZDA 1E3HA 4HLYA 4D5CA 3HYIA 4KFCA 2ETHA 5KL7A 2EIKH 5D4SA 4CCNA 1YW8A 3MVPA 1VQLI 3BWGA 4CYCA 1FY7A 1I1SA 1WI9A 1VF9A 2EV0A 4FE4A 4G6TB 3CO7C 4E7KA 4Y33A 2VONA 4OMZA 5LFAA 3CCRI 2OD5A 3BDDA 2EORA 3CDLA 3HRSA 2XV4S 4Y52J 1ZR9A 3MEXA 5CVJA 1IXSB 3VB2A 2EFOA 1G3SA 3X2QH 2K40A 3OYLA 4AWXB 5E1WA 1YYWA 2HVSA 4BXXJ 3PJRA 1PVEA 4HLXA 3M7GA 2XGXA 1N36E 4L0ZB 1RI7A 2IPQX 4MQVA 1BC7C 1QHGA 2LC2A 2VJ4A 3K69A 1GXPA 1F1ZA 1OYIA 4LB6B 1LQ1A 5IYDJ 1A5JA 4LF6E 1Z7UA 4P78A 2H27A 2ZJQF 3HC7A 1XGMA 3SHFA 3SZGA 4BHCA 5F3WA 3LSJA 3H9GA 1XMQE 1NG6A 2VQFE 4NHRA 2QWWA 2MLGA 5E8GA 2BE5F 5TJJA 1M1EB 3K4CA 5M5XJ 2LMZA 3BIDA 3BJAA 4DR1E 1YYKA 4CICA 1ETYA 2BVMA 4MTDA 2BVLA 3TDUC 3EYYA 4J00A 1WGXA 3VEPA 2N3GA 1LDKB 2KKOA 1OFCX 4RAGA 5DUKA 2QF7A 1ZARA 2FMLA 3F72A 1EH7A 1IGNA 4MQ9F 3DBHB 3HHHA 1MJAA 2DMUA 2VRDA 4B3TE 4DQ2A 2LTPA 4C3JJ 2STWA 3ROUA 1FYMA 1K6YA 2K7IA 4C2UA 2UZKA 1W7PB 2ENCA 1GXQA 2MFZA 2DAOA 2F5VA 3ESWB 1K7AA 1ITYA 4JYAE 1OLTA 1TWAJ 3BJOA 1QPIA 2ICWG 2B9SA 1FSEA 1PJSA 1FBQA 4WPYA 1YIOA 1W5CC 1D5YA 1DU6A 3EPHA 3HRMA 1BI0A 3RKYA 1G3WA 3WE3A 3CMYA 3IC7A 1Y6IA 3IH4A 4F9AB 2EM3A 1X2NA 3PIPF 1A1LA 2B0LA 1MEYC 3EPJA 3JRHA 2HYJA 2ODRD 2R1FA 2WAQA 4N4NB 2UUCE 3OYCA 1SFOJ 3QU6A 2RV8A 1B8IA 3I55I 1T56A 2E1OA 2FX0A 1QU6A 3WTVC 2WA0A 2X85A 1HSJA 2XSJC 3M1EA 2XGDA 4HRIA 2B7TA 3ZN1A 4BE1A 1VQPI 2LO3A 2M2EA 2VI6A 1AOYA 3LMMA 4EJUA 4LLNA 2QQAA 2P8TA 1MNEA 2XF6A 5IOYA 1XSXA 3P9CA 3ABTA 1PUFA 5CYVA 5FRMA 1WJ5A 2DCEA 1HQCA 4LJZF 4HX8A 2EMYA 1XTAA 2H6BA 2VODA 3AKZA 3DF8A 4HW0A 3L2RA 2LFBA 3L00A 4GYGA 3AG2H 3G1MA 5EZGA 3J7ZI 1FP2A 1KYWA 2MYSA 1BOAA 2JVAA 1DPRA 2GA1A 2XAGA 5EYRA 3RMPA 3ERMA 4UV8A 3OIQA 3T1BA 4HYEA 4MLOA 5DV5A 1MW7A 1TL8A 4RAYA 1XB4A 1HDDC 1R1VA 1UN6B 1FLIA 3H3UA 3IH3A 3OOPA 5DUIA 1W36D 1P7IA 3O8HA 1K78B 1MZBA 2KT0A 2E1MA 3ERED 4MLQA 1I6HJ 3P1XA 4ZZLA 3ADJA 4N4RB 3FXKA 2NOJB 4XMYA 1O3QA 2PG4A 2VBYA 3I59B 3MAJA 2ZCWA 3IWBA 2EIJH 3BLYA 3C2HA 3E3VA 1IAWA 4LIVA 2YU9J 4JQFA 1QU3A 4R2QA 1SFEA 2P7VB 5AC5A 4EGZA 2JZYA 2HQNA 3A0HC 2FNAA 5KL2A 2VF1A 4MEXF 2EMCA 2FTXB 2HEOA 1YQAA 3GBGA 3RKWA 1W36C 3CC7I 3UKGA 1ZAOA 3BZ6A 3FDYA 1JXSA 3GZNB 1TZLA 3TQMA 1MDMA 4AVZA 3E0JB 2EOMA 3UK3C 1LUJB 1FBUA 4GKKE 2MC3A 5FLVA 4RB1A 3DBRB 2RSMA 1A1FA 2ZSIB 3QODA 1R5HA 4A3JJ 4UY8I 2HNHA 1MNDA 4CCMA 4GFBA 3DF6A 4M71A 1P6RA 2FRHA 3K1MA 3OMLA 2HVQA 3KP7A 1T08B 1X1BA 5EG0A 4BBRJ 3HL2A 3R61A 1G59A 3CJRB 1YYVA 2L3CA 1KQ0A 3JRBA 1XD7A 2ENHA 2YTQA 2FUG2 2M1SA 2FQ4A 4NDLA 1CF7A 3HGGA 3BZCA 4YG2F 1U5TB 5CVUA 1IRGA 3BCAA 3J80C 3OSFA 1RZ4A 1MBJA 2BW3A 2IXSA 4D7NA 4BQQA 5CKTA 2DW4A 2HZTA 2HTSA 3CCUI 4IQJA 1A1KA 1OKRA 1U9OA 2CUJA 2JVGA 4LLLA 4EQQA 5IV8B 3K4MA 1VNDA 1BIBA 3Q0WA 4IJAA 4ZYDA 3OYEA 2J5PA 2DMNA 4DR3E 4F92B 3FIGA 2KL4A 2VQGA 3CUQB 3CTAA 5JVGF 2KHXA 4YRVA 1A6IA 5E20A 3CCEI 2RS6A 3OYFA 2JRMA 4UXNA 3GF2A 4JX6A 4AIJA 2EWNA 5EZHA 1U8RA 2EPLX 3WTWC 2ELZA 4U7BA 3GFJA 4M72A 5T6JA 1QZYA 1L4SA 2L9SA 3MHHC 2FBIA 3IKVA 3FMRA 4FK5C 2AQFA 3J7AY 5FKOA 3NQOA 3ADGA 4EM2A 3K4JA 3GUDA 5E8IA 4BJ6C 2XPUA 2RVCA 1N25A 2VQEE 1W5SA 4XRSA 1K61A 2MH2A 5EEHA 5KHDA 2IA0A 5D5UB 3ZQ7A 4BBSJ 4YHHE 2RKHA 1DQUA 2DLLA 4B47A 4E70A 4AU7A 1SD7A 2XAJA 1XS9A 1RRJA 1O7LA 2BHZA 2DT5A 4ZDLA 3L1PA 3D1NI 5FLXC 3J80K 1ZGJA 3E6MA 3TEDA 1YJWI 4XLEA 2DOEA 3GTMJ 3E1SA 1G6NA 4UB8C 4FETA 1C0WA 2IS1A 2STTA 1HW1A 1MD0A 2DI3A 5J47A 5E18F 2Z5UA 3HHGA 3SEQA 3OS1A 2QYOA 2ZJ2A 2DA2A 1IZ1A 5FFXA 4IPAA 4CZCA 3J81Z 1Z3YA 5FO5A 1Z21A 4NQWA 1XN7A 3LL7A 4JI2E 2DK8A 3C4TA 4KUMA 1MMAA 2VKHA 1BA5A 4R79A 1ZAAC 2GQQA 3NRVA 1I39A 4I98B 3BCBA 3MN2A 3CUQA 5L3BA 1FTTA 4HDVA 2X1EA 3VOEA 5HS8A 4ESJA 2L9RA 1F43A 2YTNA 2LTRA 3GFMA 2P5KA 1BJZA 3T1HE 3O8GA 1OR7C 4CCJA 4MEYF 3ZQHA 1R4MB 4M73A 4XM3A 2CG4A 2JYAA 5CVRA 2NUEA 3ONQA 1P92A 5L3DA 5DS9A 3K10A 3F8BA 2WWYA 3GFLA 3ABKH 4XICA 1SAXA 3K6QA 1ODDA 3S2HJ 4C3HJ 2MH9A 2R5ZB 2CV1A 4ITVA 4A3EJ 3HPZA 1LFPA 4KYWA 1D0XA 2EFWA 2HXOA 1HC8A 1G3YA 2Z1DA 3REOA 1XX5A 3DV8A 2L7ZA 4M3GA 3GEZA 1U6GA 4XLPF 4ON0A 2ZMEC 1X3CA 1OMIA 1ZREA 3PQJA 4GKJE 1A1IA 5AE1A 3KP3A 2WV1A 4GRIA 2M7QA 1TQPA 2OCCH 2FU4A 2EK5A 3FXQA 2K4JA 1EKEA 2DYRH 4BHPA 4GYIA 4C9YA 3TW7A 2P5LC 2HDCA 3FX3A 2XVCA 3EUKL 1UILA 2HQ5A 2X48A 3EUHA 3RKXA 2EQ1A 2ZO4A 3FMQA 1ZG1A 3FK7A 2RC4A 1QBJA 2WY8Q 4RM3A 4HF1A 5IT9K 2DRPA 1HNWE 1I3QJ 5IY5H 2YWQA 3SZPA 3LAJA 2CMPA 3VK6A 2K4BA 4M30A 2P6TA 2GLIA 4DW6A 2VKVA 5TSEA 2M87A 4G12A 4BDYA 3RZOJ 3DEUA 1J7KA 5F0CA 1YHQI 1MSFC 5LEJA 4M9XA 5CVIA 2NVYJ 3W2WA 4BQOA 4OOIA 4LOCA 2V86A 2KIUA 2R5YA 3BR2A 3SYTA 2EM4A 2E36A 1ENHA 3F6HA 1MH4A 3WG9A 3FXRA 4YEJA 4IEJA 5L3EA 3SJMA 4WF2A 5FLMJ 2VN2A 5B5EC 2P5VA 3SFZA 2LBFB 3CCJI 4A5NA 3RQIA 2LUQA 1HXDA 2YRKA 1R7JA 3LQQA 1RUNA 5HLTA 4IOAF 4DKKA 2NUGA 2Z99A 3CQZJ 1HKTA 2HR3A 5LHGA 2E35A 3ECHA 1NEIA 3JRDA 2ZJRF 3DBLB 2RNJA 1VQKI 4TUGA 1O3TA 2KRCA 5M3FJ 4AD9A 2YSRA 3FWEA 4F7ZA 4CXFA 2DMTA 1UG2A 3KETA 1EH6A 5J4YA 3RJPA 3Q9SA 3A03A 5B1AH 2EPOA 2IA2A 4RGXA 1YS7A 4QIWN 3EPZA 3RI4A 3GZ5A 3P7NA 2MABA 2DB2A 1AU7A 1V54H 2EN3A 3CJQB 3TKYA 3LA2A 1ACIA 4DV0E 2IS6A 4KITB 4JOMA 4RH8A 1WJAA 2XF5A 1FKAE 1BW6A 1I94E 1ZG5A 3ZRGA 3TBIA 4B44A 5ICGA 2DPDA 2LKXA 5LMNE 3BBGA 3OYJA 4KMFA 3CLQA 4LD5A 4EJTA 3ABLH 3CCMI 3JCUC 2LBSB 4I6ZA 3ZP5A 3A0BC 1BN5A 2CRGA 1S9HA 4S0HB 5IPAA 3E6DA 2EINH 5J8FA 1A1JA 2DMQA 2L4MA 3J7AO 2P4WA 3RYPA 3ZQIA 1MMDA 5BPIA 4XK4A 3BG6A 3MMYB 2XB0X 5A2QK 1WPKA 3S2WA 1YJ9I 5AIQA 2VT2A 3KX2A 2ZBKA 3MFKA 2V79A 1PUFB 1EH8A 2OQGA 3NWTA 1Z6RA 2Y9YA 4HV5A 1VQNI 4X8WA 3BR3A 4JI0E 1UBDC 1MJ9A 1WJCA 2O03A 3L09A 3OYNA 2DSYA 2RGVA 2CUZA 5L3CA 4H0EA 4NZVA 2L3DA 1A31A 3BTCA 1RKTA 2M9AA 2YSPA 1GTKA 4A3BJ 1TF6A 1BR4A 2PJRA 2M5WA 1Y39A 3QP5A 2V7FA 5KAFC 4XKCA 2EM9A 1RETA 2ZXJA 3BC8A 3F0CA 3DKWA 1LEBA 1ETQA 1Z1DA 4HSRA 1D1AA 4BGDA 2X6YA 2V6EA 5LL6R 5DD8A 1OCTC 5FJ8J 5DDGA 1ON1A 2JPBA 1DGCA 2FQ3A 3TGNA 1WJBA 4MIMA 2EN4A 5GAGJ 4UVBA 3F8FA 3VYRB 1ZN2A 2IGOA 2RREA 3IH2A 4FT8A 4G9YA 5H6RA 4ENNA 4KIBA 1HF0A 5LBQA 2NXNB 1J9IA 2FOKA 2CT1A 3WGIA 1WKMA 3CF2A 5IYBJ 2YRMA 4AIHA 2CTDA 2QCOA 5LGUA 2R7XA 4OX9E 2EMBA 4CCLA 3ZQGA 4Y3OA 2DTZA 1WHNA 3CLOA 1YX3A 3V8KA 3I9V2 4EM1A 3CMAI 4E7SA 2OZUA 4LMYA 4O5VA 1QZEA 2DGCA 1X4PA 4WSPA 2OCEA 2JSPA 2O5RA 2VQCA 4GGGA 3PNVA 4Y7NJ 1A04A 3SFIA 2XIGA 2DQRA 5J40A 3FMSA 2VB6A 3TP3A 2LLKA 2GOXB 1V5GA 2O6GE 1NG7A 4KWYA 1OPCA 1FOYA 1XCBA 4JI5E 1YFHA 3CC4I 3QPSA 1ZKGA 2OZ6A 1UMQA 3I4PA 4PDKA 3ZMSA 2AQEA 3GO5A 1QO0D 3HTXA 1K83J 3LWFA 3QP6A 1J09A 5EEGA 4OAYA 1TT5B 2M7BA 3HDDA 2XKOA 3HPHA 3MZHA 2DDBA 2EPKX 2YTOA 2GIVA 4XONA 2LYCA 3DLAA 2LR8A 4E6KG 1VQ8I 5GTHC 2CQKA 5IYCJ 3FM5A 4HQEA 1JKPC 1RC7A 3T5XA 3H92A 2Q2EA 2LJHA 3WHBA 1WRJA 1BOBA 3TP0A 1O3RA 5E3NA 3KE2A 3JAMK 3U21A 1TC3C 1P4WA 3VPRA 3GLLA 1YRNB 4DZJA 2D5VA 4O3MA 2WV0A 2VE8A 2P0WA 2OPTA 2MLKA 2FD5A 1F4KA 3ECOA 4BEHA 4M6XA 1WJPA 2KZGA 4U0WA 4YFXF 1UHMA 2F4OB 2DO7A 3E6CC 1GVJA 2HFHA 3D5SC 3R4KA 5DEQA 4L5IA 1MBEA 3S8PA 5HS9A 1K78A 2QSHX 1TW2A 3LMLA 1XSDA 4ZYEA 1JI8A 1IBME 3CCVI 4H4KC 1Y0UA 2VLAA 2CW7A 2DFIA 2G7UA 4NUBA 5DD4A 2QUFA 1JGGA 2CUEA 3PO2J 1RNLA 5C4XJ 4BACA 1X6FA 2HYGD 2MC5A 4BXUA 3DKXA 2JA5J 1FIAA 1X2MA 2DMIA 3GTLJ 1QZZA 1HR0E 4QWQA 1RKWA 2XGCA 2E2JJ 4G6QA 2A5YB 2MGQA 2V1DA 4F9BB 5FB2A 1NK3P 2VPLA 2EPAA 2M8EA 1Y56A 2MBFA 3ZOBA 4CH7A 3LLHA 1WJEA 2MDGA 2EA2A 2DOAA 3V4GA 3M3YJ 3K70C 4UB6C 3IKTA 1FZPB 2L9NA 4DV6E 2GWRA 2DDAA 2JK3A 4B09A 1B59A 2EMXA 2LRDA 1F9NA 1ON2A 1XDUA 3PFYA 5DCFA 1QPMA 3KP2A 3PM1A 3WE2A 4AQYE 3OWTA 1G3TA 2DFHA 4A3GJ 1JT0A 4M3DA 4HSTA 2IEKA 3S1RJ 4LK1F 3KEOA 2VOOA 3MQ0A 5FD5A 1R36A 2NNNA 2UV1A 4Y17A 4IHXA 1T4NA 3G73A 3HJEA 3J81C 4GZNC 1IW7F 4PFOA 1H89C 3BP8A 1BBGA 4KZSA 1BB8A 2RQLA 2VE7C 2JWTA 3W2VA 2L2KB 1HNXE 1X1PA 1H0MA 3ZN0A 2KRHA 2Z33A 5E1XA 1TWHJ 2L33A 4XR6A 2V1XA 3DU5A 1X6HA 4XOTA 4KA4A 1G2DC 2K7LA 3HZJA 2RN7A 2NVTJ 2EMKA 5DNYA 2KZVA 1TWGJ 1I50J 2R7UA 2VL8A 9ANTA 1XDSA 2EM5A 4BH9A 4A0XA 2NYXA 1GZ6A 3I58A 1JJ6C 5AIPA 2A6TA 1OCOH 3BQYA 3ZR8X 3GTKJ 3V8JA 1TWCJ 3DPTA 4I99C 4PJNA 3RYRA 3FBIB 4I02A 2FEZA 5ILUA 4LIUA 2NS7A 5K5RA 1IN8A 3HOZJ 3CUQC 3S2DJ 2VUMJ 4DMIA 5E3LA 5IWAE 2GAUA 2EOEA 2GIZA 2PMHA 1RMDA 5FKNA 4JK1X 4Q4ZF 4NQWB 2Q8UA 3H09A 3F6VA 1G2HA 2A69F 1L3LA 4LF4E 4DR7E 3OR1C 3HXLA 2DLKA 1QVUA 5BPDA 4OIPF 2ZB9A 3O6BB 1NHAA 3ULQB 4F2JC 2R7VA 4CZZA 2ENAA 3EETA 1GT0C 4B1RA 1YX5A 4B3AA 3PUBA 4BY7J 1GHCA 4HZFA 1T95A 3SXYA 5B1BH 4ZC3A 5B66C 4RLQA 3T8RA 3MKZA 2PRTA 3HTSB 1OR7A 3HOWJ 3LSKA 2A68F 3I56I 3GX4X 3JREA 1HOMA 3TOAA 4A69C 2DOFA 2A07F 4R2PA 3MKWB 3L2VA 3ZCOA 3K70D 4KIGA 4O43A 2XAQA 3TO9A 3IAS2 2ZNYA 1X4OA 2X6OA 2HOSA 2DLQA 4XLCA 2Z16A 1RR8C 1XC5A 5CFFE 2D1HA 3VYYA 3CP2A 1O3SA 1SC7A 3TW6A 3KFWX 2GPIA 1I3AA 2VASA 4IS1C 5FKMA 2EN1A 1JGSA 3JSOA 1ZYRF 3K4BA 3N05A 2LE2A 3M4OJ 5M5YJ 2CFOA 3NWSA 3DU6A 3RCOA 3JAMC 2K9SA 1IQOA 4HV6A 1WSUA 4DGWB 2M0MA 4MLVA 4ZJZA 1FMWA 3GMEA 2X6WA 1ETOA 1U5TA 2EILH 4PFPA 4ENKA 2W82A 2X0LA 2BYVE 1WVRA 2EM8A 1Y0NA 4TV7A 4ZYHA 4IVNA 1BI1A 2RAEA 3G3ZA 5TISC 3WODF 4IHYA 1S29A 4D9JA 4HX7A 3T0YA 2E2HJ 2EL6A 5AONA 3SQNA 3FXUA 1N33E 2JPAA 1Z7LA 5EG0B 2BY3A 4XN3A 4EMSA 2EP3A 2E1MB 2EM7A 3OTOE 2ME6A 1PJQA 1TTYA 1X1CA 2KHMA 3CCSI 1VQ5I 2GXAA 1W5TA 1LVKA 4D7MA 2YU5A 1JUSA 5ILSA 4KISA 2N3HA 1K79A 3LSRA 3WG7H 4CGZA 2EPZA 1JE8A 3Q9VA 5BR8E 1X19A 2HZDA 1X1AA 3HPSA 1BJAA 3PNTA 3BF2A 1LB2A 1B1BA 4G94A 5D5XB 5D6FA 3S3OA 3FHZA 1UFMA 3IHUA 2I5UA 1NCSA 2UU9E 4QPQA 2UXDE 2L01A 4I76A 1YTYA 1VQMI 4ZYGA 2K4VA 4EATA 3ABMH 4M74A 4QTRA 4NXNE 3KEYA 1Z91A 3F8CA 3OIPA 1R5ID 4KT5C 2E72A 1IV6A 4IOCF 5BS6A 2M45A 2M3AA 3JTZA 2P7CB 3ASNH 3P9KA 4BL0B 1IRZA 3BR1A 2W4SA 2FSWA 2MA3A 2KLOA 3CF5F 4BY1J 4JI1E 1W7PA 1ETVA 2OJED 5HOOA 1FJGE 4UUTA 2QVOA 1QHHD 2PX9A 3OYHA 1IV8A 2EQ0A 4Q28A 3EPKA 2G0EA 4DV4E 5D4RA 2EOSA 1QQIA 4S04A 3WTZA 5ICFA 2ESHA 3F9KA 3GFIA 1ZH5A 3OYAA 2H1KA 3JTHA 1ETXA 2D9HA 2E5LE 2L5QA 4S05A 4ZTFA 5GAHJ 1KA8A 5GPCA 1UHWA 4IX7A 1VQ4I 1RQ0A 4JBAA 1WXRA 2A3SA 2DA1A 2JR1A 2W85A 1P47A 3U1DA 2A5WA 3H5AA 4RBOA 3S1QJ 2N8GA 2FGGA 2H94A 3QYBA 1X3UA 1T33A 2EMGA 3L2QA 2HYFA 1MMSA 3S1MJ 1FEXA 2J7JA 5IT9C 2UUBE 2LREA 2ZXHA 5ICEA 3F21A 3DPLC 1U0JA 4JI8E 2VXZA 2TDXA 3DPUA 4BC7A 1YO5C 4AM3A 2NS0A 2B3TB 1BBOA 3FIWA 2WBTA 1EA3A 2EZHA 3KWRA 3BOQA 1OCCH 5CPRB 5CJ9A 4IHVA 4PZJA 1KU3A 2K02A 1E0EA 1HNZE 3E97A 3F6GA 1J5EE 1GV2A 2HWVA 2UXNA 1X58A 4AYBA 2LTSA 2KIFA 1SFKA 2V1NA 1MH3A 3F6OA 4GEQB 4B43A 1PYVA 2H8RA 1JUPA 2E1MC 3FK6A 1WJFA 4BCAA 1QRYA 2UUAE 1J59A 2L2NA 1P4XA 2V9PA 4I2OA 4A3MJ 3AL0C 1KU9A 2EPNA 1R1UA 3ZGKA 1PP7U 2WBSA 1J0RA 3CDHA 1SFUA 1ZK8A 2IHR1 3JRAA 2KISA 1W0TA 2VBWA 4MTEA 6PAXA 1MMNA 2ME0A 4LFUA 2EQRA 4V2FA 4B8XA 1JKOC 3S15J 3MZYA 2KDOA 1UJ8A 4PJ0C 3F23A 2HKXA 1ZGAA 4XLHA 3N4MA 1KONA 2NVXJ 4F55A 1OYYA 3M1CA 5K7FA 4IO9F 1XCVA 2XRNA 2VIXA 3OS0A 1R1TA 2R0QC 5ILVA 4XKBA 1D8JA 3LSMA 4Y4RA 1Z6TA 2Y0MA 1UZCA 2BEOA 3HUGA 4OAZA 4R2DA 2WY7Q 5K7HA 4BU2A 1UCRA 1XGSA 4J19A 1F36A 1CQTA 3P5JA 3MSWA 3HG9A 4YELA 2GLOA 2VQLA 3V8LA 2LKPA 2L4AA 1GQEA 5HS7A 5LMUE 4AIDA 4HF2A 4KT6A 1KU7A 3IP4B 1PJTA 4HNVA 1YZ9A 3VDXA 1A1GA 3LNQA 2HC5A 1ZTRA 2DU9A 5HLGA 4XORA 5LLQA 2ZM6E 2UXBE 3WHCA 3VSKA 1T2KA 4ASNA 2W1OA 1R9TJ 1DGRM 3VODA 3H35A 2KJBA 5AE2A 2EOHA 1XMKA 2YTIA 2Y9ZA 4NHJA 4KJZA 2F5EA 4AYBN 4MFEA 2EOXA 3H1CA 4A12A 4A5MA 2ZFWA 5DM6F 2ECCA 3K2ZA 1YRNA 3TOBA 4D1QA 3WTUC 4XRSG 5GAEJ 1GVDA 1XSVA 1MGTA 1OCPA 3SDBA 3C6KA 4JI3E 2EN6A 2EN2A 2JN6A 1D0YA 4BYYA 2R7QA 4HEA2 2EPFA 2L54A 2K27A 4WCGA 3GLXA 2R7WA 4C2TA 4A3LJ 3GWZA 2VOPA 5M3MJ 2X9DA 4X1EA 4PJMA 3M99B 3AUZA 3J7AG 1N32E 2CJJA 4L5JA 3B02A 4XRMA 2VPRA 1X6EA 1R22A 1H88C 3LOCA 5GP9A 3CDIA 2EMHA 1BIAA 3HRTA 1IN4A 2V9VA 1BL0A 3GTPJ 2QSFX 2Q0OA 4ZTJA 2Y0SA 3F22A 3PFIA 4XLFA 4B4CA 5FLXZ 2NVQJ 5EDNA 4XN0A 2VJ5A 4BJTA 2E60A 4XLAA 1IUYA 2CQXA 2OTLI 2D1VA 1ZG3A 2XPWA 2YTPA 3W6VA 1T38A 4A2UA 2BBYA 2LD5A 3KEQA 2WCC3 1OISA 1BI2A 1WHUA 1MJBA 3LSTA 2K85A 5JHFA 5D5WB 2F4MB 1ZQ3P 1VQ7I 4LB5A 3AL0B 3FXJA 4II2A 2HOTA 2E19A 2L92A 1GLNA 1ZGWA 2BXYA 3GTGJ 2DA4A 2IW5A 4MNUA 1GDTA 3HGYA 4HDUA 1X3WB 2LVHA 2XASA 2MC4A 4FISA 2EWLA 3K4NA 5GADJ 3ZQCA 4RA2A 2O8KA 2XAHA 3M8FA 1YG2A 2Q1ZB 5GPAA 3G4SI 2FA5A 5DYMA 3TMOA 3BGHA 2JOBA 2L3JA 4I0AA 4DBQA 1TN9A 1LFBA 4JX4A 4JI7E 2GM4A 5TGTA 3RZDJ 2F5CA 2VBXA 3BQZA 4E7JA 5DTDA 1X1DA 3RDIA 2F2EA
chains in the Genus database with same CATH topology
5K5QA 3KP4A 2A6HF 2QENA 2PJPA 1BBYA 4A6DA 3HSRA 3M9AA 3KZYA 1SD4A 5KVRA 3PQKA 1R23A 5F64A 3W6JB 4KIFA 1JHFA 4KN7X 4HA8A 2G9WA 2XHKA 5TRDA 5FFZA 4U7DA 4KDPA 5F1RA 1V3FA 1I27A 2EB7A 2O3FA 1ULYA 4CO8A 5A2QZ 3C3WA 4UHTA 2ZNZA 4I7HA 3GZ6A 4XRFA 4XSZF 3F8NA 2F5FA 4BQAA 2E1NA 4CDGA 5CVVA 4XBFA 1KQ9A 2DPUA 2LSOA 1T0FA 4EM0B 4YFNF 2AXLA 4DNCA 1B6AA 4FX0A 2H6CA 4UVCA 3P9IA 1Z9CA 1P2FA 1R00A 2KJCA 4R1HA 1WQ2A 4G7ZF 4EGYA 5D8LB 2LDUA 3HIFA 2XROA 2FXAA 2Y48A 5E17F 1IXRC 4EVIA 3J80Z 2ISZA 2BGCA 3ZMTA 1DP7P 1WWXA 3HSFA 4HF0A 1SD6A 4IRIA 3L7WA 5JVTA 3HOTA 2DQLA 3QRFF 3DFGA 2K86A 2D45A 1U78A 1FNNA 2FE3A 3C1DA 3EQLF 2W57A 1XGOA 1HSTA 1KU2A 1XMAA 3GW2A 3ZMVA 1HKQA 4KNYA 1CF7B 4EJOA 1B4AA 3EYIA 2RDPA 5HVQC 2EA4A 1G4DA 1D3YA 2JRTA 4R8HA 5IT9Z 5BMZA 1QNTA 3HSEA 2YPRA 4WXHA 4BNCA 4RB0A 4L9VA 5J6XA 2OBPA 4KMUX 4ZH4F 2QBYB 2A61A 1L0OC 3R0JA 2VC0A 4LLGF 3KLNA 1J2XA 1USTA 1AWCA 4A0ZA 1FSHA 4UVAA 3R0AA 1TW3A 3QPTA 1V4RA 2O0YA 3B73A 2LF7A 4FX4A 2CGPA 5JHUA 2OA4A 2FBHA 2CFXA 3LQRA 3R6SA 5LEKA 1D5VA 4OIRF 5BQTA 2D2WA 2ACJA 5ERIA 4AVPA 2M1BA 5K5OA 3ISPA 1YW7A 3COAC 4G7HF 2C6YA 5D6EA 4M9SA 2NNYA 4HX4A 3FZVA 2YX7A 3ZMZA 2J5OA 4YIIA 3I59A 2E1CA 3BPVA 3QPHA 1FC3A 4Q47A 2VBZA 4WX9A 3I71A 5HDNA 4ENJA 4O6JA 3AAFA 1HBXG 3F3XA 2H09A 5CLSA 2IRFG 3LA3A 3I5UA 3BY6A 2QBYA 3K0LA 2XUBA 4HOBA 4YFKF 3E5XA 2VE9A 4LG0A 2EFPA 3M8EA 4RGSA 3LAPA 4Q5SF 3IWZA 2JT1A 3KP5A 4RB2C 1K6OA 2LF8A 4A6EA 5LRSA 4Q48A 1IXCA 4HAMA 4N9IA 3C18A 4K2EA 1RUOA 2W24A 2GZWA 3CUOA 3KLOA 3QOPA 2IT0A 5H6QA 1W4MA 1ONVA 4PGHA 3E6BA 4AIKA 3KZZA 3TO6A 5ICCA 3GXOA 2L02A 1FPQA 4I09A 2JSCA 4RS8A 1BI3A 4XLNF 1MKMA 4BAYA 3CO6C 3DXJF 1TBXA 4HBLA 1O57A 3IRQA 1HW5A 2CYYA 2HS5A 2QQ9A 4GO1A 4MHGA 4IRGA 1TQMA 2PMUA 4EV0A 4Z2YA 4D0PA 2DK5A 5JI6A 2CO5A 1MDMB 4WK8F 2GA2A 1FYLA 2OQRA 4I0BA 3MCZA 1HKSA 4ESFA 1SMTA 1SD5A 2ELHA 1U5TC 2XKPA 2VT3A 1I1GA 1B9NA 1S3JA 5JFRA 1LDDA 3H3ZA 4IF4A 1B9MA 3EDPA 3U9GA 1TNSA 2ZMEA 3ELKA 2OU2A 1REPC 1U2WA 2W84A 1R58A 2WTEA 4CHUA 4WXCA 3I54A 4I01A 2ZKZA 1STZA 3I0TA 1I5ZA 4U0YA 2PBIA 1Q1HA 4RGRA 1EV7A 3LFKA 2CW0F 5F6FA 1LNWA 3F8MA 2O8XA 2ZMEB 3TO7A 3DP7A 4Y15A 2R7FA 3K1NA 3RTRA 2AS5F 1E17A 2R7DA 2Y75A 3I53A 3TDZC 4L0YB 1FWZA 3BROA 1IN7A 4G8XA 1T98A 1SFXA 3D0SA 3T8TA 3E5QA 2HKOA 4N9HA 3O3KA 1LDJA 1KQ8A 1TQIA 5E1ZB 4P9UA 3IRRA 2ESNA 2HQRA 2YX4A 1ZLKA 1SMYF 2WC2A 2ADUA 1J5YA 4U0VA 5J8CA 3J81K 5DCMB 3BPXA 3N97A 1UB9A 3IWFA 5ED4A 5L3GA 2HOEA 1FT9A 4OMYA 2HTJA 1QGPA 2EJRA 3WTXC 3OV8A 2PI0A 1PP8F 3ZMDA 2PFBA 5BOXA 4WWCA 3ABUA 2CSOA 4LG0B 5H20A 2A6EF 1LEAA 1IN5A 2JPCA 1P4AA 1ZRFA 2UXXA 5JR3A 3W6KB 5HLHA 2DTRA 5D8KB 1FYKA 1GHCA 2CWEA 1JHHA 1USSA 1O7FA 3WGHA 3FM3A 3ML6A 4L9NA 4P55A 2FBKA 2LNBA 4GXOA 4L9TA 3LA7A 3KP6A 3JW4A 4U88A 4M6YA 3VFZA 1ZRCA 4L9JA 1OYWA 1S8NA 3U2RA 4LK0F 4OINF 4XSXF 3JTGA 1E2XA 1IRFA 4N0BA 2IVMA 3QU3A 3WTSC 3BJ6A 5DCMA 1I6XA 1YLFA 3K1PA 4CYDA 1FX7A 1U3EM 4G6DA 1BC8C 2YU3A 4IXAA 2EV5A 2QM3A 1TLHB 2PEXA 2IJLA 3JAMZ 3WU1B 2ISYA 5K1YA 3ZMUA 2EFNA 4LGWA 2FMYA 4EJWA 2G7HA 2YR2A 3V7SA 2PN6A 3JSPA 4MGRA 2PQ8A 1LJ9A 1H9TA 2X4HA 2Q8KA 3C7JA 2QLZA 3FF5A 4P5OA 2NAZA 3RIRA 5HDKA 3WTYC 4IRHA 1CGPA 2EFQA 3V7RA 4PGGA 3QAHA 4M9ZA 2W25A 1S6LA 4ESBA 1S7OA 4PCQA 1RIOH 4RGUA 3I64A 4A0YA 5L3FA 2QZ8A 3E5UA 2M30A 4OIOF 1IF1A 2GXGA 1PUEE 1BM9A 1T39A 5FGMA 5HDGA 1H9GA 1XGNA 2NRAC 4OIQF 4YIFA 1TNTA 1ZLJA 2FNPA 2COMA 2V1UA 3V7CA 1F5TA 3WGGA 3DQVC 1FBSA 1FP1D 4QLCU 4FHTA 4P9FA 3GVAA 2JTVA 1W7PD 2F5DA 4KN4X 4UV9A 3CJNA 2DBBA 2Z3YA 4UUVA 1FOKA 3R60A 3D5LA 2R3SA 4RAZA 1R5GA 3NEUA 2HGCA 5IT3A 1PDNC 4G7OF 2Z9OA 1DDNA 1KYZA 5LGTA 3WTTC 5D5VB 4HQMA 2UWMA 1DUXC 4ENMA 1YS6A 5FD6A 4BHBA 4KICA 1Z05A 3RPUA 4RB3C 2FF4A 4IHTA 1ZRDA 2EV6A 5LGNA 3HRUA 2BV6A 1DPUA 2QQBA 2IP2A 3TQNA 2P6SA 4NB5A 2OAZA 1VTNC 4L18B 4UNOA 3WU0A 1HW2A 4WXDA 3O2PE 3RPQA 3Q5FA 2E7XA 1KGSA 3KCCA 3ZPLA 2KIMA 4GCVA 4EJVA 1ZHFA 1D8KA 4Y13A 1S7AA 5LHHA 3MWMA 2PLYA 1T6SA 1J75A 1IN6A 3GYHX 2MD5A 1LVAA 5HLIA 2KRFA 5KK1A 2V6CA 2XAFA 2VC1A 2O61A 3L2CA 3HTUA 2E7WA 4P96A 3L9FA 3IL2A 5LRRA 2IA1A 3SZTA 5FLXK 3HOSA 1YW9A 2RQPA 4OU0A 4ETSA 5LHIA 2GXBA 3K9TA 4HLYA 4ZZDA 3HYIA 4KFCA 2ETHA 5D4SA 1YW8A 3BWGA 1FY7A 1I1SA 1WI9A 2EV0A 3CO7C 2VONA 4OMZA 2OD5A 3BDDA 3HRSA 2XV4S 3MEXA 5CVJA 1IXSB 3VB2A 2EFOA 1G3SA 4AWXB 5E1WA 4HLXA 3M7GA 2XGXA 4L0ZB 1RI7A 1BC7C 2IPQX 4MQVA 1GXPA 3K69A 1F1ZA 1LQ1A 1OYIA 4LB6B 1Z7UA 2H27A 1XGMA 3SHFA 4BHCA 2QWWA 2MLGA 5E8GA 2BE5F 5TJJA 3BJAA 4CICA 4MTDA 3TDUC 3EYYA 3VEPA 1LDKB 2KKOA 5DUKA 1ZARA 2FMLA 3F72A 1EH7A 4MQ9F 3HHHA 1MJAA 4DQ2A 2STWA 3ROUA 1FYMA 2UZKA 1W7PB 1GXQA 2DAOA 1K7AA 3BJOA 1FSEA 1FBQA 1YIOA 3HRMA 1BI0A 3RKYA 1G3WA 3WE3A 3IC7A 2B0LA 3QU6A 2RV8A 3WTVC 1HSJA 3M1EA 3ZN1A 1AOYA 4EJUA 4LLNA 2QQAA 2P8TA 1XSXA 3P9CA 3ABTA 5CYVA 4LJZF 1HQCA 4HX8A 2H6BA 2VODA 3DF8A 4HW0A 3L00A 4GYGA 1FP2A 1KYWA 1BOAA 1DPRA 2GA1A 2XAGA 4UV8A 3T1BA 4HYEA 5DV5A 4RAYA 1XB4A 1R1VA 1FLIA 3H3UA 3OOPA 5DUIA 1K78B 1MZBA 3ERED 4ZZLA 1O3QA 2PG4A 2VBYA 3I59B 3MAJA 2ZCWA 3E3VA 1IAWA 4JQFA 1SFEA 2P7VB 4EGZA 2JZYA 2HQNA 2FNAA 4MEXF 2HEOA 1YQAA 3RKWA 1JXSA 1ZAOA 3BZ6A 1MDMA 1FBUA 2MC3A 4RB1A 1R5HA 4M71A 1P6RA 2FRHA 3K1MA 3KP7A 3R61A 1YYVA 1KQ0A 1XD7A 1CF7A 4YG2F 1U5TB 5CVUA 1IRGA 1RZ4A 2DW4A 2HZTA 2HTSA 1OKRA 4LLLA 4EQQA 4IJAA 4ZYDA 1BIBA 2J5PA 3CUQB 3CTAA 5E20A 4UXNA 3GF2A 4AIJA 2EWNA 1U8RA 3WTWC 4U7BA 3GFJA 4M72A 1QZYA 2FBIA 3IKVA 3FMRA 3NQOA 4EM2A 3GUDA 5E8IA 2RVCA 1W5SA 2MH2A 5EEHA 2IA0A 5D5UB 3ZQ7A 2RKHA 2DLLA 4E70A 1SD7A 2XAJA 1O7LA 2DT5A 3J80K 1ZGJA 3E6MA 1G6NA 1C0WA 2STTA 1HW1A 1MD0A 2DI3A 5E18F 2Z5UA 3HHGA 2QYOA 2ZJ2A 1IZ1A 5FFXA 4IPAA 3J81Z 5FO5A 4NQWA 1XN7A 2DK8A 4KUMA 4R79A 2GQQA 3NRVA 4I98B 3CUQA 5L3BA 4HDVA 3VOEA 5HS8A 4ESJA 3GFMA 2P5KA 4MEYF 4M73A 2CG4A 5CVRA 1P92A 5L3DA 3F8BA 2WWYA 3GFLA 1SAXA 1ODDA 2MH9A 4KYWA 2EFWA 1G3YA 3REOA 3DV8A 3GEZA 1U6GA 4XLPF 4ON0A 1OMIA 1ZREA 3PQJA 3KP3A 1TQPA 2FU4A 2EK5A 3FXQA 2K4JA 4BHPA 2HDCA 4GYIA 2P5LC 3FX3A 2XVCA 3EUHA 3RKXA 2ZO4A 3FMQA 1ZG1A 1QBJA 2RC4A 4HF1A 5IT9K 3SZPA 3LAJA 2K4BA 2P6TA 2M87A 3DEUA 1J7KA 5LEJA 4M9XA 5CVIA 4OOIA 2KIUA 3WG9A 3FXRA 5L3EA 4WF2A 2VN2A 2P5VA 3SFZA 4A5NA 1HXDA 1R7JA 3LQQA 1RUNA 2Z99A 1HKTA 2HR3A 5LHGA 3ECHA 2RNJA 1O3TA 4AD9A 2YSRA 3FWEA 4F7ZA 4CXFA 3KETA 1EH6A 3RJPA 3Q9SA 2IA2A 4RGXA 1YS7A 3RI4A 3GZ5A 3P7NA 3TKYA 3LA2A 1ZG5A 5ICGA 2DPDA 4KMFA 4LD5A 4EJTA 3ZP5A 1BN5A 5J8FA 3E6DA 2L4MA 3J7AO 2P4WA 3RYPA 5BPIA 5A2QK 3S2WA 5AIQA 2VT2A 2ZBKA 3MFKA 2V79A 1EH8A 2OQGA 1Z6RA 4HV5A 1MJ9A 2O03A 3L09A 2RGVA 4H0EA 5L3CA 2L3DA 2M5WA 3QP5A 2ZXJA 3DKWA 1LEBA 1Z1DA 5DD8A 5DDGA 1ON1A 2JPBA 2FQ3A 3TGNA 4UVBA 3F8FA 4ENNA 1ZN2A 4FT8A 5H6RA 4G9YA 4KIBA 5LBQA 1J9IA 2FOKA 3WGIA 1WKMA 4AIHA 5LGUA 3CLOA 3V8KA 4EM1A 2OZUA 4LMYA 4O5VA 4GGGA 1A04A 2XIGA 2DQRA 3FMSA 2O6GE 1OPCA 1XCBA 1YFHA 2OZ6A 3I4PA 4PDKA 3ZMSA 1QO0D 3GO5A 3LWFA 3QP6A 5EEGA 2XKOA 3MZHA 2GIVA 2CQKA 3FM5A 4HQEA 3T5XA 3H92A 2Q2EA 1O3RA 1WRJA 3KE2A 3JAMK 4O3MA 1P4WA 2WV0A 2VE8A 2MLKA 1F4KA 3ECOA 4M6XA 4U0WA 4YFXF 1UHMA 2DO7A 3E6CC 1GVJA 2HFHA 3R4KA 5DEQA 4L5IA 1K78A 5HS9A 1TW2A 1XSDA 4ZYEA 1Y0UA 2DFIA 2G7UA 5DD4A 2QUFA 1RNLA 2HYGD 4BXUA 1QZZA 4QWQA 4G6QA 2A5YB 2V1DA 5FB2A 2M8EA 2MBFA 2EA2A 3V4GA 1FZPB 3IKTA 2GWRA 4B09A 1B59A 1F9NA 1ON2A 1XDUA 5DCFA 3WE2A 1QPMA 3KP2A 1G3TA 4LK1F 3KEOA 2VOOA 3MQ0A 5FD5A 1R36A 2NNNA 4Y17A 3G73A 1IW7F 3BP8A 1H0MA 3ZN0A 2Z33A 5E1XA 2V1XA 4KA4A 2K7LA 2RN7A 1XDSA 4BH9A 4A0XA 2NYXA 3I58A 5AIPA 3V8JA 3DPTA 3RYRA 4I02A 2FEZA 5ILUA 5K5RA 1IN8A 3CUQC 2GAUA 2PMHA 4JK1X 4Q4ZF 3F6VA 2A69F 1L3LA 5BPDA 4OIPF 3O6BB 1NHAA 3ULQB 4CZZA 3EETA 4HZFA 3SXYA 3T8RA 3HTSB 1OR7A 2A68F 3GX4X 3TOAA 2A07F 4KIGA 2XAQA 3TO9A 2ZNYA 2D1HA 1O3SA 3KFWX 1JGSA 3JSOA 1ZYRF 4HV6A 1WSUA 1U5TA 4ENKA 2X0LA 2BYVE 4TV7A 4ZYHA 4IVNA 1BI1A 3G3ZA 3WODF 1S29A 4HX7A 3T0YA 5AONA 3SQNA 3FXUA 4EMSA 1TTYA 1W5TA 5ILSA 1K79A 4CGZA 1JE8A 3Q9VA 1BJAA 1LB2A 1B1BA 4G94A 5D5XB 5D6FA 3FHZA 1UFMA 3IHUA 2L01A 1YTYA 4ZYGA 4M74A 1Z91A 3F8CA 4KT5C 5BS6A 2M45A 2P7CB 3P9KA 2FSWA 2MA3A 1W7PA 5HOOA 2QVOA 5D4RA 1QQIA 4S04A 3WTZA 5ICFA 2ESHA 3GFIA 1ZH5A 3JTHA 4S05A 1KA8A 1UHWA 4JBAA 2A3SA 2W85A 3U1DA 2H94A 1X3UA 2HYFA 5ICEA 3F21A 3DPLC 2VXZA 2TDXA 1YO5C 2NS0A 3BOQA 5CJ9A 4PZJA 1KU3A 2K02A 3E97A 2HWVA 2UXNA 2KIFA 3F6OA 1J59A 1P4XA 4I2OA 1KU9A 1R1UA 1PP7U 1J0RA 3CDHA 1SFUA 2VBWA 4MTEA 6PAXA 4LFUA 4B8XA 3MZYA 3F23A 2HKXA 1ZGAA 3N4MA 1OYYA 1XCVA 2XRNA 1R1TA 5ILVA 1D8JA 1Z6TA 2Y0MA 2BEOA 3HUGA 1UCRA 1XGSA 3V8LA 2LKPA 2L4AA 5HS7A 4HF2A 1KU7A 2DU9A 5HLGA 5LLQA 1T2KA 4ASNA 3VODA 2KJBA 1XMKA 4NHJA 2F5EA 4A12A 4A5MA 2ZFWA 3K2ZA 3TOBA 3WTUC 1XSVA 1MGTA 4BYYA 2L54A 2K27A