4ZYHA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119l variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
148
Chain Sequence
LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPLHRVIAENGIGGYSRGVKLKRALLELEGVKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 44
structure length 148
sequence length 148
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyhA01
3HOSA 4O5VA 3LFKA 4ZYHA 2UWMA 1RIOH 3GYHX 2ZJ2A 3E97A 3FM5A 1S7OA 4MTEA 1FLIA 1IAWA 4ESBA 1HKQA 5LHIA 1STZA 3ZN0A 2GWRA 3QU6A 5D5VB 2ZNYA 2YX4A 4UVBA 1TQIA 3CUOA 1XMAA 5CVUA 4ETSA 3J80Z 2LF8A 4FHTA 3L2CA 3CO6C 1VTNC 5A2QZ 2QM3A 2XUBA 3R60A 1WRJA 3B02A 3KEOA 2PEXA 4ENJA 2V79A 3PQKA 3C7JA 4KMFA 2DPUA 3IWFA 4M71A 1BI1A 4HLYA 4XBFA 1MDMB 2W84A 1YYVA 1E17A 2P7VB 4XLPF 2CGPA 1FC3A 1Z6RA 5ILSA 4K2EA 2H6BA 2QQAA 2D1HA 1J9IA 4PGGA 5CJ9A 3OV8A 1W5SA 1BC7C 2PN6A 1HKSA 3FWEA 3FMSA 1MDMA 3W6KB 1IF1A 3WODF 1LB2A 3WTXC 2UXXA 2DO7A 1IN5A 2ZFWA 3ECHA 5FO5A 3GFMA 3JW4A 1YIOA 2RVCA 1D8JA 2M5WA 2ETHA 3K1PA 2K02A 3IWZA 1P92A 4MHGA 5E1ZB 3LQRA 2M87A 3I58A 5TRDA 3R0JA 3LWFA 2IP2A 2AS5F 2EJRA 3HRUA 3KE2A 5HVQC 4IRGA 3AAFA 2LNBA 1EH6A 2O03A 3O6BB 3F8BA 2O61A 4G8XA 1QNTA 1Z05A 2FBIA 1ZH5A 1OYIA 2VBYA 5HLGA 2EV5A 2V1XA 4KT5C 5FLXK 4KUMA 1ON1A 1FYLA 1SD7A 4IRIA 3ZN1A 3WTUC 2R3SA 3QRFF 2JSCA 1SD4A 4BHPA 3LQQA 1XB4A 2DU9A 3DPTA 2ACJA 2PG4A 2NYXA 3V7RA 4HF2A 4MEYF 2HGCA 3DFGA 4DNCA 2MLKA 2E1CA 4A2UA 1P4WA 5K1YA 3T1BA 5FB2A 5E20A 2D2WA 2F5EA 3K9TA 3PFIA 2F5DA 2C6YA 4OMYA 3EQLF 3F22A 2FOKA 5D8LB 3F8MA 2FF4A 1I1GA 3L7WA 3ZP5A 2YPRA 1ZRCA 1XMKA 2IJLA 4Z2YA 3HSEA 5HDKA 1R5GA 3ABUA 4RB2C 2H94A 3KETA 5CVIA 5DD8A 2EFNA 1OPCA 2PMUA 2XAQA 3C3WA 3MFKA 3IRQA 4BH9A 3GF2A 4G9YA 2E7XA 2M45A 3HTSB 5IT9K 3ZMTA 4KICA 3BJOA 1SD5A 3HTUA 2A68F 5BQTA 2Q8KA 5HOOA 4BAYA 4KN7X 3I4PA 2CWEA 1O3QA 2CO5A 3HRMA 1F4KA 2RN7A 1K6OA 3H3UA 1CF7A 5JHUA 2VT2A 1C0WA 1I27A 1R23A 1RNLA 2L3DA 2OBPA 2OQGA 2XROA 2VC0A 1J2XA 3DPLC 2COMA 2BYVE 2EA2A 2ESNA 5BMZA 3QP5A 3ZMUA 3E3VA 5JR3A 5LHHA 1HKTA 1O3RA 1JXSA 2HS5A 3BPXA 1ON2A 3ECOA 1SFUA 1G4DA 2WV0A 1BIBA 3PQJA 3WTSC 5E1XA 5E18F 4B8XA 4PDKA 2XIGA 4CXFA 1U78A 1RZ4A 2Y0MA 2ZCWA 1D5VA 3NEUA 5H6RA 2DW4A 2RV8A 1TNTA 2XASA 4A0XA 1JHFA 4ENMA 2G7UA 2OD5A 5DEQA 2NNYA 2DPDA 3JAMZ 1X3UA 1HW1A 3F21A 5J6XA 3M1EA 4RB0A 2RGVA 5LGUA 4JQFA 5D4SA 5FD5A 3I0TA 2E7WA 2OZ6A 1GVJA 1ZYRF 4RAZA 2A5YB 3L9FA 3HRSA 4KIBA 5HDGA 4KDPA 1PP7U 2LF7A 3QOPA 1U3EM 1SAXA 4CICA 2ZO4A 4HX8A 1ZLJA 4P96A 2EB7A 4Y17A 4WWCA 4MQ9F 2IA1A 4LLGF 1HW5A 4U88A 2JTVA 2IPQX 1XGNA 2EFPA 2KRFA 1ZN2A 3J7AO 1LEBA 3BJAA 3DKWA 3WGIA 2STWA 4OIRF 1MKMA 1YG2A 3LAPA 1HXDA 5DV5A 3I54A 2H6CA 1J75A 2DFIA 3KLOA 4LMYA 3GZ6A 2VE9A 5JFRA 3Q9VA 2PLYA 4EJWA 5D6FA 1Q1HA 2ISYA 2FNPA 4YFNF 2PFBA 2H09A 5D5UB 4ENKA 1FYKA 5HLHA 1OMIA 3E6DA 4LFUA 1D8KA 4IF4A 5LLQA 3FMRA 3ZMSA 1TW2A 4YIFA 5F64A 3C18A 4OIQF 2L54A 2YR2A 4A5NA 3G3ZA 4G7OF 1XN7A 5E8GA 4MTDA 1I1SA 1W4MA 3QP6A 4RB3C 4YIIA 3SHFA 5LHGA 1KQ9A 1YW8A 3GZ5A 1XSDA 4U7BA 1Z91A 4ASNA 2UZKA 2DAOA 3FZVA 2FRHA 4HLXA 2VONA 4OINF 5ILUA 3GEZA 3DP7A 2P4WA 3TKYA 4M6XA 4EVIA 2HYFA 2VT3A 3V7CA 1TQPA 3OOPA 2A6HF 1HQCA 2HYGD 4Q48A 2HDCA 4MNUA 4A5MA 3WGGA 4L0YB 3V8KA 2BEOA 4UNOA 5CVVA 2JT1A 2KJCA 3ZPLA 5H20A 4NHJA 1YLFA 1HW2A 3KZYA 3JTGA 3GVAA 1I5ZA 1TNSA 4MQVA 3LSTA 1O57A 5F1RA 2M1BA 1U5TB 3CUQC 1ZG3A 3VFZA 1S3JA 2GXGA 5K5QA 1H9TA 4NQWA 1QBJA 2EFOA 4L0ZB 4KFCA 3HYIA 2UXNA 3IL2A 2XAGA 2B0LA 1A04A 3RDIA 3VODA 1BJAA 1IZ1A 5D6EA 4EM0B 1Z6TA 4L9VA 1KQ0A 1P2FA 2PQ8A 3EETA 4HYEA 4RAYA 2P7CB 2EV6A 2HTSA 1KQ8A 1USTA 3MQ0A 1FYMA 1FBQA 1ZGJA 4G94A 2BE5F 4P9FA 3RPQA 3WU0A 2F5CA 3Q9SA 1I6XA 3RKYA 5HS9A 3F6OA 2Y48A 4IHTA 3K1MA 4ZZDA 1R22A 3E5XA 3TO7A 5D4RA 2ZNZA 4IRHA 4GO1A 1T2KA 3FXUA 2GQQA 1K79A 2DK8A 4LG0B 3KEQA 5ICGA 2W24A 4BHBA 4EMSA 1BI0A 3TDUC 1EH8A 3VEPA 3GW2A 4OMZA 5IT3A 1DPUA 4KNYA 1LNWA 3E6CC 1T38A 4M73A 3DF8A 1F5TA 1GXQA 2ZKZA 3R6SA 3RYRA 3REOA 4LB5A 2OU2A 2K4JA 3ELKA 2V1DA 4LG0A 4HW0A 1ODDA 2CW0F 4YFKF 4M74A 4GXOA 4EGYA 1B4AA 4R8HA 2FE3A 2QENA 4U0VA 4L5IA 3E6BA 1LDJA 1BI3A 3F3XA 4HA8A 1UB9A 3U2RA 2FBHA 4HX7A 1IRFA 2MBFA 3IKTA 5L3EA 2QZ8A 1Y0UA 4LK0F 3FHZA 1MGTA 2KIFA 2P6SA 1BBYA 3RIRA 4RGUA 1YQAA 5TJJA 2XV4S 2Z3YA 1V4RA 2J5PA 3CUQB 5FLXZ 2VBWA 3WTWC 4LD5A 4FX0A 4TV7A 2HOEA 1QO0D 1S6LA 5CVJA 3EDPA 4LGWA 2IRFG 3LAJA 2HWVA 3WTVC 4IPAA 4I7HA 4IVNA 4BYYA 4HAMA 2CYYA 1DPRA 1V3FA 4M9SA 3CUQA 2PMHA 4HZFA 1D3YA 1XGMA 3VOEA 2GA1A 3KZZA 3WE3A 2WWYA 3V4GA 3TDZC 2QLZA 4R1HA 1Z1DA 1G6NA 2IT0A 2MH2A 3TGNA 4B09A 1YW9A 1GXPA 5LRRA 2JPCA 1MJAA 3BWGA 3KP6A 2G7HA 2EFWA 1WWXA 4KIGA 2V6CA 5EEHA 2FEZA 3IC7A 4EJVA 2RC4A 3SXYA 2NNNA 1S7AA 5D5WB 1HSTA 5L3FA 1YO5C 1T39A 5IT9Z 2P5LC 3WGHA 3ZMDA 1ZHFA 4WF2A 2DQLA 2NAZA 1P4XA 1TBXA 3ISPA 2L4MA 3BDDA 2Z33A 2OAZA 3BROA 1XGOA 4WXHA 5KVRA 1ULYA 2LDUA 2XGXA 4M9ZA 3I59B 3F72A 1DDNA 1OKRA 2VN2A 1XCBA 3CTAA 2MH9A 1PUEE 5FGMA 1O7LA 1QZZA 1SMTA 2DLLA 3BPVA 3HSFA 2FMLA 4L9NA 3LA7A 2HKOA 3D5LA 3WTYC 4HF0A 1LEAA 3Q5FA 2V9VA 3I59A 3V7SA 2XVCA 2QUFA 1UHWA 1FPQA 3GWZA 1AWCA 2R7DA 1MJBA 2D45A 1WQ2A 4OIPF 3GFLA 1XSXA 2Z5UA 3M8EA 3KFWX 2J5OA 2VXZA 3RPUA 3QPHA 2BV6A 2XAHA 1BOAA 4BQAA 4KMUX 5ED4A 4HQEA 3P9CA 3O3KA 2QBYB 1KU7A 4RB1A 3CJNA 2XAJA 2Z99A 3TOBA 2DTRA 2YSRA 2FSWA 3ERED 4FX4A 1H9GA 2RDPA 3R61A 1J5YA 3MEXA 1FBSA 4MGRA 2HZTA 2Q2EA 4ON0A 1SFXA 1KU2A 4A6DA 2QBYA 4GYGA 5CVRA 1XDUA 2NS0A 1O7FA 3EYYA 4DQ2A 3F6VA 4CGZA 1G3TA 2IW5A 3JTHA 3U9GA 4AIHA 3K2ZA 4CDGA 4CHUA 1EH7A 3O2PE 2VOPA 4A0YA 5DCMB 2CG4A 2PBIA 4IHSA 1R36A 2A69F 1IRGA 1T0FA 3GUDA 2D1VA 4AWXB 3H92A 2X4HA 1F9NA 1U5TC 1JGSA 3B73A 3LA3A 5DCMA 1R1TA 4WK8F 4XLNF 4G6DA 1T98A 2IA0A 4HDVA 1PP8F 3IRRA 4HQMA 1LJ9A 1LVAA 3FXRA 3L00A 4I01A 2P5VA 3MCZA 4UV8A 3JSOA 4OU0A 5AIPA 5HDNA 1AOYA 2A3SA 4EQQA 2FQ3A 4MEXF 4I02A 2OQRA 2IVMA 4G7ZF 2M30A 4RGXA 1FBUA 4S04A 3TO6A 4I0BA 1J59A 3J81K 4EJUA 1IXCA 4BNCA 3TQNA 4Q47A 2QVOA 1FX7A 3KP4A 2JZYA 3SZPA 3RKWA 2ELHA 5AONA 2O8XA 1USSA 1B9NA 2PJPA 3P9KA 1QZYA 1W5TA 1SD6A 2YX7A 3L09A 2K27A 1YTYA 1CGPA 3ULQB 3WTTC 4GGGA 1RI7A 2GAUA 1XSVA 4RGRA 3EUHA 1BC8C 1R1VA 3RKXA 1O3SA 3FMQA 2VBXA 1T6SA 5D8KB 3COAC 2MD5A 1FNNA 2HQNA 1R00A 3ML6A 4ZYEA 1OYWA 4PZJA 1KYWA 4UUVA 4HX4A 2RQPA 5FFXA 1IXRC 2IA2A 4ZH4F 5K5OA 2A61A 2YU3A 1W7PD 2VE8A 1YS7A 1EV7A 2F2EA 3RI4A 1ZRDA 3FM3A 4YG2F 4WXDA 3ROUA 3NQOA 1ONVA 2OZUA 1MD0A 1LQ1A 1B59A 4LK1F 1B9MA 3QPTA 1P6RA 5J8CA 2QQ9A 1ZGAA 4KIFA 2Z9OA 5K5RA 1R58A 5L3DA 4N9IA 1F1ZA 4IJAA 1U5TA 2CFXA 5HS8A 2EWNA 3ZQ7A 2V1UA 2O3FA 4NB5A 3K1NA 1BI2A 4GCVA 2A6EF 4YFXF 5JI6A 3WU1B 1BN5A 1HBXG 4AIJA 2NRAC 5DCFA 4L5JA 1J0RA 5BS6A 1TTYA 3F8NA 1R5HA 4EJTA 3M8FA 3T8RA 3J80K 5A2QK 4EM2A 4N9HA 2JPBA 4Q4ZF 2FBKA 2MC3A 1IXSB 3RJPA 1H0MA 4HV6A 3M9AA 2HTJA 2TDXA 2XRNA 4O3MA 4G7HF 2WTEA 3BZ6A 2DI3A 3T0YA 3SQNA 3GLXA 2FXAA 3QU3A 2FMYA 1IN6A 2GZWA 1KYZA 4WCGA 1UCRA 2G9WA 5E8IA 4I09A 4U7DA 3WTZA 1O3TA 2VODA 4G6QA 2KIUA 4BXUA 1ZG1A 1FP1D 3GXOA 4IXAA 4UHTA 1L0OC 1OYYA 2ESHA 1YFHA 1TLHB 4L9TA 5JVTA 2W57A 3S2WA 3V8JA 1QQIA 2FNAA 5L3BA 4WXCA 2QYOA 1IN7A 1NHAA 4EGZA 4I0AA 3SZTA 1G3SA 4LLLA 2XKOA 1ZLKA 1YS6A 4OIOF 3D0SA 2H27A 1RUNA 1UHMA 2QWWA 2STTA 1ZRFA 1BM9A 1U2WA 2Y75A 1Z7UA 1XDSA 4RS8A 4U0YA 1J7KA 4XSZF 5ERIA 4Y15A 4OOIA 3DEUA 3CLOA 4UV9A 4QWQA 5E1WA 4AIKA 2VC1A 5EEGA 2HQRA 4PGHA 3T5XA 1K7AA 3DXJF 1G3WA 4WX9A 1E2XA 5HLIA 2F5FA 1PDNC 3H3ZA 4UXNA 4O6JA 2WC2A 2KIMA 1Z9CA 2FU4A 4JBAA 1YW7A 3IKVA 2LKPA 1R1UA 5L3GA 3P7NA 2HEOA 2XHKA 1JE8A 2KJBA 3GO5A 4R79A 2O6GE 4UVAA 3U1DA 2P5KA 3F8CA 5ICFA 4BHCA 4CZZA 4CO8A 5KK1A 4LLNA 3GFIA 5LEKA 5ICCA 3KP2A 5J8FA 2JRTA 1CF7B 2BBYA 5BOXA 2ZMEB 3GFJA 1SFEA 3KP3A 1DUXC 4H0EA 3I5UA 2X0LA 4N0BA 1RUOA 5D5XB 5DDGA 2GXBA 1OR7A 1QPMA 3F8FA 3KP7A 1ZG5A 2EK5A 5HS7A 4I2OA 3ABTA 3TO9A 2ZMEA 5F6FA 3G73A 3RTRA 4GYIA 2RNJA 2XKPA 1FP2A 2W25A 2K7LA 1FOKA 1JHHA 1P4AA 1K78B 1UFMA 3ZMVA 2GA2A 3FXQA 5DYMA 3BY6A 1IUYA 3R0AA 1L3LA 4AD9A 1S29A 4QLCU 4CYDA 2CSOA 5E17F 5DUKA 4S05A 4LJZF 2EV0A 1FWZA 1K78A 1KU3A 4EJOA 4KN4X 5LGNA 4P55A 2MA3A 1R7JA 1TQMA 5BPDA 1MJ9A 3F23A 3E6MA 3QAHA 3DQVC 1TW3A 1HSJA 3MZYA 4XSXF 4A12A 3HSRA 1QGPA 3EYIA 4ESJA 4P9UA 1FT9A 2R7FA 1WKMA 4F7ZA 1SMYF 5CYVA 1IN8A 1XCVA 4U0WA 4HDUA 5LGTA 5LRSA 3ZMZA 4UVCA 1REPC 4EM1A 5BPIA 1G3YA 3JAMK 1LDKB 4JK1X 1BIAA 3VB2A 4L9JA 1S8NA 4HOBA 4L18B 2ISZA 1U8RA 5L3CA 2E1NA 1KGSA 3HHGA 2L01A 2K4BA 3HRTA 1U6GA 3BP8A 4XRFA 4ZZLA 2OA4A 4Q5SF 2XAFA 5DD4A 3P9IA 4KYWA 3N97A 3HIFA 3M7GA 3DV8A 4M72A 4D0PA 4AVPA 3WG9A 3I64A 4A6EA 3FX3A 3HHHA 2W85A 4I98B 2L02A 2VBZA 2RKHA 4HF1A 3KLNA 3HUGA 3KCCA 3HOTA 5CLSA 1MZBA 3N4MA 3TOAA 3T8TA 1WI9A 2EA4A 3CO7C 4EV0A 3J81Z 4E70A 1XGSA 4A0ZA 4ZYDA 1FSHA 4ZYGA 2LSOA 2ZBKA 2M8EA 5ILVA 2HR3A 1IN4A 3MZHA 3MAJA 3KP5A 1LDDA 3JSPA 2ADUA 3WE2A 1WSUA 4ENNA 5FD6A 1XD7A 1ZAOA 1ZARA 4PCQA 2DBBA 3I71A 1KA8A 3NRVA 3LA2A 5LBQA 3R4KA 3E5UA 2EFQA 2VOOA 2HKXA 3FF5A 3MWMA 5ICEA 3BJ6A 5H6QA 4P5OA 3I53A 2FA5A 2P8TA 4FT8A 1KU9A 1FZPB 4KA4A 1B1BA 3W6JB 2BGCA 2A07F 2Q0OA 1FY7A 2DT5A 3V8LA 1W7PB 2DK5A 4ESFA 2QQBA 2MLGA 1ZREA 4HBLA 3BOQA 5LEJA 3GX4X 3K69A 2KKOA 2L4AA 1IW7F 2O0YA 1FSEA 3IHUA 3SFZA 5AIQA 4HV5A 2GIVA 5FFZA 4M6YA 3K0LA 3RYPA 1DP7P 3CDHA 4M9XA 2PI0A 1W7PA 1GHCA 2K86A 5DUIA 2HFHA 3C1DA 1B6AA 2AXLA 2CQKA 4LB6B 4RGSA 6PAXA 2P6TA 4Y13A 2DQRA 2ZXJA 3E5QA
chains in the Genus database with same CATH superfamily
4KISA 2IEKA 2LRSA 4Q28A 3HOSA 4DR5E 4KHPE 4O5VA 1PJSA 4E6KG 4LF5E 2H36X 2L8TA 3LFKA 2L0KA 2F5VA 4XMYA 1RRJA 4ZYHA 2UWMA 4BU2A 1RIOH 3IWCA 3GYHX 2LBFA 3CCEI 3OYEA 2ZXWH 2ZJ2A 2JA5J 3E97A 3FM5A 1A6QA 1S7OA 2KOUA 4MTEA 2OPTA 1FLIA 1IAWA 4LIUA 4ESBA 1G8XA 1HKQA 2DTZA 3ASNH 5LHIA 1STZA 2G0EA 4XRSA 2HDDA 2NUFA 1WJ5A 3ZN0A 4O4KA 2GWRA 1Z67A 3QU6A 5D5VB 5HNHA 3IP4B 2ZNYA 2YX4A 4UVBA 1TQIA 4B4CA 1VQNI 4CYCA 3CUOA 1P7IA 1XMAA 2L9NA 5CVUA 2VLAA 1H89C 4ETSA 1MSEC 4QIWN 4JV5E 4RM2A 3G2BA 4E7JA 4V2FA 2LF8A 4FHTA 4UB8C 3J80Z 3L2CA 3CO6C 5A2QZ 2R0QC 2QM3A 2XUBA 1VTNC 3R60A 1WRJA 3B02A 1UJ8A 3KEOA 4NXME 2PEXA 2DA4A 4ENJA 2V79A 1UZCA 3AFHA 3PQKA 3HC7A 1TC3C 3CMMA 3C7JA 4KMFA 3LSKA 1E3OC 3P5JA 2DPUA 3IWFA 4M71A 2OJED 2YTIA 3LFUA 3F9KA 2GLOA 2FUG2 1BI1A 3MKYB 4HLYA 4Y7NJ 4XBFA 3BG9A 1MDMB 4DR1E 3BGHA 1ZU1A 2BVLA 2W84A 3Q0WA 1YYVA 1E17A 3BCAA 1JTXA 2P7VB 1ERDA 4XLPF 2DA6A 2NOGA 2CGPA 1FC3A 2VRDA 1ZAAC 3DEEA 1HNXE 1Z6RA 3RCOA 3T1YE 5ILSA 3L2VA 4K2EA 2H6BA 1JK2A 2E1MB 4MLVA 5AC5A 3U1KA 2QQAA 2D1HA 1YOVB 3WHCA 1J9IA 4PGGA 5CJ9A 3OV8A 2K3FA 3QWLA 1RQ0A 1W5SA 1BC7C 4II2A 2CTDA 2PN6A 2ELZA 1HKSA 3FWEA 3D1NI 4KT6A 3FMSA 1MDMA 3W6KB 1IF1A 3GBGA 3H9QA 3WODF 1QHGA 1LB2A 3WTXC 2UXXA 2HOAA 2DO7A 4LTYA 1IN5A 4ZDPA 2ZFWA 3ECHA 2I9IA 1RC9A 4B3ME 5FO5A 3GFMA 2Y30A 2DCEA 4IHWA 3H9GA 3JW4A 3HJEA 5IY5H 4DV6E 1YIOA 2RVCA 1D8JA 2M5WA 3OMYA 3A4CA 2ETHA 1LVKA 3K1PA 2K02A 1SAUA 3IWZA 1P92A 4MHGA 4RM3A 3IAM2 5E1ZB 3LQRA 2YUSA 2M87A 2EPAA 3I58A 5TRDA 3R0JA 4OAYA 4GKKE 2DLKA 4I6ZA 4XORA 4DV3E 2YRKA 3AKZA 2W7NA 4XLFA 2BZTA 3LWFA 2DA3A 2IP2A 2AS5F 2EJRA 2DSYA 3HRUA 2NABA 3EPHA 2NS7A 2GOXB 4J01A 3KE2A 1ZK8A 5HVQC 1JI8A 4FTHA 2EMAA 4IRGA 2M8GX 3AAFA 1YITI 2LNBA 1MMAA 2MABA 4RLFA 1EH6A 2O03A 1JJ8C 3T1HE 1XTAA 3O6BB 5F3WA 4PSWA 3A2KA 3IH2A 5GPAA 4HTGA 3F8BA 1NG7A 2O61A 4G8XA 3CJQB 2M7AA 1QNTA 1Z05A 2FBIA 1SVOA 2IGKA 3CC7I 2BW3B 2LH9A 3OS0A 1ZH5A 1OYIA 2N3GA 3DBLB 4DV2E 2VBYA 2Q8UA 5HLGA 2EV5A 2V1XA 4HG2A 3EPLA 4KT5C 3OIPA 5FLXK 4KUMA 1ON1A 1FYLA 1SD7A 4IRIA 3ZN1A 3WTUC 2LREA 2R3SA 2X6WA 3QRFF 2ZFUA 5GTHC 2JSCA 1SD4A 4BHPA 3LQQA 1XB4A 5IOZA 2M7BA 2DU9A 2DYRH 3DPTA 2ACJA 2HDWA 2WAFA 3M07A 2PG4A 2NYXA 3V7RA 1A1FA 4HF2A 2UUZA 3PNTA 4MEYF 4DJAA 2BHYA 1IRZA 5BR8E 3WG7H 4CUGA 1U9OA 2HGCA 1IGNA 3DFGA 3IUOA 2HPMA 3A01B 2VQFE 4DNCA 3LSRA 2BW3A 2MLKA 2E1CA 1FJLA 2DLQA 4A2UA 4R2EA 2EM9A 1P4WA 5K1YA 1X6FA 1GDTA 3T1BA 3JRCA 1R4NB 1N77A 5T6JA 4RA2A 2KT0A 3JR9A 3KWRA 3TP0A 5FB2A 5E20A 3E0JB 2D2WA 5DS9A 2F5EA 2CH0A 1MBFA 3HOYJ 3K9TA 3PFIA 4PJMA 1SVLA 2L5QA 5J1RA 2CRGA 2F5DA 3A0BC 5E3MA 2HVSA 2C6YA 2Y31A 2FX0A 4OMYA 3EQLF 2EN3A 4OOGC 3F22A 2FOKA 5D8LB 1Z77A 5EJCA 3FIWA 2ENAA 2X1CA 3HGYA 2VJJA 3GLLA 3A01A 1QHHD 3S2HJ 5IV8B 4D1QA 3F8MA 3GTQJ 2CUEA 1I1GA 2FF4A 4DYCA 2LT7A 1A1JA 1EA3A 3L7WA 3ZP5A 1X1CA 2YPRA 3HZJA 1ZRCA 2LBSB 1GV2A 1XMKA 2IJLA 4Z2YA 3OYFA 3HSEA 1N33E 5HDKA 3PFYA 3RQIA 1R5GA 2E2HJ 2KPMA 4W1UA 3K4JA 3ABUA 4RB2C 1TZLA 3M4OJ 2H94A 3KETA 2FOWA 3FXLA 1HA8A 5CVIA 5DD8A 3BC8A 2EFNA 1UILA 4XR6A 4O5GA 1OPCA 2VUMJ 2PMUA 1N75A 4K0KE 2XAQA 2VPRA 3C3WA 4LOCA 3MFKA 5B1AH 2HXOA 3HPGA 4A69C 3IRQA 4BH9A 2VQEE 1B69A 2R7RA 4S0HB 3HOVJ 2LUQA 3GF2A 4G9YA 3K70C 2E7XA 2M45A 3HTSB 3PL8A 2MKNA 2YTQA 4V2GA 4YHHE 5IT9K 3ZMTA 1EKZA 2VL8A 4KICA 3BJOA 1SD5A 2Z16A 3HTUA 2A68F 3J7AY 5BQTA 4FK5C 3CCUI 2Q8KA 1BR2A 5HOOA 4BAYA 2EPNA 4KN7X 2COBA 3M99B 2BY0A 3I4PA 1ZR9A 2CWEA 1O3QA 2CO5A 3HRMA 4JX6A 4M6VA 4UY8I 2DJIA 2DA7A 4PJNA 1Z7LA 2I13A 1F4KA 2RN7A 1K6OA 1A5JA 1WVRA 3H3UA 1W5CC 1CF7A 4PJJA 2VT2A 5JHUA 1STUA 2EPCA 2IGNA 1C0WA 1I27A 3FIGA 3H9JA 2EMWA 1R23A 2VQLA 1RNLA 2LKXA 1W36C 3CP8A 2L3DA 2OBPA 4Z6YA 2OQGA 2EOIA 3LNQA 2R1FA 1TT5B 4Y33A 1MMNA 2CJJA 2XROA 2VC0A 4II3A 1J2XA 2YSOA 1MEYC 3DPLC 3SEZA 1FJGE 2COMA 2BYVE 2EA2A 3J7YJ 4L5EA 2ECCA 2ESNA 5KHDA 1X3CA 4BMJA 1DU6A 5BMZA 1IV8A 3BBGA 4DR4E 3QP5A 3ZMUA 5FLVA 3E3VA 5JR3A 2JVGA 5LHHA 1V54H 2LKSA 5LD2C 1HKTA 1O3RA 1JXSA 2LE2A 2HS5A 2XPUA 2FJ1A 4ZDLA 1MSFC 2YZTA 3BPXA 5CFFE 5K7FA 1ON2A 3ECOA 1SFUA 1G4DA 2WV0A 2JJ7A 4AU7A 1BIBA 1S7EA 3BR6A 3PQJA 4A3KJ 1I39A 2L9VA 3WTSC 5E1XA 3QQAA 4B8XA 5E18F 5IYDJ 2FGGA 4ZDOA 4BJTA 4PDKA 5A6KA 2XIGA 3OYDA 2DMPA 4CXFA 1U78A 4BE2A 3H3VK 4JI1E 2VKEA 1D1BA 1RZ4A 2Y0MA 4BCAA 2ZCWA 4YIRX 1D5VA 3NEUA 4W97A 1TWFJ 5H6RA 1FTTA 2DW4A 4MIMA 4CZCA 2RV8A 4R2SA 2YT4A 2LMZA 3NWTA 5FJ8J 3JRBA 1TNTA 2JOXA 2XASA 1ETOA 4A0XA 1RKTA 4RHBB 2X48A 4XLCA 1JHFA 1VNDA 2DYSH 2JA8J 1I6HJ 4L8NA 2QSGX 2EM4A 3JTZA 5IWAE 3KIOA 1YJNI 3OYLA 3CMEI 2G7UA 2DA2A 5GAGJ 4ENMA 2OD5A 5DEQA 2EN7A 2Y0SN 2NNYA 3D5RC 3AL0C 2VIXA 1Z3XA 3ZQLA 2DPDA 2YPNA 3JAMZ 2W82A 2V26A 1X3UA 2EQRA 1HW1A 4M3GA 4BC7A 1TF3A 1G59A 2EPLX 5EZGA 2YRHA 3F21A 5J6XA 3C6KA 3M1EA 4RB0A 1GLNA 2EZKA 1S5LC 2RGVA 3TL4X 2EIJH 5LGUA 4JQFA 4OWRB 2VQHA 5C4XJ 5D4SA 5FD5A 3I0TA 2E7WA 2YU8A 5F0HA 4LFCE 2IS2A 2OZ6A 3L2UA 5B3SH 1GVJA 1ZYRF 2ZB9A 4RAZA 3CC4I 3IWDA 2A5YB 3L9FA 1X6EA 3HRSA 4B3XA 2MDRA 2R7WA 2EE8A 2K9LA 1UHZA 1HNWE 4KIBA 5HDGA 2EM0A 2CW7A 1WHNA 4KDPA 2HNHA 1PP7U 2LF7A 3QOPA 1O4XA 1U3EM 4B3SE 2LY1A 1SAXA 4BS9A 2OTJI 4CICA 5J4YA 2ZO4A 4HX8A 2ELKA 2DJNA 1ZLJA 4P96A 2EB7A 4Y17A 4WWCA 2I10A 1IQSA 3CCJI 5KAFC 1A1LA 3ASOH 2FQ4A 2IA1A 2O7OA 4MQ9F 4M2ZA 4LLGF 4FCYA 1HW5A 4U88A 2JTVA 1VZ0A 2IPQX 1XGNA 2EFPA 2KRFA 3LOCA 1ZN2A 1MMSA 3J7AO 1X1PA 3K4MA 1N78A 3BJAA 3DKWA 1LEBA 5KL6A 3WGIA 3ZQIA 1OQYA 1A35A 2CV2A 3MZ8A 2STWA 5F0FA 2OF7A 1MKMA 4OIRF 2RAEA 4X8WA 2R5ZB 1YG2A 4DV1E 1IO2A 3LAPA 3BF2A 1RR8C 1HXDA 5DV5A 3I54A 4MLOA 1WPKA 2DMQA 1F2IG 2H6CA 2K40A 1J75A 2E35A 3BG3A 3ZQQA 2DFIA 3KLOA 4LMYA 2K9MA 1CQTA 4IHVA 2NXNB 3CMAI 4IX7A 3GZ6A 3S2DJ 3QG5C 1X5WA 1FKAE 3SYTA 2VE9A 5JFRA 3GTMJ 1GV5A 3Q9VA 1YJWI 3ABMH 1IJWC 1A31A 2PLYA 3K4LA 2LOOA 2XB5A 4EJWA 5D6FA 4XONA 2R5ZA 1Q1HA 2ISYA 2LTPA 2FNPA 4YFNF 2PFBA 3BZCA 2H09A 4N4RB 1F36A 4ZJZA 4AVZA 5E3LA 5D5UB 4ENKA 1FYKA 5HLHA 1YYOA 2EMIA 3PUBA 5IP7J 5EEAA 1OMIA 3UR3C 2DT7B 3E6DA 4LFUA 4WYQB 4BXFA 1D8KA 1FTZA 4IF4A 3QOEA 3DTKA 3E7LA 5LLQA 3FMRA 3ZMSA 1TW2A 3BCBA 4A3GJ 4LF8E 3MKLA 4YIFA 5F64A 3C18A 1TP4A 1X49A 4DR2E 3EPKA 1A1HA 2BY2A 2EMXA 4BJ6C 4OIQF 1JK1A 2L54A 2YR2A 2VF1A 2RTXA 4A5NA 3G3ZA 2CQNA 5CKTA 2EPOA 1WHQA 4G7OF 1XN7A 5E8GA 4MTDA 1I1SA 1W4MA 4F9AB 1X2MA 3OIOA 4PJLA 3QP6A 2B63J 4RB3C 4YIIA 1T95A 2F4MB 1V5EA 3THOB 3G6EI 1V5GA 5F04A 1LFUP 3HL2A 3SHFA 5LHGA 4F9CB 1KJKA 1KQ9A 1YW8A 3ADIA 3GZ5A 3PSFA 3MKZA 5M5WJ 1XSDA 2Y0SA 4U7BA 4BE0A 3K6QA 5J3LA 1XMXA 3A03A 2E1MC 4FASD 1Y56A 1Z91A 4J19A 2EMGA 4ASNA 2UZKA 2DOEA 3AL0B 2DAOA 4F54A 2YWQA 3FZVA 2A5WA 3SFIA 2EQ0A 2UXCE 3CCLI 2FRHA 2R4GA 3AG4H 4HLXA 3H5RA 2UUCE 4B47A 2VONA 4OINF 2KMUA 4HNUA 2TRTA 3S3OA 5ILUA 2LVSA 3GEZA 2FV4B 3S1MJ 3DP7A 3A02A 2P4WA 2AO9A 3TKYA 1ETQA 1H88C 2VB6A 4M6XA 2YTNA 4EVIA 2CT1A 3HG9A 2LV2A 2HYFA 3H09A 1ENHA 2VT3A 3V7CA 1TQPA 3UNGC 3S15J 3OOPA 1ETXA 1QPIA 1UHSA 3B6AA 4C2MJ 3CC2I 2A6HF 2JR1A 2WBUA 1HQCA 2DMYA 2HYGD 4Q48A 2E71A 1WJAA 1JGGA 5CQGA 2HDCA 4MNUA 2CUJA 3WGGA 2KRHA 4A5MA 4L0YB 4NQWB 2EBIA 2ZM6E 3V8KA 1N36E 2PMZN 1TL8A 2BEOA 3WHBA 4UNOA 5CVVA 1M1EB 2JT1A 2KJCA 3M1CA 3ZPLA 2XF6A 1ETVA 5H20A 4NHJA 1YLFA 1HW2A 1LLMC 1X4OA 3KZYA 3JTGA 3GVAA 1D0YA 1I5ZA 1R5ID 1TNSA 1D0XA 3CMYA 1BR1A 2R76A 5AASA 4MQVA 1WJDA 3LSTA 4YY3E 1O57A 3A0HC 1MBEA 3KPHA 5HODA 5EDNA 1AU7A 5F1RA 2M1BA 1A1IA 1MBKA 1XNQE 1U5TB 1PJRA 5EG0B 3CUQC 1ZG3A 3VFZA 1S3JA 2GXGA 5K5QA 1H9TA 4NQWA 1QBJA 5J4VA 2EFOA 4L0ZB 3MHHC 4JX5A 4KFCA 4C9YA 3HYIA 2UXNA 2WY7Q 2UXDE 3IL2A 2XAGA 3GTKJ 2EOYA 4QTRA 2HGHA 2B0LA 1A04A 3RDIA 3VODA 2Y9YA 2NUGA 1WFXA 1BJAA 1IZ1A 5D6EA 3TMOA 3MVPA 4EM0B 1LFBA 4CCOA 1Z6TA 4L9VA 3H0DA 5C4JJ 3V42A 2VJIA 1KQ0A 1P2FA 4A93J 2PQ8A 3EETA 4HYEA 2RREA 5J40A 5EG0A 2B9SA 2NVYJ 4RAYA 5EZHA 2P7CB 3JRIA 2EV6A 2HTSA 1KQ8A 1USTA 3MQ0A 2R7XA 2JA2A 1FYMA 2CPNA 4DMIA 1IQOA 2EZLA 1FBQA 1T4OA 2HVRA 1ZGJA 4G94A 2BE5F 4P9FA 2QA4I 3VWBA 2E5ZA 3RPQA 3WU0A 4BBRJ 1IMUA 2F5CA 3Q9SA 1I6XA 2KZGA 3HOWJ 2EMFA 2QCOA 3RKYA 5HS9A 2EQ1A 3DLAA 3F6OA 3W3CA 2Y48A 4IHTA 3K1MA 1IDYA 4ZZDA 1R22A 3E5XA 2LLKA 3TO7A 5D4RA 4MFEA 3OYGA 2ZNZA 1R49A 5CQEA 4IRHA 5A6BA 2DA5A 1O0WA 2GOMA 4GO1A 1T2KA 3FXUA 2GQQA 1K79A 1PJQA 4DV7E 2DK8A 4LG0B 3CCMI 2HXIA 3KEQA 5ICGA 2W24A 3OWTA 2MFZA 4BHBA 3BLYA 4EMSA 1BI0A 2RQQA 2XB0X 1EH8A 1MBHA 3TDUC 4A3IJ 4QPOA 3VEPA 4ABZA 3CESA 2EPUA 3GW2A 3IWBA 2HU9A 4OMZA 5IT3A 1DPUA 1UMQA 4KNYA 1LNWA 2EM3A 3E6CC 5JHFA 1T38A 4J00A 4M73A 2EM8A 4A3CJ 3LL7A 3DF8A 2BHZA 5K7HA 3JRAA 2E1OA 1F5TA 1GXQA 1AA7A 3ESWB 2ZKZA 3R6SA 5CPRB 3RYRA 4DUYE 1VF9A 3REOA 4HNTA 4LB5A 2OU2A 4O43A 2K4JA 3ELKA 2X9DA 3EQ1A 2V1DA 4LG0A 3VYYA 2ZJQF 4HW0A 3THNA 1ODDA 2CUFA 4CCJA 1TWGJ 2NVXJ 1MMDA 2CW0F 3VSLA 4M74A 4YFKF 3JRGA 2L9SA 2YTDA 4GXOA 4XK4A 3S32A 1B4AA 5JVGF 4EGYA 1UELB 4HPQA 4R8HA 2IBDA 2FE3A 3TEDA 3BTJA 4IO9F 1OCZH 1UBDC 2E1MA 3C2GA 2QENA 4U0VA 4XNFA 3C6MA 4L5IA 3ONQA 3KYDB 2K9QA 2O8KA 2ZC2A 3E6BA 3VYUB 1LDJA 1BI3A 3F3XA 3PUFA 3QYEA 3AUZA 1MNEA 4HA8A 1UB9A 2I5UA 2FBHA 2V9PA 2W48A 3U2RA 2GXAA 4HX7A 2PMZA 2OC6A 4A3JJ 3P1XA 1VQKI 4L5NC 1IRFA 2MBFA 3IKTA 5L3EA 2QZ8A 1Y0UA 2BB8A 2HI3A 3PM1A 1WI3A 4LK0F 3C2BA 2DB2A 2EMBA 4XKWA 3FHZA 3G71I 5M5XJ 3HPZA 1MGTA 4KITB 2JQ7A 2DODA 2KIFA 2P6SA 4GRIA 1BBYA 1AH5A 3J7AG 4NC7A 5JLWA 3RIRA 4EEFG 4RGUA 2YTEA 3TQMA 1YQAA 2L7ZA 5TJJA 2XV4S 4R2DA 2Z3YA 2EMCA 1V4RA 2Y9ZA 5DNYA 3E1SA 3KEYA 3VYSB 4M9VC 2J5PA 2E2JJ 1A1GA 4IZZA 3CUQB 2H1LA 2VBWA 5GAEJ 5FLXZ 3WTWC 1OJLA 4LD5A 2LUPB 4E7LA 3JREA 4FX0A 2AQEA 4TV7A 4DYRA 2X6OA 5F1JA 2HOEA 5FRMA 1QO0D 1S6LA 3FK6A 5CVJA 3K6GA 4DIQA 2K5CA 3EDPA 4LGWA 2CW8A 3QYBA 2IRFG 3LAJA 3L2WA 4H4KC 2HWVA 2NVTJ 4R8OA 3WTVC 3DWLE 4V19K 1MMGA 2Y2ZA 2ADRA 3VYXA 4IPAA 4I7HA 4IVNA 2ELJA 3OMLA 1I3QJ 2R7ZJ 4BYYA 3NAUA 5FLXC 2EWLA 2EL4A 2BY1A 1ITYA 4X66E 3GCMA 4LG3A 4M3FA 3CCVI 4HAMA 2CYYA 4I76A 1DPRA 2MC5A 2CV0A 2EORA 1V3FA 4M9SA 4XLEA 3CUQA 3G4SI 2PMHA 2R5YB 2E19A 1D3YA 4HZFA 2YRMA 1XGMA 3VOEA 3DPUA 2AXTC 3S17J 2GA1A 2X85A 2V88A 3I4MJ 3KZZA 1JKPC 5KL2A 3WE3A 2WWYA 3W2VA 5F08A 3V4GA 3TDZC 2QLZA 4BGDA 4A3MJ 2B7VA 4R1HA 3EPZA 4IJDA 5GADJ 4JI6E 3BTCA 3FBIB 4DR6E 5DM6F 1Z1DA 2PJRB 4DOZA 2AHQA 1G6NA 2H1KA 1R71A 2IT0A 2H8WA 4D7NA 4LFBE 2MH2A 2QEXI 1SVMA 3G1MA 4PJ0C 3TGNA 4RBOA 2QGUA 1QRYA 4B09A 1JKRC 1YW9A 2WY8Q 4IS1C 1J5EE 2R5YA 1GXPA 3BZKA 5LRRA 2UXBE 2JPCA 4BY7J 1RMDA 2HQAA 1MJAA 3BWGA 2VKVA 3FHNA 2E60A 2L7FP 4XRMA 3KP6A 1VQ4I 2ME0A 3FXMA 4FETA 2G7HA 1DGWY 2EFWA 1ETWA 3O8HA 1WWXA 4KIGA 2V6CA 5EEHA 1T0FC 2FEZA 3IC7A 4EJVA 3S3NA 2RC4A 3SXYA 2DDAA 5FROA 2PJRA 3OTOE 2NNNA 2IS1A 3QPLA 1E3HA 5AC4A 1TF6A 1S7AA 5D5WB 2IAIA 3DBHB 3KYCB 1UN6B 2RSMA 3H35A 2DMNA 2XSDC 1LE8B 1HSTA 2LYCA 5L3FA 1YO5C 2TCTA 2XSJC 1T39A 1HF0A 2JMWA 1YYKA 5IT9Z 2M9HA 4X6AJ 2P5LC 4KZSA 3WGHA 3ZMDA 4GKJE 1E0EA 4I8OA 1ZHFA 3GTPJ 1GTKA 3AG1H 4WF2A 2Z2SB 2DQLA 4AIDA 2NAZA 4ZYAA 2DDBA 4CSWA 1P4XA 1TBXA 3ISPA 2BBGA 4JI5E 2L4MA 3BDDA 2V83A 2R7VA 2Z33A 2OAZA 5IT9C 3BROA 1XGOA 3H36A 4WXHA 5KVRA 2R7TA 2EPZA 1ULYA 1ETYA 3CZ6A 4F6NA 2LDUA 3JRHA 1FOXA 2XGXA 4M9ZA 3TW7A 2ZJPF 1LE8A 3I59B 3F72A 3DF6A 3WU2C 1DDNA 4M30A 1OKRA 2HOTA 2DN0A 2VN2A 1XCBA 3CTAA 4HEIA 2MH9A 1PUEE 2ID6A 3IAS2 5FGMA 1TWCJ 3IH3A 4NC6A 1O7LA 1QZZA 1SMTA 2DLLA 3BPVA 5DTDA 1I94E 1DI2A 1JT0A 4XKBA 3HSFA 2FMLA 4L9NA 3LLHA 1OCCH 1IG7A 3LA7A 2YTPA 4B3TE 3CJTB 2EPMX 2HKOA 3D5LA 3WTYC 4HF0A 1RESA 2M0CA 2V4JC 1N3GA 2L3JA 1LEAA 2Y69H 2LK2A 1WJBA 1B8IB 3Q5FA 3IH4A 3J7Yp 5J1YA 4PSXA 5E3OA 1SEUA 2NVQJ 2V9VA 3I59A 3V7SA 1RC7A 4NHRA 2JUGA 2HHHE 1JUSA 3N05A 3U21A 2EMKA 2XVCA 2QUFA 1UHWA 1I3AA 2BOLA 2CFOA 3H1CA 1K83J 3RSNA 1FPQA 3GWZA 1AWCA 3CCRI 4C2TA 1QU6A 2UUBE 2R7DA 1MJBA 3AG3H 2D45A 3GTLJ 1WQ2A 1V5FA 4OIPF 3GFLA 4XKVA 1XSXA 5M3MJ 3FXJA 2Z5UA 3M8EA 2JP9A 1S9HA 2V9KA 3ZCOA 2DIXA 2LP0A 5HLTA 3KFWX 5GPCA 2J5OA 2VXZA 3RPUA 3QPHA 1EF4A 3VK6A 2Q1ZB 3PNYA 2BV6A 4R2CA 2XAHA 1RETA 1BOAA 4X1EA 2EZ6A 4C3HJ 2IGOA 4BQAA 4JI8E 2J7JA 5IP6A 2Q2EB 2OCCH 4KMUX 2XPVA 5ED4A 4HQEA 3OSGA 2EN1A 4I99C 4WFTA 3P9CA 2LTSA 3O3KA 1W0UA 2QBYB 4B44A 1KU7A 3EUHC 4BUPA 1X3WB 4RB1A 3CJNA 4XOPA 2KLOA 2XAJA 2Z99A 3TBIA 3OL4A 2QKMB 1HCRA 2LRDA 3TOBA 5IPAA 4IOCF 1R4MB 2DTRA 2YSRA 5IP9J 2FSWA 4F52A 3ERED 2B3TB 4LF7E 4BQOA 4FX4A 1XNRE 3BQYA 1H9GA 2RDPA 1ACIA 3R61A 1J5YA 1SFKA 3FK7A 2YS9A 1OCRH 3MEXA 2EQ3A 2L2NA 2F4IA 1FBSA 4MGRA 2HZTA 1WHUA 3BR2A 3OR1C 4PK4A 1WH7A 2Q2EA 1ORKA 4ON0A 2EOXA 4HRIA 4DGWB 4B3AA 1SFXA 1KU2A 2NA2A 1NTCA 4A6DA 2QBYA 2KFDA 1D0ZA 1E3PA 4X62E 4AQYE 5E3NA 4GYGA 2GM4A 2EZHA 2EM5A 5CVRA 4LF6E 2WAQN 4LFAE 1XDUA 2NS0A 4HNVA 1O7FA 3EYYA 4JYKA 4DQ2A 2BXYA 2NOJB 2KISA 1B72B 2EOSA 3F6VA 1JKQC 4GDFA 4CGZA 5KL4A 2XAUA 1TT0A 1G3TA 3X2QH 4DV5E 1Y39A 2IW5A 3JTHA 4PUSA 3U9GA 4AIHA 3K2ZA 1S72I 4P7DA 4CDGA 4D5FA 4CHUA 1EH7A 1ZR4A 1Z21A 1BOBA 3O2PE 2VOPA 1LUJB 2E34A 1TWAJ 4A0YA 5DCMB 2CG4A 2YTGA 1X47A 2LJUA 1WH5A 2L9RA 2LY9A 2PBIA 2H8RA 4IHSA 1R36A 2A69F 3ERMA 1IRGA 3W2WA 3BR5A 4J8ZA 1T0FA 3GUDA 1ZKGA 2D1VA 5GTIC 4AWXB 2CSHA 3HM5A 4ZTJA 2V8QB 4Y3OA 2M1SA 4BC9A 1B72A 2GBYA 5B1BH 3H92A 2X4HA 1FOWA 4RDUA 3FXOA 5AE1A 1F9NA 1A36A 1Y1VJ 3KYLA 2P81A 1U5TC 3I3LA 2CMPA 1JGSA 1DGCA 4X65E 3OYCA 3B73A 1V55H 3LA3A 5DCMA 1R1TA 4WK8F 4XLNF 4G6DA 1T98A 2IA0A 4HDVA 2KHMA 2WBMA 1P7JA 1PP8F 1HLVA 2N8GA 3OY9A 3OS1A 3IRRA 4HQMA 4HSTA 1LJ9A 2QF7A 2JA7J 2DFFA 2EOOA 3VYRB 3H5AA 1LVAA 2HOSA 3FXRA 1XMOE 2Z1DA 1K6YA 3L00A 2M3AA 3W2AA 2XGCA 2JA6J 4Y52J 4I01A 2P5VA 3MCZA 2XF5A 5FRNA 4UV8A 4JI0E 5F0CA 3JSOA 4OU0A 4A3EJ 1GUUA 4CH7A 2K3PA 4KJZA 2EJ4A 5AIPA 5HDNA 4JI7E 1AOYA 3RKQA 2A3SA 4EQQA 2FQ3A 4DW6A 2KRCA 5LMNE 4MEXF 2R7SA 2XGEA 2K4VA 2VE7C 3LSJA 4I02A 4AM3A 2OQRA 5KCMA 2IVMA 1LKXA 4G7ZF 2M30A 5FKMA 4RGXA 2EOZA 1IUFA 2K7IA 1FBUA 4S04A 2RSIA 1QVTA 3TO6A 4I0BA 1J59A 2VI6A 3PNVA 3J81K 4EJUA 1IXCA 2YSPA 9ANTA 3K4NA 3BIDA 4BNCA 2ODRD 3TQNA 2PX9A 4Q47A 2QVOA 2M7QA 1FX7A 1JUPA 3OYNA 1J09A 3KP4A 2JK3A 4NXNE 2JZYA 1X1AA 3SZPA 3RZOJ 3RKWA 3L1PA 3SZGA 1PUFB 3HXLA 1YX3A 2ENCA 3L2QA 2ELHA 2JUCA 2YU9J 5AONA 4RAFA 1ZGWA 1X1BA 2DT6A 2JVHA 2O8XA 1USSA 4E7IA 3VPRA 4BXXJ 1B9NA 2PJPA 3P9KA 1K61A 1QZYA 2I8DA 2EMZA 2F6CA 2R7OA 1R9TJ 1W5TA 1SD6A 2YX7A 3K7AJ 3L09A 4P78A 5TSEA 2K27A 1UG0A 4IOAF 1YTYA 1CGPA 2MYSA 4LF9E 1T33A 3ULQB 3WTTC 1FIAA 2CU7A 1WZ2A 3MSWA 4GGGA 4Q35B 1BB8A 1RI7A 2GAUA 1XSVA 4RGRA 1XMQE 2WAQA 3EUHA 1PUFA 2AQFA 1BC8C 2ELYA 1R1VA 3OYIA 3JCUC 3RKXA 1O3SA 3FMQA 5IYCJ 2VBXA 4D9JA 3CCQI 1T6SA 5D8KB 2KQRA 4UB6C 1BA5A 3COAC 3OYHA 1T08B 4B43A 4C3JJ 1VQMI 2MD5A 3NARA 2K9SA 5B5EC 1X2NA 2V89A 1FNNA 2HQNA 2ENHA 3S14J 4QPQA 1YIJI 1RR7A 1R00A 3ML6A 4E7SA 4ZYEA 4YRVA 1EJ9A 1OYWA 3Q0VA 4PZJA 1KYWA 4HEA2 4UUVA 3F6GA 1T4LB 4MFDA 4HX4A 3JU0A 2RQPA 5FFXA 2KL4A 1IXRC 3HTXA 2DOAA 2IA2A 2A05A 1N32E 1VQ6I 2CQ7A 1OLTA 4A3DJ 2EM2A 4ZH4F 4XM3A 3KZIC 5K5OA 2A61A 4XKCA 2X6XA 2YU3A 1W7PD 2VJ5A 3ZQFA 2VXDA 4XOTA 2D5VA 5AE2A 2WCC3 2VE8A 3SDBA 1QVUA 1YS7A 1EV7A 2F2EA 1XG1A 5IYBJ 3RI4A 5FKKA 1ZRDA 4DUZE 3FM3A 4YG2F 4WXDA 3BR1A 2EOEA 3ROUA 3NQOA 4YEJA 1ONVA 2OZUA 1MD0A 1LQ1A 4R2AA 1B59A 4JX4A 4LK1F 1B9MA 3QPTA 2LBFB 4NC8A 3OYMA 1P6RA 2UU9E 2M4IA 1YSAC 2EPRA 2EH3A 2DA1A 4P1WA 5J8CA 2QQ9A 1PKPA 4F9BB 2LD5A 1ZGAA 1SANA 2K9NA 2XDVA 3OOUA 4M3BA 2XGDA 4KIFA 1WGXA 3EUAA 2Z9OA 1IBME 2EIMH 4BL0B 3DLLF 2JWOA 1JJ6C 1F43A 1FIPA 5K5RA 2JSPA 2GHFA 1FMWA 3CCSI 1N34E 1R58A 5L3DA 4N9IA 1F1ZA 3FKJA 4CYCB 4IJAA 2MG4A 3UKGA 1U5TA 2CFXA 5BNGA 5HS8A 2JOBA 2EWNA 4YELA 3ZQ7A 1N25A 4DV0E 2V1UA 2O3FA 1UG2A 4NB5A 3ZQHA 2VJ4A 3K1NA 3LSHA 1BI2A 3HOXJ 4JI3E 4GCVA 2A6EF 4YFXF 5ADZA 4DZJA 3S16J 3HPSA 2WB1N 5JI6A 3WU1B 1BN5A 2X1EA 1XS9A 1HBXG 1NK2P 1UAAA 4AIJA 4B48A 2NRAC 1U9NA 4XICA 5DCFA 3I4NJ 1T8IA 5JLXA 4L5JA 1J0RA 4FE4A 3OIQA 4M3DA 5BS6A 1TTYA 4BACA 2GPIA 3F8NA 3JRDA 1R5HA 1Q1VA 3GMEA 4NZVA 1SR9A 4EJTA 3M8FA 3T8RA 3LMLA 4XRSG 5A6BD 3J80K 4PFPA 2E36A 1T56A 2VQGA 5A2QK 4EM2A 1FEXA 3CLQA 4N9HA 5AE3A 3MD2A 2JPBA 2RPCA 4Q4ZF 3PSIA 2FBKA 4NNJA 2MC3A 3QYFA 1IXSB 2V85A 3ADJA 5E79C 2EIKH 1YHQI 4LITA 3RJPA 3J80C 1H0MA 4AYBN 1BR4A 5A2QC 4HV6A 1OISA 3CQZJ 3M9AA 3S93A 2VQCA 2HTJA 4E7KA 2OTLI 2B9DA 3ZQCA 2IGMA 3HGGA 2TDXA 1MIJA 2CQQA 2F8BA 1PJTA 2XRNA 4O3MA 4G7HF 2WTEA 1FMVA 1NK3P 4GZNC 3BZ6A 3PIOF 2X1DA 5A69A 2DI3A 4XL9A 1WCMJ 3T0YA 1OCTC 1AHDP 3SQNA 2ECBA 3FDYA 3GLXA 1BL0A 4R2RA 4A3FJ 2FXAA 1Z1BA 3QU3A 2FMYA 1VQ5I 3ABKH 3K10A 3LSIA 5GP9A 1IN6A 1OR7C 4HSRA 3ZGKA 2GZWA 1KYZA 4WCGA 4DR3E 1JUMA 4CCKA 4OAZA 1UCRA 3RZDJ 1D1AA 2G9WA 4LU9A 3HPHA 5E8IA 4IKFA 1XPXA 1WXRA 2V1NA 4I09A 4R2PA 2ZMEC 4U7DA 3DTEA 3WTZA 1O3TA 2VODA 4IQJA 4FISA 4G6QA 1JKOC 2KIUA 3DTIA 3LMMA 4BXUA 4GEQB 1RKWA 1ZG1A 1FP1D 2ZSHB 2A25A 3GXOA 2OUMA 4IXAA 1GZ6A 4UHTA 1L0OC 1OYYA 2ESHA 3H0GJ 2EMLA 1GVDA 3J7ZI 1YFHA 3C4BA 1TLHB 2W4SA 4L9TA 2OV7A 4QSHA 4WPYA 1WJEA 5JVTA 2W57A 5J47A 3S2WA 3V8JA 1QQIA 1D1CA 3ADLA 2MKDA 1IBLE 5HNFA 1YI2I 2CV1A 2FNAA 2JPAA 5L3BA 3HQ1A 4ZTFA 1BW6A 1X4PA 2XPWA 4WXCA 2QYOA 1MNMC 1IN7A 2R7UA 3W6VA 1NHAA 2RNGA 2EPFA 4EGZA 4I0AA 3CDIA 3SZTA 1G3SA 1X1DA 2YTOA 1XX5A 1KONA 5M5YJ 2M9AA 4LLLA 2XRLA 1POGA 2XKOA 1ZLKA 1YS6A 4OIOF 1Y8QB 3D0SA 2EM7A 2H27A 2HYJA 5EGOB 2JWTA 1RUNA 3ZR8X 1UHMA 2QWWA 2KDZA 2STTA 2LFBA 3BG7A 2V6EA 1ZRFA 4C30A 1BM9A 1U2WA 1TWHJ 2Y75A 2F48A 2LCEA 2M34A 1Z7UA 3PJRA 4DV4E 1XDSA 3DKXA 4ITVA 2MDGA 1X58A 4RS8A 3RMPA 4U0YA 1J7KA 2WADA 3DJWA 4XSZF 5B66C 1DU0A 1MNDA 2HVQA 4Y15A 2QKLB 5ERIA 3OYJA 1G2HA 4BBYA 4OOIA 1APLC 2DFEA 1RPWA 2DOFA 1SC7A 4AC0A 2WB1A 4C2UA 2E2IJ 3ZOQB 3DEUA 1HDDC 5EGOA 1QA6A 3CLOA 1DP3A 4X9JA 2ID3A 4BY1J 1YJ9I 4UV9A 3CF5F 2FD5A 1Y8RB 3MMYB 4QWQA 3CD6I 2EP3A 5E1WA 2JVAA 4D7MA 4AIKA 2VC1A 4PFOA 5EEGA 3DU6A 5KL3A 1A1KA 2HQRA 4PGHA 3ECRA 3T5XA 1K7AA 2KHXA 2KZVA 3DXJF 4XLHA 3HOZJ 3OSFA 1G3WA 2L6MA 4WX9A 3OYAA 2HQ5A 2LTRA 2L2KB 1E2XA 5HLIA 2F5FA 1PDNC 3H3ZA 3EUKL 2NUEA 3ZRGA 4BE1A 4UXNA 4O6JA 2WC2A 2KIMA 1Z9CA 2FU4A 1YRNB 4AYBA 4DYQA 4XLAA 1VQLI 4JBAA 2HC5A 1YW7A 3M8JA 3IKVA 4NBQA 2LKPA 1R1UA 1IRXA 5L3GA 1ZR2A 1NCSA 3OS2A 5A6JA 4BEHB 3P7NA 2DGCA 2QQ8A 1G2FC 4IEJA 3K4BA 2HEOA 1NEIA 3SEQA 2QSHX 2XHKA 3CJRB 1JE8A 4CA0A 2KJBA 3BR3A 4DZPA 1MW7A 3GO5A 4R79A 2EM6A 3ZXSA 4M0VA 1VQOI 2O6GE 2O9LA 4UVAA 3U1DA 2P5KA 2WAEA 2EN4A 3F8CA 5ICFA 1YRNA 2A6TA 1HNZE 3BQZA 4BHCA 5M3FJ 4CZZA 3CF2A 4G6TB 2E5NA 3G1LA 3SJMA 4CO8A 5KK1A 2R92J 4LLNA 3RQ4A 3GFIA 5LEKA 5ICCA 3KP2A 5J8FA 2JRTA 4BEHA 2EOHA 1CF7B 3IV5A 2EPKX 1LPQA 2BBYA 3TP3A 2ZMEB 5BOXA 1W1WE 3GFJA 1I50J 1SFEA 3KP3A 5J1UA 3LSPA 1DUXC 3AV0A 4F55A 4H0EA 3I5UA 5LFAA 5K7ZA 2EZIA 3DBRB 5LMUE 2ZSIB 2X0LA 4FE7A 4N0BA 5KAIC 3TW6A 4DR7E 1OCPA 4XIDA 5C44J 1RUOA 5D5XB 2V7FA 5DDGA 2GXBA 2ME6A 1OR7A 1QPMA 2W1OA 3S1NJ 2ZXHA 1Z3YA 3F8FA 3KP7A 3CCYA 5H2FC 2EOQA 4JOMA 2LO3A 4C3IJ 5GAHJ 3I9V2 1ZG5A 2IS6A 2EK5A 5HS7A 2VPLA 4I2OA 3ABTA 3TO9A 4DBRA 2CS3A 2ZMEA 5IOYA 4BDYA 2BVMA 2B7EA 3ABLH 3H5NA 5F6FA 3RTRA 3G73A 3F0CA 3BR0A 4GYIA 2LJHA 2RNJA 5TISC 1YX5A 2XKPA 2LY2A 1FP2A 2W25A 2K7LA 2L92A 5KL7A 2GLIA 1J26A 1FOKA 1JHHA 1P4AA 1K78B 1UFMA 3HEFA 3BG6A 3GTGJ 3MHSC 3HOUJ 2E72A 1NH3A 2IHR1 3ZMVA 2M4GA 4BKXA 3SDGA 1K4SA 2GA2A 3FXQA 5DYMA 1YPNA 3BY6A 4F3QA 2EMYA 2ODRC 3MKWB 1IUYA 3R0AA 2JY9A 1L3LA 4AD9A 1S29A 2CUZA 4QLCU 1X6HA 4JYAE 4CYDA 4E4HA 1PVEA 1B8IA 2CSOA 1VQ8I 5FKLA 5E17F 4DKKA 1AAYA 3PO3J 1ZBTA 2XF7A 5DUKA 3OYKA 3S1QJ 4S05A 4O24A 4LJZF 2EV0A 3OYBA 1WJFA 1FWZA 2M4KA 3I55I 3RPUD 4XQFA 1MBJA 1K78A 1KU3A 4EJOA 4KN4X 4B1RA 2EOFA 5LGNA 3L2RA 2KIQA 2NVUB 2MD0A 4P55A 3ZOBA 4CCNA 4TUGA 2MA3A 2E5LE 1R7JA 1K4TA 1TQMA 5BPDA 3S1RJ 2EOJA 4BJ5C 2L3CA 3FISA 1MJ9A 2VKDA 4A3LJ 1HOMA 4M3EA 2PRTA 3F23A 5DM7F 2V86A 3E6MA 2F4OB 4N4OB 1PYVA 3AG2H 3DQVC 1A6IA 3QAHA 3PO2J 3ADGA 2B7TA 1TW3A 3GZNB 2UUAE 3M3YJ 1FOYA 1HSJA 3MZYA 2M0MA 4D5CA 2P0WA 4XSXF 4A12A 2JRMA 1MH3A 2LR8A 3HSRA 1QGPA 3VSKA 3EYIA 3D5SC 3FBNB 1ZELA 4ESJA 4P9UA 4Y4RA 2BXZA 3OL3A 1FT9A 2UV1A 2R7FA 2O5RA 1AKHB 1DQ3A 2DMTA 2GIZA 3HB9A 1JTYA 2V87A 5FKNA 1WKMA 4E7HA 4F7ZA 1YUIA 1SMYF 2VKHA 3BG5A 4WSGA 5CYVA 1IN8A 4LF4E 1Y6IA 2F4VE 1XCVA 4R03A 4U0WA 4HDUA 5LGTA 4IL6C 5LRSA 3JRFA 3ZMZA 4UVCA 2EL5A 1REPC 4EM1A 5BPIA 1G3YA 3HKZN 3VHTB 2MW8A 3VDXA 4NDLA 1WJCA 3JAMK 1LDKB 5IXMB 4JK1X 1BIAA 4EATA 2R7QA 2DXIA 3VB2A 4L9JA 4RMNA 1S8NA 1YUJA 1AKHA 4HOBA 3Q0UA 1D5YA 4L18B 1KYQA 2ISZA 2EOMA 3S8PA 1U8RA 3JAMC 5L3CA 3PIPF 1DGRM 3G1OA 3MN2A 2E1NA 2WBSA 2YTFA 2K85A 2JXPA 4IHXA 4E7ZA 1KGSA 3HHGA 4UUSB 2L01A 1X19A 1IC8A 2K4BA 1G2DC 2EILH 3HRTA 1U6GA 2OCEA 3BP8A 4XRFA 4ZZLA 4F93B 3GTJJ 2OA4A 4Q5SF 3QODA 2HPIA 2FTXB 2XAFA 1ZQ3P 5DD4A 3A1YA 2W00A 3K4CA 3P9IA 2WV1A 4XN0A 4KYWA 2XC7A 5FKOA 3N97A 5LL6R 4JI2E 3HIFA 3M7GA 2L7KA 4F6MA 4BQNA 2M2EA 3FKIJ 2KDOA 3HUGB 5EYRA 1WJPA 2LMDA 3DV8A 1DQUA 2NS8A 4M72A 3C2HA 4D0PA 3K70D 1YYWA 4AVPA 2EN2A 1HDPA 1OCOH 3WG9A 1HC8A 4UUSA 5A6AA 4ZC3A 5F27A 1SFOJ 3I64A 3LSMA 4A6EA 1TN9A 3FX3A 2DMIA 3HHHA 1W0TA 1X3ZB 2ZJRF 2RQLA 1OFCX 2W85A 3F6HA 4I98B 4JP0A 2L02A 4RAGA 2VBZA 2RKHA 1U0JA 2LVHA 4HF1A 1JT6A 2X6YA 1YZ9A 1U8BA 1LFPA 3KLNA 1KZHA 1VQ9I 2MGQA 2DRPA 3HUGA 3KCCA 3HOTA 3I56I 5CLSA 3O8GA 1MZBA 3N4MA 4IQ4A 3HDDA 2EPXA 1Z0XA 3TOAA 2KONA 3T8TA 1WI9A 2EA4A 2JN6A 3CO7C 5KL5A 4EV0A 3J81Z 4BQQA 3EPJA 1W36D 2L2OA 2MSYA 3OR2C 4E70A 3HBLA 2MC4A 1GT0C 1XGSA 4A0ZA 2L2MA 4ZYDA 4F2JC 2LC2A 2RS6A 4KWYA 2IXSA 1FSHA 2ICWG 4ZYGA 2LSOA 2ZBKA 4X64E 2M8EA 4X0GA 5ILVA 2HR3A 1IN4A 3MZHA 4LIVA 3MAJA 3Q3SA 1QZEA 3KP5A 4IHYA 1LDDA 3J81C 3JSPA 2ADUA 3WE2A 1WSUA 1R6RA 4ENNA 1P9QC 4MO7A 5FD6A 3S3MA 1ETKA 4GFBA 1MH4A 2N3HA 2EINH 2KP6A 1PDAA 1VQ7I 4R2QA 4FQGA 3VYTB 1XC5A 4BBSJ 1BBGA 1XD7A 2JYAA 1ZAOA 3BT9A 2EN8A 4F92B 1ZARA 4PCQA 2DBBA 3UK3C 3I71A 1KA8A 1QU3A 3NRVA 2YU5A 3LA2A 4NUBA 4BDZA 5LBQA 2EMHA 2DFHA 3E5UA 2EFQA 3R4KA 2VOOA 1BJZA 2HKXA 3FF5A 2WBTA 3BTIA 3MWMA 2L7MP 5ICEA 3BJ6A 2IS4A 5H6QA 2RS7A 3CDLA 4P5OA 3I53A 3DCFA 4OX9E 1Y0NA 1IDZA 2R93J 3QPSA 2FA5A 2P8TA 4FT8A 1ZTRA 4N4NB 4XN3A 5FLMJ 4MLQA 1KU9A 4AUXA 1VQPI 2HJJA 1FZPB 4KA4A 1B1BA 5TGTA 3K4KA 1VI0A 3HKZA 4WSPA 1NG6A 1L4SA 3W6JB 2BGCA 2A07F 1MBGA 2Q0OA 3KX2A 2L33A 1FY7A 2CQXA 2DT5A 3V8LA 4TUIA 4F91B 1IBKE 1EKEA 1W7PB 1HR0E 2EL6A 3B6CA 2DK5A 4ESFA 2QQBA 2EN6A 2YTJA 2MC6A 2MLGA 1ZREA 1T4NA 1YE9A 3BOQA 4HBLA 2N8XA 4A3BJ 2WA0A 3FXKA 5LEJA 2EPPA 3BTLA 1P47A 4JI4E 3GX4X 4CCLA 3K69A 2KKOA 1BW5A 2L4AA 1IW7F 2BY3A 2O0YA 5KNLA 1FSEA 3DU5A 3IHUA 3SFZA 4ANJA 2ZXIA 1H8AC 5AIQA 4HV5A 3C4TA 2GIVA 4M6YA 5FFZA 3K0LA 3DEWA 3RYPA 1DP7P 3CDHA 2D9HA 2WZOA 4M9XA 2PI0A 4U87A 5C3EJ 1W7PA 1GQEA 3ZQGA 2HZDA 1GHCA 2K86A 5DUIA 1ZBQA 2HFHA 3C1DA 1Y1WJ 1B6AA 5EF6A 2QSFX 2AXLA 2CQKA 3DKYA 4LB6B 4B3RE 3K2AA 3CP2A 4RLQA 4DBQA 4RGSA 6PAXA 1VFCA 2VASA 2P6TA 4Y13A 2DQRA 4UUTA 2X51A 2ZXJA 4RH8A 2LG4A 1IV6A 4CCMA 3E5QA 2DMUA 3LSGA 4G12A 1BBOA 3GTOJ 1X48A 3NWSA
chains in the Genus database with same CATH topology
3HOSA 4O5VA 3LFKA 4ZYHA 2UWMA 1RIOH 3GYHX 2ZJ2A 3E97A 3FM5A 1S7OA 4MTEA 1FLIA 1IAWA 4ESBA 1HKQA 5LHIA 1STZA 3ZN0A 2GWRA 3QU6A 5D5VB 2ZNYA 2YX4A 4UVBA 1TQIA 3CUOA 1XMAA 5CVUA 4ETSA 3J80Z 2LF8A 4FHTA 3L2CA 3CO6C 1VTNC 5A2QZ 2QM3A 2XUBA 3R60A 1WRJA 3B02A 3KEOA 2PEXA 4ENJA 2V79A 3PQKA 3C7JA 4KMFA 2DPUA 3IWFA 4M71A 1BI1A 4HLYA 4XBFA 1MDMB 2W84A 1YYVA 1E17A 2P7VB 4XLPF 2CGPA 1FC3A 1Z6RA 5ILSA 4K2EA 2H6BA 2QQAA 2D1HA 1J9IA 4PGGA 5CJ9A 3OV8A 1W5SA 1BC7C 2PN6A 1HKSA 3FWEA 3FMSA 1MDMA 3W6KB 1IF1A 3WODF 1LB2A 3WTXC 2UXXA 2DO7A 1IN5A 2ZFWA 3ECHA 5FO5A 3GFMA 3JW4A 1YIOA 2RVCA 1D8JA 2M5WA 2ETHA 3K1PA 2K02A 3IWZA 1P92A 4MHGA 5E1ZB 3LQRA 2M87A 3I58A 5TRDA 3R0JA 3LWFA 2IP2A 2AS5F 2EJRA 3HRUA 3KE2A 5HVQC 4IRGA 3AAFA 2LNBA 1EH6A 2O03A 3O6BB 3F8BA 2O61A 4G8XA 1QNTA 1Z05A 2FBIA 1ZH5A 1OYIA 2VBYA 5HLGA 2EV5A 2V1XA 4KT5C 5FLXK 4KUMA 1ON1A 1FYLA 1SD7A 4IRIA 3ZN1A 3WTUC 2R3SA 3QRFF 2JSCA 1SD4A 4BHPA 3LQQA 1XB4A 2DU9A 3DPTA 2ACJA 2PG4A 2NYXA 3V7RA 4HF2A 4MEYF 2HGCA 3DFGA 4DNCA 2MLKA 2E1CA 4A2UA 1P4WA 5K1YA 3T1BA 5FB2A 5E20A 2D2WA 2F5EA 3K9TA 3PFIA 2F5DA 2C6YA 4OMYA 3EQLF 3F22A 2FOKA 5D8LB 3F8MA 2FF4A 1I1GA 3L7WA 3ZP5A 2YPRA 1ZRCA 1XMKA 2IJLA 4Z2YA 3HSEA 5HDKA 1R5GA 3ABUA 4RB2C 2H94A 3KETA 5CVIA 5DD8A 2EFNA 1OPCA 2PMUA 2XAQA 3C3WA 3MFKA 3IRQA 4BH9A 3GF2A 4G9YA 2E7XA 2M45A 3HTSB 5IT9K 3ZMTA 4KICA 3BJOA 1SD5A 3HTUA 2A68F 5BQTA 2Q8KA 5HOOA 4BAYA 4KN7X 3I4PA 2CWEA 1O3QA 2CO5A 3HRMA 1F4KA 2RN7A 1K6OA 3H3UA 1CF7A 5JHUA 2VT2A 1C0WA 1I27A 1R23A 1RNLA 2L3DA 2OBPA 2OQGA 2XROA 2VC0A 1J2XA 3DPLC 2COMA 2BYVE 2EA2A 2ESNA 5BMZA 3QP5A 3ZMUA 3E3VA 5JR3A 5LHHA 1HKTA 1O3RA 1JXSA 2HS5A 3BPXA 1ON2A 3ECOA 1SFUA 1G4DA 2WV0A 1BIBA 3PQJA 3WTSC 5E1XA 5E18F 4B8XA 4PDKA 2XIGA 4CXFA 1U78A 1RZ4A 2Y0MA 2ZCWA 1D5VA 3NEUA 5H6RA 2DW4A 2RV8A 1TNTA 2XASA 4A0XA 1JHFA 4ENMA 2G7UA 2OD5A 5DEQA 2NNYA 2DPDA 3JAMZ 1X3UA 1HW1A 3F21A 5J6XA 3M1EA 4RB0A 2RGVA 5LGUA 4JQFA 5D4SA 5FD5A 3I0TA 2E7WA 2OZ6A 1GVJA 1ZYRF 4RAZA 2A5YB 3L9FA 3HRSA 4KIBA 5HDGA 4KDPA 1PP7U 2LF7A 3QOPA 1U3EM 1SAXA 4CICA 2ZO4A 4HX8A 1ZLJA 4P96A 2EB7A 4Y17A 4WWCA 4MQ9F 2IA1A 4LLGF 1HW5A 4U88A 2JTVA 2IPQX 1XGNA 2EFPA 2KRFA 1ZN2A 3J7AO 1LEBA 3BJAA 3DKWA 3WGIA 2STWA 4OIRF 1MKMA 1YG2A 3LAPA 1HXDA 5DV5A 3I54A 2H6CA 1J75A 2DFIA 3KLOA 4LMYA 3GZ6A 2VE9A 5JFRA 3Q9VA 2PLYA 4EJWA 5D6FA 1Q1HA 2ISYA 2FNPA 4YFNF 2PFBA 2H09A 5D5UB 4ENKA 1FYKA 5HLHA 1OMIA 3E6DA 4LFUA 1D8KA 4IF4A 5LLQA 3FMRA 3ZMSA 1TW2A 4YIFA 5F64A 3C18A 4OIQF 2L54A 2YR2A 4A5NA 3G3ZA 4G7OF 1XN7A 5E8GA 4MTDA 1I1SA 1W4MA 3QP6A 4RB3C 4YIIA 3SHFA 5LHGA 1KQ9A 1YW8A 3GZ5A 1XSDA 4U7BA 1Z91A 4ASNA 2UZKA 2DAOA 3FZVA 2FRHA 4HLXA 2VONA 4OINF 5ILUA 3GEZA 3DP7A 2P4WA 3TKYA 4M6XA 4EVIA 2HYFA 2VT3A 3V7CA 1TQPA 3OOPA 2A6HF 1HQCA 2HYGD 4Q48A 2HDCA 4MNUA 4A5MA 3WGGA 4L0YB 3V8KA 2BEOA 4UNOA 5CVVA 2JT1A 2KJCA 3ZPLA 5H20A 4NHJA 1YLFA 1HW2A 3KZYA 3JTGA 3GVAA 1I5ZA 1TNSA 4MQVA 3LSTA 1O57A 5F1RA 2M1BA 1U5TB 3CUQC 1ZG3A 3VFZA 1S3JA 2GXGA 5K5QA 1H9TA 4NQWA 1QBJA 2EFOA 4L0ZB 4KFCA 3HYIA 2UXNA 3IL2A 2XAGA 2B0LA 1A04A 3RDIA 3VODA 1BJAA 1IZ1A 5D6EA 4EM0B 1Z6TA 4L9VA 1KQ0A 1P2FA 2PQ8A 3EETA 4HYEA 4RAYA 2P7CB 2EV6A 2HTSA 1KQ8A 1USTA 3MQ0A 1FYMA 1FBQA 1ZGJA 4G94A 2BE5F 4P9FA 3RPQA 3WU0A 2F5CA 3Q9SA 1I6XA 3RKYA 5HS9A 3F6OA 2Y48A 4IHTA 3K1MA 4ZZDA 1R22A 3E5XA 3TO7A 5D4RA 2ZNZA 4IRHA 4GO1A 1T2KA 3FXUA 2GQQA 1K79A 2DK8A 4LG0B 3KEQA 5ICGA 2W24A 4BHBA 4EMSA 1BI0A 3TDUC 1EH8A 3VEPA 3GW2A 4OMZA 5IT3A 1DPUA 4KNYA 1LNWA 3E6CC 1T38A 4M73A 3DF8A 1F5TA 1GXQA 2ZKZA 3R6SA 3RYRA 3REOA 4LB5A 2OU2A 2K4JA 3ELKA 2V1DA 4LG0A 4HW0A 1ODDA 2CW0F 4YFKF 4M74A 4GXOA 4EGYA 1B4AA 4R8HA 2FE3A 2QENA 4U0VA 4L5IA 3E6BA 1LDJA 1BI3A 3F3XA 4HA8A 1UB9A 3U2RA 2FBHA 4HX7A 1IRFA 2MBFA 3IKTA 5L3EA 2QZ8A 1Y0UA 4LK0F 3FHZA 1MGTA 2KIFA 2P6SA 1BBYA 3RIRA 4RGUA 1YQAA 5TJJA 2XV4S 2Z3YA 1V4RA 2J5PA 3CUQB 5FLXZ 2VBWA 3WTWC 4LD5A 4FX0A 4TV7A 2HOEA 1QO0D 1S6LA 5CVJA 3EDPA 4LGWA 2IRFG 3LAJA 2HWVA 3WTVC 4IPAA 4I7HA 4IVNA 4BYYA 4HAMA 2CYYA 1DPRA 1V3FA 4M9SA 3CUQA 2PMHA 4HZFA 1D3YA 1XGMA 3VOEA 2GA1A 3KZZA 3WE3A 2WWYA 3V4GA 3TDZC 2QLZA 4R1HA 1Z1DA 1G6NA 2IT0A 2MH2A 3TGNA 4B09A 1YW9A 1GXPA 5LRRA 2JPCA 1MJAA 3BWGA 3KP6A 2G7HA 2EFWA 1WWXA 4KIGA 2V6CA 5EEHA 2FEZA 3IC7A 4EJVA 2RC4A 3SXYA 2NNNA 1S7AA 5D5WB 1HSTA 5L3FA 1YO5C 1T39A 5IT9Z 2P5LC 3WGHA 3ZMDA 1ZHFA 4WF2A 2DQLA 2NAZA 1P4XA 1TBXA 3ISPA 2L4MA 3BDDA 2Z33A 2OAZA 3BROA 1XGOA 4WXHA 5KVRA 1ULYA 2LDUA 2XGXA 4M9ZA 3I59B 3F72A 1DDNA 1OKRA 2VN2A 1XCBA 3CTAA 2MH9A 1PUEE 5FGMA 1O7LA 1QZZA 1SMTA 2DLLA 3BPVA 3HSFA 2FMLA 4L9NA 3LA7A 2HKOA 3D5LA 3WTYC 4HF0A 1LEAA 3Q5FA 2V9VA 3I59A 3V7SA 2XVCA 2QUFA 1UHWA 1FPQA 3GWZA 1AWCA 2R7DA 1MJBA 2D45A 1WQ2A 4OIPF 3GFLA 1XSXA 2Z5UA 3M8EA 3KFWX 2J5OA 2VXZA 3RPUA 3QPHA 2BV6A 2XAHA 1BOAA 4BQAA 4KMUX 5ED4A 4HQEA 3P9CA 3O3KA 2QBYB 1KU7A 4RB1A 3CJNA 2XAJA 2Z99A 3TOBA 2DTRA 2YSRA 2FSWA 3ERED 4FX4A 1H9GA 2RDPA 3R61A 1J5YA 3MEXA 1FBSA 4MGRA 2HZTA 2Q2EA 4ON0A 1SFXA 1KU2A 4A6DA 2QBYA 4GYGA 5CVRA 1XDUA 2NS0A 1O7FA 3EYYA 4DQ2A 3F6VA 4CGZA 1G3TA 2IW5A 3JTHA 3U9GA 4AIHA 3K2ZA 4CDGA 4CHUA 1EH7A 3O2PE 2VOPA 4A0YA 5DCMB 2CG4A 2PBIA 4IHSA 1R36A 2A69F 1IRGA 1T0FA 3GUDA 2D1VA 4AWXB 3H92A 2X4HA 1F9NA 1U5TC 1JGSA 3B73A 3LA3A 5DCMA 1R1TA 4WK8F 4XLNF 4G6DA 1T98A 2IA0A 4HDVA 1PP8F 3IRRA 4HQMA 1LJ9A 1LVAA 3FXRA 3L00A 4I01A 2P5VA 3MCZA 4UV8A 3JSOA 4OU0A 5AIPA 5HDNA 1AOYA 2A3SA 4EQQA 2FQ3A 4MEXF 4I02A 2OQRA 2IVMA 4G7ZF 2M30A 4RGXA 1FBUA 4S04A 3TO6A 4I0BA 1J59A 3J81K 4EJUA 1IXCA 4BNCA 3TQNA 4Q47A 2QVOA 1FX7A 3KP4A 2JZYA 3SZPA 3RKWA 2ELHA 5AONA 2O8XA 1USSA 1B9NA 2PJPA 3P9KA 1QZYA 1W5TA 1SD6A 2YX7A 3L09A 2K27A 1YTYA 1CGPA 3ULQB 3WTTC 4GGGA 1RI7A 2GAUA 1XSVA 4RGRA 3EUHA 1BC8C 1R1VA 3RKXA 1O3SA 3FMQA 2VBXA 1T6SA 5D8KB 3COAC 2MD5A 1FNNA 2HQNA 1R00A 3ML6A 4ZYEA 1OYWA 4PZJA 1KYWA 4UUVA 4HX4A 2RQPA 5FFXA 1IXRC 2IA2A 4ZH4F 5K5OA 2A61A 2YU3A 1W7PD 2VE8A 1YS7A 1EV7A 2F2EA 3RI4A 1ZRDA 3FM3A 4YG2F 4WXDA 3ROUA 3NQOA 1ONVA 2OZUA 1MD0A 1LQ1A 1B59A 4LK1F 1B9MA 3QPTA 1P6RA 5J8CA 2QQ9A 1ZGAA 4KIFA 2Z9OA 5K5RA 1R58A 5L3DA 4N9IA 1F1ZA 4IJAA 1U5TA 2CFXA 5HS8A 2EWNA 3ZQ7A 2V1UA 2O3FA 4NB5A 3K1NA 1BI2A 4GCVA 2A6EF 4YFXF 5JI6A 3WU1B 1BN5A 1HBXG 4AIJA 2NRAC 5DCFA 4L5JA 1J0RA 5BS6A 1TTYA 3F8NA 1R5HA 4EJTA 3M8FA 3T8RA 3J80K 5A2QK 4EM2A 4N9HA 2JPBA 4Q4ZF 2FBKA 2MC3A 1IXSB 3RJPA 1H0MA 4HV6A 3M9AA 2HTJA 2TDXA 2XRNA 4O3MA 4G7HF 2WTEA 3BZ6A 2DI3A 3T0YA 3SQNA 3GLXA 2FXAA 3QU3A 2FMYA 1IN6A 2GZWA 1KYZA 4WCGA 1UCRA 2G9WA 5E8IA 4I09A 4U7DA 3WTZA 1O3TA 2VODA 4G6QA 2KIUA 4BXUA 1ZG1A 1FP1D 3GXOA 4IXAA 4UHTA 1L0OC 1OYYA 2ESHA 1YFHA 1TLHB 4L9TA 5JVTA 2W57A 3S2WA 3V8JA 1QQIA 2FNAA 5L3BA 4WXCA 2QYOA 1IN7A 1NHAA 4EGZA 4I0AA 3SZTA 1G3SA 4LLLA 2XKOA 1ZLKA 1YS6A 4OIOF 3D0SA 2H27A 1RUNA 1UHMA 2QWWA 2STTA 1ZRFA 1BM9A 1U2WA 2Y75A 1Z7UA 1XDSA 4RS8A 4U0YA 1J7KA 4XSZF 5ERIA 4Y15A 4OOIA 3DEUA 3CLOA 4UV9A 4QWQA 5E1WA 4AIKA 2VC1A 5EEGA 2HQRA 4PGHA 3T5XA 1K7AA 3DXJF 1G3WA 4WX9A 1E2XA 5HLIA 2F5FA 1PDNC 3H3ZA 4UXNA 4O6JA 2WC2A 2KIMA 1Z9CA 2FU4A 4JBAA 1YW7A 3IKVA 2LKPA 1R1UA 5L3GA 3P7NA 2HEOA 2XHKA 1JE8A 2KJBA 3GO5A 4R79A 2O6GE 4UVAA 3U1DA 2P5KA 3F8CA 5ICFA 4BHCA 4CZZA 4CO8A 5KK1A 4LLNA 3GFIA 5LEKA 5ICCA 3KP2A 5J8FA 2JRTA 1CF7B 2BBYA 5BOXA 2ZMEB 3GFJA 1SFEA 3KP3A 1DUXC 4H0EA 3I5UA 2X0LA 4N0BA 1RUOA 5D5XB 5DDGA 2GXBA 1OR7A 1QPMA 3F8FA 3KP7A 1ZG5A 2EK5A 5HS7A 4I2OA 3ABTA 3TO9A 2ZMEA 5F6FA 3G73A 3RTRA 4GYIA 2RNJA 2XKPA 1FP2A 2W25A 2K7LA 1FOKA 1JHHA 1P4AA 1K78B 1UFMA 3ZMVA 2GA2A 3FXQA 5DYMA 3BY6A 1IUYA 3R0AA 1L3LA 4AD9A 1S29A 4QLCU 4CYDA 2CSOA 5E17F 5DUKA 4S05A 4LJZF 2EV0A 1FWZA 1K78A 1KU3A 4EJOA 4KN4X 5LGNA 4P55A 2MA3A 1R7JA 1TQMA 5BPDA 1MJ9A 3F23A 3E6MA 3QAHA 3DQVC 1TW3A 1HSJA 3MZYA 4XSXF 4A12A 3HSRA 1QGPA 3EYIA 4ESJA 4P9UA 1FT9A 2R7FA 1WKMA 4F7ZA 1SMYF 5CYVA 1IN8A 1XCVA 4U0WA 4HDUA 5LGTA 5LRSA 3ZMZA 4UVCA 1REPC 4EM1A 5BPIA 1G3YA 3JAMK 1LDKB 4JK1X 1BIAA 3VB2A 4L9JA 1S8NA 4HOBA 4L18B 2ISZA 1U8RA 5L3CA 2E1NA 1KGSA 3HHGA 2L01A 2K4BA 3HRTA 1U6GA 3BP8A 4XRFA 4ZZLA 2OA4A 4Q5SF 2XAFA 5DD4A 3P9IA 4KYWA 3N97A 3HIFA 3M7GA 3DV8A 4M72A 4D0PA 4AVPA 3WG9A 3I64A 4A6EA 3FX3A 3HHHA 2W85A 4I98B 2L02A 2VBZA 2RKHA 4HF1A 3KLNA 3HUGA 3KCCA 3HOTA 5CLSA 1MZBA 3N4MA 3TOAA 3T8TA 1WI9A 2EA4A 3CO7C 4EV0A 3J81Z 4E70A 1XGSA 4A0ZA 4ZYDA 1FSHA 4ZYGA 2LSOA 2ZBKA 2M8EA 5ILVA 2HR3A 1IN4A 3MZHA 3MAJA 3KP5A 1LDDA 3JSPA 2ADUA 3WE2A 1WSUA 4ENNA 5FD6A 1XD7A 1ZAOA 1ZARA 4PCQA 2DBBA 3I71A 1KA8A 3NRVA 3LA2A 5LBQA 3R4KA 3E5UA 2EFQA 2VOOA 2HKXA 3FF5A 3MWMA 5ICEA 3BJ6A 5H6QA 4P5OA 3I53A 2FA5A 2P8TA 4FT8A 1KU9A 1FZPB 4KA4A 1B1BA 3W6JB 2BGCA 2A07F 2Q0OA 1FY7A 2DT5A 3V8LA 1W7PB 2DK5A 4ESFA 2QQBA