4ZYHA

Crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase c119l variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
148
structure length
148
Chain Sequence
b'LVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPLHRVIAENGIGGYSRGVKLKRALLELEGVKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylated-DNA--protein-cysteine methyltransferase
publication title Structure-function relationships governing activity and stability of a DNA alkylation damage repair thermostable protein.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 44
structure length 148
sequence length 148
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zyhA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4zyhA01
1S8NA 5HDGA 1BC7C 3E97A 1U5TA 3QU6A 3PQJA 2XROA 2ISZA 1SD4A 4AIHA 3HSFA 1C0WA 4DQ2A 1F1ZA 1G6NA 5FLXZ 1ZN2A 4UV8A 3P9CA 4BAYA 3LFKA 5CVVA 4O3MA 3I5UA 1Y0UA 1CGPA 3P7NA 1LJ9A 1EH7A 4LG0B 2HYGD 1WKMA 1P6RA 1T2KA 5BS6A 3IRQA 4R8HA 1K78A 1J0RA 1TNSA 1CF7A 2KIUA 5ERIA 4PGHA 1STZA 5E1ZB 3DKWA 2V79A 1MDMB 4KUMA 5E1WA 2A6HF 4HYEA 3L09A 2H6CA 3BROA 5DEQA 3H3UA 3NRVA 3P9IA 1YW7A 1R5GA 1BN5A 3F6OA 5ILVA 1T0FA 4DNCA 2BYVE 4KMUX 2HDCA 3F21A 6PAXA 4ESJA 2QWWA 3J80Z 4LLLA 3CUQA 1E2XA 3V4GA 5HVQC 3MCZA 3I58A 3KZYA 5AIQA 2ZMEA 3TDUC 2VBXA 3WTYC 5J6XA 4UVAA 1Z91A 4G94A 4RGRA 3E5UA 1Q1HA 2ESNA 3WTXC 1D8KA 4M71A 2XUBA 2IVMA 5BQTA 3HSEA 2GAUA 3WE3A 3MWMA 4LB5A 2VC0A 1O3RA 1B9NA 3ABUA 1IRGA 4RB3C 1RNLA 1HW2A 3AAFA 2P6TA 4MTDA 1TLHB 3ECOA 1K7AA 2VN2A 2XRNA 1IF1A 2XAHA 1W7PD 2HZTA 3C7JA 2A61A 2MC3A 1T38A 4IRHA 2WWYA 4CXFA 2BV6A 2MLKA 5DCMA 4Q5SF 2E1CA 1TW3A 1R1UA 1MJBA 4I7HA 3V8KA 1ZG1A 2PG4A 2DQLA 5L3EA 1LQ1A 1IXCA 3K0LA 2DQRA 2VONA 2CWEA 5DV5A 3BP8A 2AXLA 4FX4A 4A6DA 1IN7A 2YU3A 4IVNA 3E5XA 1PUEE 2OU2A 3DPTA 2P6SA 1ZGAA 4Q47A 2DTRA 2W57A 4P96A 3RKWA 2FMLA 5D4SA 1SMYF 1W5SA 3I71A 2W85A 3FZVA 1G3WA 1D5VA 2P7CB 2ZXJA 2A68F 4R79A 5CYVA 4G8XA 4RAZA 5K5OA 5FD5A 5IT3A 1LEAA 1U5TB 2DI3A 1S7AA 2EB7A 5E20A 2L01A 1RUOA 4S05A 1MJ9A 2IA1A 2W25A 1FPQA 2L3DA 3ZMZA 2L4AA 5K5RA 1ZG3A 3I4PA 1H9GA 1O57A 4PGGA 4TV7A 4ZH4F 2V9VA 3CLOA 2UXNA 4LD5A 2EV0A 2Z33A 1EH6A 2KJCA 1BOAA 2R7DA 3O2PE 4G6DA 4NB5A 4L0YB 5BMZA 3QP5A 4Z2YA 2IPQX 1K78B 5D8KB 1CF7B 1S6LA 2YX4A 1UCRA 2PEXA 1YS7A 3K1NA 2R3SA 3FXUA 3CJNA 3BJ6A 2DFIA 2HS5A 3T5XA 5LHGA 1G3SA 4L9VA 3VFZA 1XGMA 4IF4A 4OIQF 1FLIA 3IL2A 4LLGF 4U7BA 4MGRA 2RC4A 4LB6B 1FT9A 5D5XB 3N4MA 1U2WA 1IXSB 5E18F 3LA7A 1KQ8A 4IHSA 1ONVA 1ZREA 3CUQB 1EH8A 4A6EA 4CHUA 2ZMEB 3JAMZ 1IN8A 4Q48A 4IRGA 2RV8A 5L3GA 2IT0A 4PCQA 3COAC 2K27A 3OV8A 1B6AA 3CDHA 3I54A 5FGMA 3ZQ7A 2K4BA 4LMYA 4EGYA 1O3SA 3I0TA 4UUVA 2KJBA 2A3SA 2OAZA 2FSWA 2V1XA 4IXAA 4HF1A 3C1DA 2PLYA 1OMIA 2E7XA 3ZN1A 3P9KA 5LGTA 4KIFA 3WU0A 5LBQA 3ZMDA 1K6OA 4P55A 1GXQA 5DCMB 2EA2A 2O3FA 1RIOH 4HDUA 2EV6A 2ZCWA 3M9AA 1SFXA 4XLPF 3ZN0A 1ON2A 1PP7U 2ZFWA 3RDIA 1FBQA 2AS5F 4HBLA 1ODDA 2HKXA 3HIFA 4AVPA 4HX8A 2D1HA 4M9ZA 2QQBA 1SD7A 2OQGA 5DUKA 2PQ8A 3F8MA 2MA3A 3VODA 2J5OA 2O0YA 2QYOA 1HW1A 2X4HA 4N9HA 4EJWA 1XB4A 3IHUA 1OKRA 4LGWA 3GFJA 2XAFA 3N97A 2IRFG 3TOAA 4AWXB 1JXSA 1ZLKA 1PP8F 3F6VA 4Y17A 2VT2A 2UWMA 4N9IA 2M45A 4RB2C 1YW8A 3K1MA 1S7OA 1KU3A 2WTEA 4G7HF 3TQNA 5DDGA 1B1BA 1BC8C 5DUIA 4LFUA 3ELKA 2MH9A 2GXBA 1HQCA 5F1RA 3EUHA 2DAOA 2VBYA 1R23A 2DPDA 2QBYA 1XSVA 3HHHA 3TGNA 4A5NA 3LA2A 2A07F 4ASNA 3HRUA 1R1TA 3D5LA 3GZ6A 1WQ2A 3RYPA 2FE3A 2JT1A 4L9TA 2FF4A 3F8NA 1FOKA 3J80K 3U2RA 5FFZA 2VODA 1AWCA 5FFXA 3CUOA 2HR3A 3V8JA 1J2XA 4MEXF 5LEKA 2R7FA 4HW0A 3HOSA 1XSXA 3WGIA 3IWFA 1O3TA 2Y0MA 1GVJA 3F8FA 3WTSC 4YIFA 1XGSA 1MZBA 4ZYHA 1YLFA 3EYIA 3DF8A 4UVCA 3BJOA 2FBHA 2CGPA 4HA8A 5FO5A 4U0YA 1XD7A 2P5LC 5HOOA 3Q9VA 2QVOA 4HX7A 3SXYA 2C6YA 2Z5UA 2GA2A 1SD6A 4ENMA 1DUXC 4LLNA 5JVTA 3I59A 2GA1A 5K5QA 5CLSA 1IN5A 3IKTA 5J8CA 4KT5C 4WXHA 1ZRDA 1XCVA 4NQWA 5BOXA 1YFHA 3TOBA 3ABTA 3C18A 2K86A 2ACJA 1JHFA 3RYRA 4FX0A 1U3EM 3TDZC 3ROUA 5ILUA 3M1EA 1SFEA 3F8BA 1XMKA 2HYFA 2HWVA 2O8XA 3ZMSA 3D0SA 2IA0A 2GWRA 1QNTA 4UHTA 2FEZA 4EM1A 5J8FA 1E17A 5D6EA 2DPUA 2M8EA 3LAJA 2O61A 3BWGA 2LKPA 1XGOA 2BBYA 3FMSA 4RGUA 3F3XA 1F9NA 5H6QA 3F8CA 1R00A 3IRRA 4I09A 4Y15A 1YO5C 4BNCA 1VTNC 4IJAA 1LEBA 2CSOA 2JPCA 3ZMUA 1ZLJA 4CZZA 2FRHA 2FBIA 2ZBKA 1L0OC 2F5DA 3KP7A 1I1GA 2Z99A 5LGNA 1LDJA 1KQ9A 3KP3A 4YG2F 3L00A 4M74A 1KYZA 2FU4A 1IN4A 2XAQA 1EV7A 4YFNF 2M1BA 4HLXA 2DK8A 4ETSA 1RUNA 2ADUA 5LRRA 3CO7C 2VOPA 3KE2A 4MTEA 4LJZF 1TW2A 1R36A 3OOPA 3MEXA 2EK5A 2XGXA 3M8EA 4EMSA 2D45A 2L54A 1YW9A 1QZYA 3KP6A 1FBSA 3WTTC 3QRFF 4I0BA 2K7LA 1FYKA 1FWZA 2M5WA 3RKXA 5L3DA 3ZPLA 4ESFA 3KEQA 4OMYA 2IP2A 2QZ8A 2NYXA 4M6YA 5TRDA 2XKOA 2OD5A 1J59A 1XSDA 1FBUA 4HAMA 3BY6A 2P8TA 4MEYF 1BM9A 3V7RA 1Z9CA 1UHMA 2JRTA 4CO8A 1ZHFA 4MHGA 3G73A 3U1DA 2Y48A 4CGZA 2D1VA 3WGHA 2IW5A 1OYYA 1IAWA 1O7FA 2P4WA 3JAMK 1LDKB 4MQVA 1QZZA 5AIPA 4B09A 1FSHA 2XIGA 4KN4X 3K1PA 5H6RA 2L4MA 3FMQA 3CO6C 2VE8A 4EJVA 1TQMA 2EV5A 3EQLF 1MJAA 2OZ6A 4OMZA 4OINF 4HOBA 3HYIA 2CW0F 4GYGA 2VE9A 4OIOF 3JSOA 3FF5A 4PZJA 4EM2A 4A12A 1P2FA 2FMYA 4KIBA 1JGSA 1XGNA 3I59B 1R5HA 4BYYA 1BI2A 5D5VB 2G7HA 2VT3A 2TDXA 3HTUA 2ZO4A 4HDVA 4OIRF 4QWQA 1ZARA 2K02A 4EJUA 3L7WA 3R6SA 1YG2A 2M87A 1FP2A 2HOEA 2F5EA 4KFCA 4HQEA 3ISPA 3T1BA 1P92A 2O6GE 3DQVC 3IC7A 5D4RA 3KP2A 3TO6A 3QPTA 3LWFA 2A69F 3PQKA 2FQ3A 3GXOA 4BQAA 4RB0A 1HKSA 4I98B 2V1UA 4ZYGA 1QQIA 4HF0A 1REPC 2LNBA 3I64A 1KYWA 4EGZA 2RGVA 3ML6A 2QLZA 1G3TA 5ICCA 2GZWA 3M7GA 2H94A 5ICGA 3E6MA 2CO5A 2MLGA 4JQFA 2XAGA 4P5OA 3MAJA 2K4JA 1FNNA 5HDKA 2QUFA 5HDNA 1WWXA 2XHKA 4XRFA 3K69A 3KZZA 2HEOA 3FHZA 2PN6A 2CYYA 3QP6A 1K79A 5BPIA 2MD5A 5D5UB 3GFLA 1KU7A 1QPMA 4YIIA 4R1HA 2O03A 2ESHA 2G7UA 2OQRA 2NS0A 4FHTA 2XAJA 2PBIA 3HRTA 1RZ4A 2F2EA 5LGUA 2VBWA 1H9TA 1P4WA 1Z7UA 4B8XA 5A2QK 1B4AA 2E1NA 4I2OA 1P4AA 4UNOA 1FC3A 1IW7F 5E8GA 1OPCA 4JK1X 4A2UA 4MQ9F 4Q4ZF 5LLQA 2P5KA 1KGSA 1U6GA 2Q2EA 3JW4A 1U5TC 2W84A 2EA4A 2HQNA 4HQMA 4UXNA 3FM5A 1GHCA 3V8LA 4A0XA 3WTWC 2V6CA 4KIGA 1HXDA 3G3ZA 4L9JA 2OBPA 3E3VA 3GFIA 4KYWA 2CFXA 5HLIA 1HSJA 5L3CA 1JHHA 1G4DA 2A5YB 1FY7A 1IXRC 3M8FA 4EJTA 1XDSA 4M6XA 5LEJA 1WI9A 4F7ZA 2EFQA 3VEPA 4UV9A 3GUDA 2ELHA 1ON1A 1FSEA 2YPRA 4EVIA 1D8JA 1Z05A 5D6FA 1I1SA 2EFPA 4KDPA 3GF2A 4NHJA 1U8RA 2Q8KA 2DU9A 2D2WA 1I27A 5EEGA 2BGCA 4HX4A 1R7JA 3WG9A 1SD5A 5E8IA 5LRSA 4M73A 4P9UA 3ZP5A 1FZPB 1S29A 2ISYA 2XASA 3CUQC 5HS9A 3NEUA 3V7SA 2Z9OA 1HKQA 2QQ9A 1W5TA 1W7PA 3TKYA 4WCGA 4HV6A 4KMFA 1KQ0A 1W4MA 4RGXA 4U7DA 3KP5A 2VOOA 5A2QZ 1OYWA 1DP7P 3W6KB 3L2CA 3WU1B 1ZGJA 4O6JA 5HS8A 3ECHA 5H20A 2Z3YA 2HFHA 1SFUA 4E70A 4ENJA 4Y13A 3B02A 1ZG5A 2RVCA 4CICA 4JBAA 4RS8A 4KA4A 1ZRCA 1ZAOA 1DDNA 2DT5A 3EDPA 1R1VA 3W6JB 3GWZA 2A6EF 1DPRA 1KU2A 3JTHA 2RN7A 5E1XA 4WK8F 3WTUC 2NRAC 3BDDA 3GFMA 4UVBA 2P7VB 4A5MA 5EEHA 1G3YA 1R58A 5D5WB 1NHAA 3SZPA 1L3LA 1FX7A 5HLHA 1H0MA 1R22A 4BXUA 2HKOA 4ZZLA 4M9SA 3BZ6A 2Q0OA 3RPQA 2WC2A 3GX4X 1SAXA 1FP1D 3VOEA 3K9TA 2GIVA 4QLCU 5DYMA 3C3WA 4AD9A 4HF2A 3R0JA 1ULYA 2GQQA 4IHTA 1IZ1A 3E5QA 5CVJA 3RJPA 3R61A 4XSZF 5CVIA 4KICA 3HHGA 1F5TA 2BE5F 5F64A 2LF7A 4ZZDA 2EJRA 3SZTA 2NAZA 4WF2A 5HLGA 2HQRA 5KK1A 3FMRA 3ZMTA 3WGGA 1WSUA 3ZMVA 5JHUA 1V3FA 3R4KA 5K1YA 1T39A 2FBKA 2CG4A 3KEOA 3HUGA 1Z6RA 1KU9A 4AIJA 5ED4A 2FOKA 4H0EA 2ZNZA 4L0ZB 4P9FA 4BHBA 1LNWA 1YS6A 3DXJF 3HRSA 4U0WA 3MZHA 3KETA 1QO0D 3T0YA 4K2EA 3R60A 4I0AA 1LDDA 3F72A 3VB2A 5DCFA 3HTSB 3KP4A 1UFMA 2STWA 2FXAA 3GVAA 4N0BA 5LHIA 4L5IA 2PFBA 5F6FA 1I6XA 3DP7A 4EV0A 4GCVA 1O7LA 5JI6A 4M72A 1MD0A 2PI0A 4HLYA 2YR2A 2QBYB 4EQQA 5E17F 1W7PB 5L3FA 2HGCA 3RIRA 2ZKZA 1B59A 4LK0F 4O5VA 4RAYA 1A04A 2H6BA 2EFWA 5IT9K 5JR3A 2Y75A 1FYLA 1GXPA 2UZKA 2FA5A 4L9NA 2G9WA 3U9GA 1TBXA 1UHWA 4OIPF 5ICFA 3HSRA 2PMHA 2QQAA 1V4RA 3DPLC 2DO7A 1J7KA 2DK5A 3LQQA 1MKMA 2X0LA 4ON0A 4YFKF 2XKPA 1TNTA 4GGGA 1BIAA 2VC1A 2RDPA 3E6CC 3SHFA 2VXZA 1RI7A 5D8LB 3DEUA 3HOTA 2DW4A 2MBFA 3BPVA 3NQOA 4U0VA 3CTAA 4KN7X 3ULQB 5ILSA 2UXXA 3B73A 3KLOA 5KVRA 3MFKA 4EM0B 1J5YA 2YX7A 4WXCA 1KA8A 3RKYA 1BI0A 1BI3A 1Z1DA 5TJJA 1D3YA 2RNJA 3S2WA 2H27A 1LB2A 2ZNYA 4A0YA 3LA3A 3JTGA 3WE2A 2KIMA 1J9IA 4XSXF 1XN7A 1YIOA 1ZYRF 2MH2A 1HBXG 1TQIA 4G7OF 1AOYA 1U78A 1YQAA 2FNAA 2JZYA 2E7WA 2KIFA 2CQKA 3E6BA 1S3JA 1FYMA 4EJOA 2EWNA 3MQ0A 3GLXA 3Q5FA 2JSCA 2FNPA 4IPAA 3L9FA 5DD8A 3GO5A 2LF8A 1B9MA 3WTVC 3WTZA 2ETHA 2LSOA 1I5ZA 1QBJA 4BHPA 1HKTA 4HZFA 1YTYA 3FXRA 4HV5A 3PFIA 2L02A 4G6QA 5LHHA 3IKVA 2F5FA 3F22A 4I02A 3V7CA 1OYIA 3T8RA 4KNYA 1P4XA 4WX9A 5IT9Z 5JFRA 5CVRA 1USSA 3QU3A 2M30A 4ESBA 3RTRA 4YFXF 2EFNA 5CJ9A 1MGTA 1BIBA 3KCCA 2V1DA 1DPUA 3GW2A 1XCBA 3FX3A 1PDNC 4G7ZF 3SFZA 2DBBA 3J81K 4RGSA 5AONA 4LG0A 4OU0A 2IJLA 3FXQA 2LDUA 2DLLA 4XLNF 3JSPA 4IRIA 1TTYA 1F4KA 4PDKA 2BEOA 3LSTA 4CYDA 3RI4A 2QM3A 3RPUA 2B0LA 3O3KA 1MDMA 2GXGA 2NNYA 2IA2A 4L5JA 4GO1A 3QAHA 4FT8A 3GYHX 2HTJA 3ERED 2YSRA 1QGPA 3KLNA 5L3BA 1BI1A 4GXOA 3F23A 1IUYA 2F5CA 4A0ZA 4I01A 4WWCA 3LQRA 2VBZA 3BJAA 2H09A 4RB1A 2W24A 1X3UA 2OA4A 4BH9A 2EFOA 4WXDA 1OR7A 2RQPA 2HTSA 4S04A 4ZYEA 2PMUA 1TQPA 5CVUA 2XV4S 5FLXK 2XVCA 5HS7A 1SMTA 4AIKA 5FD6A 3EYYA 4OOIA 4GYIA 4ENKA 5DD4A 3BPXA 4ZYDA 1O3QA 4MNUA 3DFGA 3WODF 3QOPA 1XDUA 4LK1F 4U88A 3MZYA 2ZJ2A 2WV0A 3E6DA 2JTVA 2PJPA 1HSTA 1USTA 1IN6A 4L18B 3H92A 1HW5A 1T98A 1T6SA 3R0AA 3FM3A 2KKOA 3EETA 3TO7A 3J81Z 3GZ5A 3SQNA 3KFWX 1JE8A 1J75A 1WRJA 2OZUA 2RKHA 5ICEA 1UB9A 4ENNA 1IRFA 3Q9SA 4G9YA 1XMAA 3HRMA 2STTA 3LAPA 1Z6TA 1ZH5A 3H3ZA 4D0PA 2KRFA 1BBYA 1ZRFA 3REOA 1YYVA 1BJAA 3IWZA 3T8TA 3K2ZA 3O6BB 3J7AO 3BOQA 4BHCA 4M9XA 4CDGA 1LVAA 2COMA 3QPHA 3GEZA 5BPDA 3I53A 2J5PA 2QENA 5FB2A 2NNNA 2P5VA 4XBFA 3FWEA 3TO9A 3DV8A 2JPBA
chains in the Genus database with same CATH superfamily
2K9NA 1S8NA 3HJEA 1G2DC 4N4NB 3PM1A 1FTTA 5HDGA 1BC7C 3E97A 4BJ5C 2EM7A 2YWQA 1U5TA 3QU6A 3PQJA 2A25A 2XROA 3IWBA 2ISZA 2TCTA 1SD4A 4PK4A 4AIHA 3HSFA 2LOOA 1Y0NA 1X2MA 2W4SA 2VQLA 3OL4A 4P1WA 4DQ2A 1C0WA 3MD2A 2Z16A 2KDZA 2CV0A 1F1ZA 1G6NA 5B1AH 5FLXZ 1ZN2A 4QIWN 4UV8A 2CTDA 2N3HA 3P9CA 1Q1VA 4BAYA 4A3JJ 3DTKA 3LFKA 3QODA 5CVVA 3DWLE 3I5UA 4XKBA 4O3MA 1Y0UA 3VYRB 1CGPA 2HQAA 4DV1E 2HGHA 4C3IJ 3P7NA 1LJ9A 1JKRC 1ZQ3P 3S1RJ 1LVKA 3BQZA 4BACA 1EH7A 2ZSIB 4MFEA 3V42A 1IRXA 3ZQLA 4R2RA 4EATA 2PJRB 4LG0B 2EM9A 2FUG2 2GIZA 2EM4A 2LMDA 2HYGD 3CP2A 1WKMA 1P6RA 1T2KA 1MSEC 5BS6A 3ZQCA 3BT9A 3IRQA 4R8HA 3OIOA 1K78A 3O8HA 1J0RA 1TNSA 1WFXA 5FKKA 1CF7A 5IV8B 1S7EA 2KIUA 2M0MA 2XDVA 3M8JA 4UUSA 3BCBA 5J4VA 2M3AA 1JKPC 4G6TB 1TC3C 5ERIA 2V9KA 4PGHA 2XB5A 1STZA 2M4KA 1ETKA 2WB1N 5E1ZB 1A31A 3DKWA 2EMAA 2V79A 1MDMB 2Q2EB 1ERDA 4KUMA 5E1WA 2A6HF 2DTZA 3EUAA 4HYEA 3GTGJ 3L09A 5F04A 4O24A 2H6CA 1X1CA 3BROA 1X4OA 5DEQA 3H3UA 4BBYA 3NRVA 2V86A 4FASD 4KISA 1T4LB 1NK3P 3P9IA 1YW7A 1MMDA 1R5GA 1BN5A 3F6OA 2HC5A 5ILVA 3W2VA 1T0FA 5E79C 2NOGA 4KMUX 2BYVE 4DNCA 4IOCF 2HDCA 1J26A 3F21A 3CD6I 6PAXA 2CUFA 4ESJA 5FRMA 1DU0A 2QWWA 3QQAA 2XAUA 1ZGWA 3IH3A 1TF3A 5IYCJ 3J80Z 4GFBA 1WJPA 2EPZA 4DV0E 4DR5E 4LLLA 3CUQA 1E2XA 3V4GA 5HVQC 1D1BA 2E5ZA 2RS7A 3MCZA 3I58A 3KZYA 5AIQA 3H0DA 2K9MA 2YTPA 2ZMEA 5KL5A 3GTQJ 3TDUC 3S2DJ 2VBXA 2LKXA 5A6BA 3WTYC 3K10A 4XLEA 1N3GA 5J6XA 4UVAA 3SZGA 1Z91A 2W1OA 2VKHA 3C6MA 2ZXIA 4RHBB 2OF7A 4G94A 4GEQB 1F43A 4RGRA 3HDDA 3E5UA 2LREA 1Q1HA 2ESNA 3S17J 2OTJI 2XPWA 1Z0XA 3WTXC 1D8KA 4M71A 4Y7NJ 2DJIA 2XUBA 2LY9A 2IVMA 4F93B 5EG0B 1LFBA 5BQTA 3HSEA 3CMAI 3BIDA 2GAUA 5FKMA 1O4XA 2EMCA 2DOAA 4FTHA 4B3SE 3VHTB 1BR1A 3MWMA 3WE3A 1PYVA 4LB5A 2VC0A 1HNXE 2B3TB 1UELB 1O3RA 1B9NA 3ABUA 1IRGA 3BZCA 2KZGA 1RNLA 4RB3C 1HW2A 2V26A 2VJ4A 2RAEA 3AAFA 2P6TA 5A2QC 4W97A 4A69C 4MTDA 4Y33A 4B3RE 1TLHB 5DS9A 4JI8E 4BJ6C 1RKTA 4XLAA 3QYFA 5GTIC 2WY8Q 3ECOA 1K7AA 2VN2A 2XRNA 2ECCA 3VYYA 4KJZA 5EF6A 3DBLB 3Q0UA 1IF1A 2H8WA 2OCEA 2XAHA 5F0FA 1W7PD 2HZTA 3C7JA 2A61A 2MC3A 3KIOA 5FLVA 1T38A 2ODRD 4BC9A 5KL2A 4IRHA 2WWYA 1DGWY 1FEXA 2EPCA 4CXFA 4F9BB 3PNVA 2BV6A 1OCCH 2MLKA 5DCMA 4Q5SF 2E1CA 4QPOA 1TW3A 2EWLA 1R1UA 1MJBA 2KMUA 4I7HA 1W36D 3V8KA 1ZG1A 2PG4A 3TW6A 2CJJA 3GBGA 2DQLA 4E6KG 5L3EA 1LQ1A 4X6AJ 1X1DA 2DSYA 1IXCA 3K0LA 3CCQI 3A01B 1TWHJ 3C2GA 2DQRA 2VONA 2R93J 3CZ6A 2ZJQF 5CKTA 5LMUE 1UAAA 4HRIA 2CWEA 3QYEA 2DODA 2LD5A 1A1KA 3QYBA 1YSAC 2I10A 5DV5A 3BP8A 1Y8QB 2AXLA 4FX4A 2HJJA 3BC8A 4A6DA 3QPSA 2UXCE 2L7KA 1R71A 1IN7A 4F2JC 3FISA 3CC2I 5KL6A 2YU3A 4IVNA 3E5XA 2O9LA 1PUEE 2OU2A 4B43A 2LMZA 1X1PA 2P6SA 3DPTA 5IPAA 1ZGAA 4A3EJ 2KPMA 3B6AA 4XN0A 3FXKA 1FMVA 1YX3A 2M9HA 4Q47A 1UMQA 2DTRA 1NG7A 3ABKH 3OYIA 2W57A 3VWBA 4CZCA 4P96A 3RKWA 2QSGX 1VQ7I 1SFKA 3ABMH 2NA2A 2ELJA 4KWYA 2UUBE 4YEJA 1WVRA 2FMLA 5D4SA 5HNHA 1SMYF 2JSPA 3DKXA 3IAS2 1UHZA 1W5SA 3I71A 1DGCA 3G2BA 1XX5A 3BG7A 3ZQHA 3S1QJ 3AG2H 2W85A 3FZVA 2XSJC 2ZXHA 1G3WA 1LE8B 1D5VA 2P7CB 2K3PA 2ZXJA 3G6EI 2A68F 1SANA 2F4OB 2NVUB 4R79A 5CYVA 3G1MA 3TP0A 4G8XA 2HOAA 4RAZA 3OYBA 2D9HA 5K5OA 2R5ZA 2DMNA 5FD5A 5IT3A 1AH5A 4YELA 1YJWI 1LEAA 2JUCA 3BR6A 1CQTA 1U5TB 1MBHA 2DI3A 1S7AA 1X6EA 2GLIA 5C3EJ 2EB7A 5E20A 2L01A 1RUOA 3M07A 4GKKE 1JK2A 2W82A 4S05A 1MJ9A 3LSJA 3DBHB 2IA1A 4HEA2 1TZLA 4NC8A 2W25A 1FPQA 1A1FA 2L3DA 3ZMZA 1U9OA 2L4AA 2XPUA 1X1BA 5K5RA 4BS9A 1ZG3A 3I4PA 1YYKA 1H9GA 1O57A 4X9JA 3Q3SA 4M3EA 4PGGA 3DBRB 3PSFA 4TV7A 4ZH4F 2V9VA 5KAFC 3CLOA 3IH4A 3VYSB 2CSHA 3SJMA 2UXNA 4LD5A 1JJ8C 2L2MA 3VSKA 2XF7A 3MKZA 3BG5A 2EV0A 1A1HA 4D5CA 2Z33A 4EEFG 1EH6A 2KJCA 4XIDA 2E2JJ 1BOAA 2R7DA 3O2PE 2KISA 4G6DA 4NB5A 1DP3A 4L0YB 3JRCA 3QP5A 5BMZA 2F8BA 2LO3A 4Z2YA 2E1OA 2IPQX 2R7XA 1K78B 4LIUA 2N3GA 3HKZA 3OL3A 4V2FA 2YU9J 4R2CA 5D8KB 3ADLA 1CF7B 2NUEA 1S6LA 2AHQA 4UUSB 2YX4A 1QU6A 1UCRA 1X3CA 2HNHA 2MG4A 2JVHA 3SEQA 3T1HE 2PEXA 1GTKA 1YS7A 1HCRA 3K1NA 2R3SA 3DU5A 1WXRA 4P7DA 3BR5A 3FXUA 3CJNA 1FIAA 2DFIA 2HS5A 3BJ6A 3T5XA 5LHGA 3EUHC 3PJRA 3A4CA 1G3SA 4L9VA 4XM3A 3D1NI 3VFZA 1XGMA 3OIQA 4IF4A 4C9YA 4OIQF 3JREA 3OYKA 1FLIA 1MMGA 3IL2A 4DW6A 2BHYA 4LLGF 3BG9A 2BOLA 4U7BA 2ODRC 2EOQA 5IP9J 4MGRA 2TRTA 2LP0A 1ITYA 1DU6A 1YE9A 3A0BC 3LSPA 2RC4A 1MBKA 4LB6B 1FT9A 1YRNA 1EKZA 5D5XB 2F6CA 3N4MA 2HZDA 1U2WA 3LSRA 2L7MP 3AL0B 1IXSB 5E18F 3IWCA 2DA1A 3LA7A 1W36C 1KQ8A 2EIMH 3BTIA 4IHSA 1X49A 4NXNE 1VI0A 2E34A 4HG2A 1ONVA 1ETVA 1ZREA 3CUQB 1EH8A 1NEIA 4A6EA 2XGDA 1VQKI 4CHUA 3MVPA 4X1EA 3ESWB 2ZMEB 3JAMZ 5J40A 1IN8A 4Q48A 4IRGA 2EM3A 2RV8A 5L3GA 4BU2A 2IT0A 1WH7A 2VKEA 5CQEA 1FKAE 2HPMA 3E1SA 2R7VA 2MC6A 4OAZA 4PCQA 2BXYA 3MN2A 1VQMI 3COAC 1JUMA 3GMEA 2WZOA 2K27A 3OV8A 1R4MB 4X64E 1B6AA 2YUSA 3CDHA 4DGWB 1VQPI 3T1YE 3I54A 2CMPA 1T8IA 2FTXB 4TUIA 5FGMA 3ZQ7A 4J00A 2K4BA 3DLAA 2JP9A 4LMYA 2EZKA 4EGYA 1V55H 1O3SA 2MKNA 3I0TA 2DA5A 3ZCOA 2KJBA 4UUVA 4AYBA 2A3SA 2OAZA 2E60A 2FSWA 4L8NA 4UUTA 3VK6A 2V1XA 5IOYA 4IXAA 4PSXA 2L5QA 2L7ZA 3UKGA 4HF1A 2EMBA 2JOXA 2M7AA 3KX2A 4PFPA 3C1DA 3BR3A 1OMIA 2PLYA 3I55I 3MSWA 3RZOJ 2YU5A 4PJLA 2EE8A 1WHNA 2E7XA 3ZN1A 4IX7A 5AE3A 3P9KA 5LGTA 1EF4A 4A93J 4KIFA 3WU0A 2K5CA 2K4VA 1WJEA 3GTKJ 5LBQA 2L0KA 4XLHA 1KYQA 3ZMDA 4A3FJ 1K6OA 3EUKL 4P55A 3OTOE 1GXQA 5DCMB 4KZSA 2EA2A 2O3FA 1RIOH 4HDUA 2VE7C 1X6FA 1XMQE 4A3IJ 2EV6A 2ZCWA 3M9AA 2XF5A 1HLVA 4E7IA 1SFXA 2QF7A 4LF7E 4XLPF 1TWGJ 2DMPA 3GZNB 3ZN0A 5M3MJ 1ON2A 2DDAA 2E2HJ 3CCSI 3I56I 4A3DJ 3MHSC 1PP7U 2ZFWA 2RREA 2F4VE 3RDIA 2MD0A 1FBQA 4PFOA 2AS5F 1HC8A 1P47A 2EL4A 2HVSA 4HBLA 1Z1BA 1ODDA 1FTZA 2FQ4A 3JTZA 2HKXA 1MMSA 2KONA 3HIFA 4D1QA 1YIJI 4AVPA 4BBRJ 1RMDA 4HX8A 2D1HA 4M9ZA 4BEHA 2QQBA 1OJLA 1SD7A 1FOXA 3CP8A 2B7TA 4JX6A 5EGOA 1SAUA 1VNDA 4I99C 2EPRA 2LH9A 2OQGA 4BDZA 5DUKA 2FOWA 2PQ8A 3F8MA 2MA3A 3VODA 2LUQA 4M3BA 4M2ZA 2LY1A 2J5OA 2O0YA 2QYOA 1HW1A 2X4HA 4N9HA 4EJWA 4S0HB 4CH7A 1J5EE 3OYEA 1XB4A 1JTXA 3IHUA 1OKRA 2EN2A 4LGWA 2QGUA 3GFJA 3CJQB 4BE1A 1D0XA 2XAFA 2KP6A 2R7RA 3N97A 4QPQA 4LG3A 2M0CA 4B3ME 2IRFG 3TOAA 4AWXB 1JXSA 1ZLKA 2JA7J 5FLMJ 1N34E 2V7FA 1PP8F 4E7LA 3F6VA 5IYBJ 1ZU1A 4Y17A 2VT2A 5DM6F 2UWMA 4IQ4A 4LFBE 4N9IA 4JX4A 2M45A 4RB2C 2GOXB 1A1JA 1YW8A 3K1MA 1S7OA 1KU3A 1I6HJ 2EN6A 4NXME 2WTEA 4G7HF 1H8AC 4F52A 3TQNA 2IAIA 1B1BA 5DDGA 1BC8C 5DUIA 2M9AA 4F92B 1SC7A 1BOBA 4LFUA 2X6XA 3DPUA 5A69A 3ELKA 1TP4A 2JVGA 2MH9A 2GXBA 3LLHA 1HQCA 5F1RA 3EUHA 5F0HA 2NVXJ 3J7AY 4A3CJ 5BNGA 2DAOA 2VBYA 2ECBA 3HZJA 1R23A 1VZ0A 1IGNA 5B5EC 4ZDLA 2DPDA 2EMGA 1ZAAC 2QBYA 2X6YA 1MBFA 2LTRA 1XSVA 1MW7A 3CESA 3HHHA 3TGNA 4A5NA 4H4KC 3LA2A 2LJUA 2A07F 4ASNA 3DF6A 3BTCA 3HRUA 3PUFA 3GTMJ 1R1TA 1WH5A 3D5LA 2CV1A 5J47A 3GZ6A 1WQ2A 3HB9A 4LF6E 3RYPA 3FIGA 2FE3A 2JT1A 1AKHA 2ADRA 4L9TA 1R5ID 2FF4A 3F8NA 1FOKA 2HU9A 3J80K 2Y9ZA 3U2RA 2EMXA 3SYTA 5FFZA 2VODA 1AWCA 5IT9C 4DBRA 1TL8A 5FFXA 1AHDP 3CUOA 2HR3A 3V8JA 1J2XA 1VQ4I 4MEXF 2X1EA 5LEKA 2R7FA 2M8GX 4HW0A 3HOSA 3TW7A 1XSXA 3WGIA 3A2KA 3HOXJ 2HVRA 4IZZA 2X85A 3IWFA 1P9QC 4R2SA 1O3TA 2Y0MA 4XRSA 2ICWG 3JRGA 1GVJA 2F5VA 3F8FA 4FQGA 3WTSC 4YIFA 1XGSA 3W2WA 2MW8A 1A35A 1MZBA 4ZYHA 1FOWA 1AU7A 5C4XJ 1YLFA 3EYIA 3DF8A 1PUFA 1JKQC 2UUAE 5M5WJ 1Y8RB 2YS9A 4UVCA 1MNEA 3BJOA 3IAM2 2FBHA 2EBIA 2LRSA 4XKCA 2CGPA 4HA8A 2K40A 5FO5A 5F0CA 4D7MA 4U0YA 5JVGF 1XD7A 2P5LC 1IV6A 5HOOA 1XMXA 2VL8A 1U0JA 2JQ7A 3WG7H 5IP7J 1YRNB 3Q9VA 1D1AA 2QVOA 3BQYA 5BR8E 2X1CA 4HX7A 3SXYA 2C6YA 2LC2A 5H2FC 2Z5UA 4R2QA 2LK2A 2B9DA 2Q1ZB 2LTPA 2GA2A 1SD6A 4ENMA 2OC6A 1DUXC 4LLNA 2KIQA 2LR8A 5IXMB 5KL3A 1IJWC 5JVTA 5TGTA 3I59A 4BXXJ 4W1UA 2GA1A 4R2AA 2HXIA 4ZJZA 1RETA 5K5QA 5CLSA 1IN5A 2WAFA 2ZJRF 1NK2P 1ACIA 1OCZH 4DR6E 2DT7B 3IKTA 4CCMA 4KT5C 4XOTA 5J8CA 1V5GA 2VIXA 4WXHA 4C3HJ 1ZRDA 4DYCA 3FKIJ 4C2UA 1XCVA 4NQWA 2LTSA 5BOXA 2DOFA 1YFHA 3TOBA 2R7SA 3ABTA 3BG3A 3C18A 2K86A 3IUOA 1JHFA 2ACJA 3RYRA 4FX0A 1U3EM 3TDZC 3K4BA 1IBME 3ROUA 5ILUA 1X48A 2EM6A 3M1EA 2H1KA 4YY3E 1Y56A 2Y0SA 3LSIA 1SFEA 3SDBA 3FK6A 3F8BA 5IP6A 4PSWA 4LFCE 2PMZN 1XMKA 2A6TA 2HWVA 2HYFA 2O8XA 3ZMSA 5GTHC 2CQ7A 3BF2A 2UXDE 3F6GA 3CMYA 3RPUD 3D0SA 2IA0A 2GWRA 1FJGE 1QNTA 2WAQN 4X65E 3BLYA 1HDPA 1V5FA 3D5RC 4UHTA 1H89C 4J8ZA 2FEZA 4EM1A 5J8FA 2EIJH 5D6EA 1E17A 3HG9A 2DPUA 2W7NA 2M8EA 3LAJA 2O61A 3OS0A 3HGYA 3I4MJ 3BWGA 2RS6A 2VPRA 4E7ZA 2LKPA 2KHXA 2X48A 3ADGA 2LKSA 1XGOA 1IBKE 3P5JA 2BBYA 4PUSA 2EMHA 3PO3J 2E5NA 1U8BA 4CCNA 5J1YA 4RA2A 3FMSA 4RGUA 3RMPA 3F3XA 3Q0WA 4ZTFA 4Y52J 4PJJA 1F9NA 5H6QA 3F8CA 2KZVA 2LBSB 1R00A 3IRRA 1MH3A 4B3TE 4PJMA 5FRNA 1DQ3A 2M4IA 4I09A 4Y15A 3OMLA 4NUBA 3S3MA 1YO5C 4BNCA 1VTNC 2LV2A 1L4SA 4IJAA 2EH3A 1LEBA 2QCOA 1FZPB 3JR9A 3HOWJ 2ELKA 1LLMC 2I5UA 2X1DA 4KITB 2CSOA 2NUFA 2JPCA 1ETXA 2K85A 3ZMUA 2VQFE 2YTQA 3GTPJ 1JI8A 1VQ6I 1ZLJA 4NNJA 2M2EA 4CZZA 4DV6E 1ZTRA 1RESA 2FRHA 2QKLB 5EDNA 3OS1A 2YRHA 2FBIA 2ZBKA 2HOSA 1L0OC 2F5DA 5FKNA 3LOCA 1SR9A 3KP7A 4WFTA 1I1GA 2Z99A 3I3LA 1AA7A 5LGNA 1LDJA 1KQ9A 3KP3A 4CA0A 4YG2F 3L00A 4M74A 1KYZA 2FU4A 2EOSA 9ANTA 4M30A 2QQ8A 4BEHB 4F55A 1SEUA 1IN4A 2XAQA 1EV7A 2EIKH 2E1MC 2MYSA 5FKLA 3S32A 2M1BA 4HLXA 4YFNF 1EJ9A 2L92A 4MLQA 2DK8A 4XKVA 1W5CC 1SFOJ 5LL6R 3CCLI 1JT6A 3PIOF 4ETSA 1RUNA 3H3VK 2ADUA 3EPZA 4AQYE 5LRRA 2KRCA 3OSFA 3CO7C 3J81C 2VOPA 2FX0A 2CW7A 3CCJI 3KE2A 2GXAA 4MTEA 1WHUA 3FHNA 4LJZF 4XLFA 2LJHA 3C2HA 1TW2A 4KHPE 1IG7A 1R36A 3LSKA 1XPXA 4ZTJA 3OOPA 3MEXA 4FCYA 4I6ZA 3CDIA 2EK5A 2G0EA 2XGXA 2EN4A 2M7QA 3AG4H 3M8EA 4EMSA 2PRTA 2D45A 3OY9A 4MLOA 2L54A 2UU9E 3HOUJ 2MDRA 4HNUA 1LPQA 1YW9A 1ZELA 3J7YJ 1QZYA 3KP6A 3JRAA 2H8RA 4A3MJ 2DB2A 1XMOE 1FBSA 1A36A 2Z2SB 2J7JA 4AC0A 3WTTC 3QRFF 3HPZA 3TEDA 2R5YB 4I0BA 2VLAA 2K7LA 1FYKA 1NG6A 4PJNA 1FWZA 2LCEA 1ENHA 1B72A 2VJ5A 2M5WA 3RKXA 4RH8A 5L3DA 3KWRA 3AG3H 5KCMA 3ZOBA 4ESFA 3ZPLA 1A6QA 1WJ5A 3KEQA 4IJDA 1MSFC 4OMYA 1YI2I 2IP2A 3LNQA 1NTCA 2L2NA 1QZEA 2DYSH 2QZ8A 2NYXA 4M6YA 3GTJJ 4IO9F 5TRDA 3ZQGA 2M34A 4BY1J 2YU8A 2KQRA 2XKOA 1GUUA 2AQEA 2OD5A 5FROA 2EL5A 1J59A 1XSDA 1OCOH 1FBUA 1X1AA 3FK7A 4HAMA 2R7ZJ 3BY6A 2P8TA 2OJED 5K7HA 2EP3A 3KYDB 4MEYF 1BM9A 3V7RA 1Z9CA 1UHMA 2JRTA 3G4SI 1S72I 2RQLA 4BUPA 4CO8A 3EPJA 1ZHFA 4NC6A 4MHGA 3G73A 3GCMA 1B8IA 2Y31A 4B47A 3HOVJ 2B9SA 3U1DA 2Y48A 4DOZA 4CGZA 2D1VA 3WGHA 3AUZA 2IW5A 4Z6YA 3CDLA 1OLTA 3PNYA 1OYYA 2ME0A 4RM2A 3OYFA 1IAWA 1O7FA 3TBIA 1IBLE 2P4WA 1Z3XA 3MKWB 3JAMK 2WY7Q 1LDKB 3H0GJ 4MQVA 1QZZA 5AIPA 2VRDA 4B09A 2DRPA 2ZM6E 2L9SA 1UILA 4DIQA 1O0WA 1K61A 1FSHA 2XIGA 4KN4X 2EMIA 2QSHX 3K1PA 3H9JA 5H6RA 2NXNB 2DN0A 4R2PA 2L4MA 3FMQA 5M5YJ 5FLXC 3ZXSA 2VE8A 3CO6C 2L3CA 4K0KE 1WZ2A 2XSDC 4EJVA 1TQMA 5TSEA 1IDYA 1ZR9A 1IQSA 1JT0A 2EV5A 3HM5A 1HA8A 2BY2A 3DLLF 3EQLF 1E0EA 1MJAA 2OZ6A 4OMZA 4OINF 4HSTA 4HOBA 3WHBA 2NS8A 1Y6IA 1A1IA 3HYIA 3OYNA 4YIRX 2WB1A 2CW0F 4GYGA 2VE9A 1QA6A 4OIOF 4AVZA 2OV7A 4NZVA 3JSOA 3FF5A 4PZJA 4ABZA 4EM2A 2YTEA 4A12A 1P2FA 2CQQA 2COBA 2JVAA 2FMYA 4KIBA 2CUJA 3UNGC 1JGSA 3ADJA 2YTDA 4E7HA 1XGNA 4LITA 2EOOA 3I59B 2R76A 1R5HA 4BYYA 1K4TA 1BI2A 3ERMA 5D5VB 2G7HA 1RRJA 2IGMA 1E3HA 3CLQA 2JMWA 2VT3A 2EM0A 1ETOA 2TDXA 4WYQB 1WJFA 3HTUA 4HPQA 2ZO4A 2I9IA 4HDVA 5CFFE 4NQWB 4OIRF 4QWQA 3U1KA 1ZARA 5C44J 2K02A 4LU9A 4EJUA 2VQEE 3OS2A 2EQ1A 3P1XA 2BHZA 2MSYA 4FE4A 4OX9E 4ANJA 1PJTA 3L7WA 1ZBQA 3R6SA 1YG2A 2EM8A 2M87A 1FP2A 2KLOA 4RMNA 1JKOC 2O8KA 3L1PA 2HOEA 1OCRH 2F5EA 1SVLA 4KFCA 1QVTA 3BR1A 3A0HC 4HQEA 2JPAA 3ISPA 2VB6A 3T1BA 1P92A 2WBSA 3CCRI 1UG2A 4LF8E 2VKDA 3KEYA 2O6GE 3DQVC 4E7KA 4XICA 1X5WA 2IGNA 3JRDA 3IC7A 1K4SA 5D4RA 4DUYE 1F2IG 1XC5A 1LFPA 1UG0A 3KP2A 2DFFA 4DV2E 3TO6A 2ELZA 2E1MA 3QPTA 3L2RA 5DNYA 3LWFA 2RQQA 2A69F 3PQKA 4XKWA 2FQ3A 3GXOA 4BQAA 4RB0A 1HKSA 4DKKA 2HDWA 4I98B 2JYAA 2V1UA 4ZYGA 3JU0A 2YRMA 1QQIA 3CCMI 1LFUP 4HF0A 3K4JA 1REPC 2MGQA 5AE1A 4IHXA 3GTLJ 4Y3OA 1PDAA 4O5GA 5FKOA 1H88C 2AO9A 2LNBA 1KYWA 3I64A 5KL7A 3ZR8X 4EGZA 1VQ9I 2RGVA 1UBDC 3ML6A 2EMYA 4L5NC 2QLZA 1G3TA 3W6VA 4RDUA 5ICCA 2GHFA 2GZWA 3M7GA 1S9HA 2H94A 5ICGA 1I3AA 3CF5F 3E6MA 2CO5A 2DFHA 5GAHJ 2MLGA 5E3OA 2HOTA 4N4RB 2CH0A 1Y39A 4DZPA 4JQFA 3NWSA 2XAGA 4P5OA 3MAJA 2K4JA 3JRHA 1FNNA 5GAEJ 4DR7E 2HQ5A 5HDKA 2QUFA 5HDNA 4XNFA 5GAGJ 1WWXA 1FMWA 2EZLA 2XHKA 4XRFA 3K69A 5IY5H 1ZKGA 2VUMJ 4RBOA 3S8PA 1HF0A 2EILH 3KZZA 2WBUA 2HEOA 2GOMA 3EPHA 4I76A 4M3FA 3RCOA 3FHZA 4BC7A 4M3GA 4OWRB 2B7EA 2PN6A 4A3KJ 2BVMA 4ZC3A 2CYYA 3QP6A 2D5VA 1K79A 3FXLA 1TT0A 5BPIA 2MD5A 5D5UB 2IGOA 1BA5A 3GFLA 1KU7A 1QPMA 1WJCA 1V5EA 1X3WB 5AASA 2WBTA 1N77A 4YIIA 4R1HA 3QOEA 2O03A 2ESHA 2G7UA 4BCAA 4R2EA 2X6OA 3LMMA 2OQRA 4GRIA 2NS0A 3LSGA 4FHTA 1FJLA 3M4OJ 1Z3YA 2X9DA 2PBIA 2XAJA 1RZ4A 2F2EA 3HRTA 2VBWA 5LGUA 5GPCA 1H9TA 1P4WA 3K6GA 1Z7UA 4B8XA 3HQ1A 5A2QK 1B4AA 2WV1A 2E1NA 4I2OA 4C2TA 5C4JJ 2DYRH 4OAYA 1P4AA 4UNOA 2EOXA 1E3PA 2JRMA 1I39A 3ECRA 1FC3A 1IW7F 5E8GA 1OPCA 3OYJA 2BVLA 4JK1X 2P0WA 4A2UA 1GV5A 3E7LA 4MQ9F 4GZNC 4Q4ZF 5LLQA 2V6EA 4D7NA 1JUSA 2P5KA 1KGSA 1U6GA 2N8GA 2Q2EA 3JW4A 4JI7E 3UK3C 3FXOA 1U5TC 2W84A 3RZDJ 5LMNE 4JV5E 2EA4A 3H35A 2HQNA 1B72B 2Z1DA 3PNTA 4HQMA 4BMJA 4UXNA 3VYUB 2Q8UA 3OMYA 3FM5A 1POGA 4XOPA 1NH3A 1GHCA 3V8LA 1MH4A 1QRYA 4A0XA 1N36E 2YTNA 3UR3C 4BY7J 3L2WA 4BQOA 3MKLA 2JA8J 4PJ0C 2IS6A 1G2FC 3WTWC 2IS2A 1DGRM 2NOJB 2V6CA 4KIGA 1ZK8A 2OPTA 2LBFA 3WU2C 2L7FP 1HXDA 1QPIA 3VPRA 2UV1A 1RQ0A 3G3ZA 2EPLX 5B1BH 4L9JA 2OBPA 3E3VA 3RQIA 3LMLA 2QKMB 1OCTC 3E0JB 2DMQA 3GFIA 2NVYJ 4KYWA 2NUGA 4M9VC 2CFXA 4C3JJ 5HLIA 1HSJA 5L3CA 1JHHA 1WI3A 2MC4A 3S93A 3A1YA 3VSLA 4AIDA 2A5YB 1G4DA 3LSMA 1Y1VJ 5A6KA 1B8IB 2CT1A 1FY7A 1YYOA 4Y4RA 1IXRC 3M8FA 4EJTA 1XDSA 1WJBA 4M6XA 4O43A 5A6JA 5LEJA 2WBMA 1WI9A 4F7ZA 3S16J 4LTYA 5A6AA 2EFQA 3VEPA 3PUBA 1GVDA 2EOYA 2DA2A 4X66E 4UV9A 1YX5A 5F1JA 3GUDA 2ELHA 3KYCB 1ON1A 2ZFUA 1FSEA 2ENHA 1LKXA 2YPRA 4EVIA 2EQ3A 1D8JA 1PJQA 2CV2A 1Z05A 1G2HA 3AV0A 4JI2E 3HL2A 3BZKA 5D6FA 1I1SA 2EFPA 4CCOA 4KDPA 3GF2A 4NHJA 2KFDA 1BW6A 2F4IA 1U8RA 2Q8KA 2VQCA 1BR2A 1T0FC 2VXDA 3H9GA 3AL0C 2DU9A 1Y1WJ 2D2WA 1I27A 5EEGA 1J09A 2BGCA 4HX4A 5M5XJ 1R7JA 2DMTA 3WG9A 1SD5A 2GM4A 2R5ZB 5E8IA 5LRSA 1IO2A 4M73A 4OOGC 4P9UA 3ZP5A 1W0TA 1I50J 1S29A 2X6WA 2FD5A 1MBEA 2HYJA 2ISYA 2WAEA 2UXBE 2XASA 4F6NA 3CUQC 3F6HA 1WHQA 2XF6A 3NEUA 5HS9A 2O5RA 3V7SA 2DA7A 1JJ6C 2Z9OA 4HTGA 1HKQA 4AU7A 2QQ9A 1W5TA 3NARA 2ZMEC 2KRHA 1IMUA 4II2A 2DMYA 1W7PA 4DZJA 3N05A 3TKYA 4WCGA 2PX9A 1STUA 3G1LA 2YTIA 1TT5B 4HV6A 1E3OC 4KMFA 1KQ0A 1W4MA 3W3CA 4RGXA 3LSHA 4U7DA 3IH2A 3KP5A 1WJDA 2R92J 3F9KA 2VOOA 2FV4B 5A2QZ 1X6HA 4DUZE 2GLOA 3DEEA 3A01A 3AFHA 1OYWA 4ITVA 4WSPA 1N33E 2EMWA 2LT7A 1DP7P 1BJZA 2EPUA 2QEXI 3W6KB 2R1FA 2N8XA 2IEKA 3PIPF 1W0UA 2BXZA 2VQGA 3L2CA 3H5AA 2CQNA 3WU1B 1ZGJA 4DYRA 4O6JA 5HS8A 3ECHA 2KL4A 5H20A 3JRIA 2Z3YA 2LYCA 2HFHA 2EZIA 1SFUA 4E70A 4ENJA 1BBOA 4X0GA 2GPIA 3CCVI 4Y13A 3B02A 1ZG5A 5HNFA 1D0YA 4AUXA 5HLTA 1GT0C 4GKJE 4O4KA 2RVCA 4CICA 1T33A 4BDYA 4JBAA 4R2DA 4RS8A 5JLXA 3C2BA 3K2AA 2BY0A 3ONQA 1ZAOA 3VDXA 4KA4A 1ZRCA 2NVTJ 3QG5C 1DDNA 2DT5A 2ZSHB 4X62E 3EDPA 4RM3A 1MMNA 4M3DA 3EPLA 1R1VA 5EJCA 2EPKX 1HNWE 1KJKA 1W1WE 3W6JB 3GWZA 2A6EF 2K9QA 5E3NA 3CQZJ 2CFOA 1DPRA 1KU2A 3JTHA 2R7TA 2RN7A 3DJWA 5E1XA 3OR2C 4WK8F 3WTUC 1YITI 4A3BJ 4TUGA 2DA6A 4XL9A 2NRAC 3BDDA 3JCUC 3GFMA 4UVBA 2P7VB 4A5MA 2DT6A 3CMEI 3RKQA 1QU3A 2DDBA 2K9LA 4BJTA 5EEHA 2B63J 1G3YA 3S2HJ 1PVEA 1R58A 2VASA 1XG1A 2QSFX 3H36A 5D5WB 3CCYA 1NHAA 4JP0A 3OOUA 3SZPA 1L3LA 1FX7A 5HLHA 1H0MA 4F9AB 1PJSA 1R22A 2EPMX 4BXUA 2YTOA 1N75A 1IQOA 4HNTA 3C4TA 4IL6C 1OFCX 2HKOA 2Y30A 3U21A 2EINH 4RLFA 3CJTB 5EEAA 3CC4I 1BL0A 2NABA 4ZZLA 4M9SA 3BZ6A 2Q0OA 2ZJPF 2EOIA 3PFYA 2RNGA 1JK1A 4IQJA 1BB8A 2E19A 3RPQA 2EPAA 2WC2A 2DXIA 2DMUA 1XS9A 3GX4X 1D0ZA 3X2QH 3HGGA 4V19K 2EJ4A 5B3SH 1SAXA 3HBLA 1D1CA 2E35A 1FP1D 3VOEA 3K9TA 4Q28A 2AXTC 2GIVA 2KDOA 2IGKA 3JRFA 2CUEA 4BE2A 4XONA 4DR1E 2E5LE 1KZHA 1S5LC 3ZRGA 1OQYA 4QLCU 2V9PA 3CF2A 5DYMA 4P78A 3C3WA 4AD9A 2CPNA 1ORKA 1RC9A 3AG1H 1IC8A 4B1RA 4HF2A 1YHQI 3RQ4A 2KOUA 4WSGA 2K3FA 3R0JA 1ULYA 3D5SC 3HPGA 5J1RA 3THNA 4F54A 1FIPA 2GQQA 4JI0E 2VI6A 2EPPA 4RAGA 2DCEA 5CPRB 3JRBA 3BTLA 1R9TJ 4IHTA 1YZ9A 3IP4B 2IBDA 4JYKA 2IHR1 1XNRE 1IZ1A 3E5QA 4MO7A 2M7BA 2YTGA 3PSIA 5CVJA 2EQ0A 4A3GJ 3RJPA 3R61A 4XSZF 5EYRA 2XGCA 5CVIA 4BBSJ 4KICA 3HHGA 2YT4A 1F5TA 2BE5F 1RR8C 4DR4E 4NBQA 1WGXA 2P81A 5F64A 4ZDPA 1UN6B 3ZOQB 3BG6A 2LF7A 4V2GA 4ZZDA 3PO2J 1A5JA 3ZGKA 1VQLI 2EJRA 3DCFA 3A02A 3SZTA 1VFCA 3M99B 2NAZA 4WF2A 2MDGA 3IWDA 1T08B 5HLGA 2HQRA 2KT0A 5KK1A 1PJRA 3FMRA 3CMMA 3WGGA 3ZMTA 3MKYB 3HXLA 2LBFB 3ZMVA 5JHUA 1WSUA 3HPSA 1MIJA 1V3FA 2EN3A 3R4KA 5K1YA 2LLKA 1T39A 1MNDA 2VF1A 2FBKA 2YSOA 1MBGA 2CG4A 2LG4A 3KEOA 3HUGA 2YSPA 4R03A 1Z6RA 1KU9A 4AIJA 5F08A 3O8GA 1G59A 2FJ1A 4NC7A 5ED4A 5EGOB 1RPWA 2FOKA 3S3NA 4H0EA 2ZNZA 3HKZN 4L0ZB 3S15J 4P9FA 4BHBA 5E3LA 3OYLA 1MNMC 3K4CA 1IUFA 1YUIA 1VQOI 1LNWA 1YS6A 3DXJF 3HRSA 5EZGA 3CJRB 4M0VA 4U0WA 3ZQFA 5KL4A 2ME6A 3MZHA 4DMIA 1R4NB 3KETA 2HDDA 1QO0D 2LVHA 3T0YA 2F4MB 1YUJA 4K2EA 4UY8I 3R60A 3CCEI 4DBQA 4I0AA 3FBNB 1LDDA 3QWLA 3F72A 2EN8A 1YJNI 3VB2A 5DCFA 3HTSB 3KP4A 1ZR2A 3MZ8A 5LD2C 3FXMA 1N78A 2V87A 1UFMA 4DV7E 2STWA 2FXAA 3GVAA 4N0BA 1BR4A 1OISA 4FE7A 4QSHA 1WCMJ 3H9QA 4BL0B 5LHIA 1Z77A 4L5IA 3KPHA 4FETA 4E4HA 2PFBA 5F6FA 2DGCA 1I6XA 3DP7A 2JN6A 3I9V2 2R4GA 3ZQIA 3S14J 4E7SA 4EV0A 1A1LA 2Y2ZA 4G12A 4GCVA 1O7LA 5JI6A 2R7WA 4MLVA 4M72A 1MD0A 4BQNA 3FBIB 2PI0A 5J3LA 4HLYA 3IV5A 4DR3E 2YR2A 2QBYB 4D5FA 2JA2A 4EQQA 5E17F 2IS4A 1X2NA 4JI4E 2JK3A 1W7PB 4CYCA 1TWFJ 4XQFA 5L3FA 4WPYA 2HGCA 3OSGA 4DV3E 2V88A 3RIRA 2ZKZA 1UZCA 1UJ8A 1B59A 2EQRA 4LK0F 5T6JA 3QPLA 4O5VA 4RAYA 2E71A 4QTRA 4II3A 2DLQA 4HEIA 1A04A 2H6BA 2EFWA 1AKHB 3NAUA 4NDLA 4JOMA 5IT9K 5JR3A 1FOYA 2Y75A 1FYLA 3I4NJ 2JOBA 1RC7A 3DTEA 1GXPA 1NCSA 5K7ZA 2A05A 2UZKA 2H36X 2HPIA 2FA5A 1AAYA 3OR1C 4KT6A 4L9NA 2G9WA 2LRDA 3U9GA 1TBXA 2XPVA 2LFBA 1UHWA 4AYBN 2HI3A 4OIPF 5GPAA 3M1CA 5ICFA 1V54H 3Q0VA 2L6MA 3K7AJ 2M4GA 3TL4X 3HSRA 3G71I 2PMHA 2QQAA 1V4RA 1G8XA 3DPLC 3DEWA 2LY2A 2DO7A 1J7KA 2DK5A 3LQQA 1MKMA 2X0LA 2EPNA 4ON0A 1XNQE 2CUZA 4YFKF 2XKPA 1TNTA 2VJIA 4GGGA 3FIWA 1PUFB 2JY9A 3BGHA 2IS1A 2CQXA 1ZBTA 1BIAA 1UHSA 2VC1A 2RDPA 1A1GA 2PMZA 1IDZA 3E6CC 3C4BA 3SHFA 2VXZA 1HR0E 4F91B 1RI7A 5D8LB 3DEUA 2JXPA 2WAQA 1XTAA 3HOTA 2MFZA 2DW4A 2MBFA 3BPVA 2H1LA 3NQOA 4U0VA 5KHDA 2HXOA 2OUMA 3CTAA 2MKDA 4J01A 1T95A 4KN7X 3ULQB 4L5EA 1GLNA 2VPLA 5B66C 5AE2A 4YRVA 4BGDA 4CCLA 2EM2A 5TISC 5ILSA 2UXXA 3B73A 3DTIA 4M6VA 3KLOA 4Q35B 5KVRA 2EPFA 3MFKA 3W2AA 4XR6A 4EM0B 2BW3A 1J5YA 3G1OA 2YX7A 4C30A 1R49A 1OR7C 4WXCA 3AKZA 2YZTA 1KA8A 1F36A 3J7Yp 3RKYA 1BI0A 3OWTA 1BI3A 2YPNA 1N25A 1Z1DA 5TJJA 3VYXA 4AM3A 3HEFA 3J7ZI 4UB8C 1D3YA 5LFAA 2RNJA 2DOEA 3S2WA 2H27A 1LB2A 4YHHE 2ZNYA 4A0YA 1GV2A 3LA3A 3JTGA 4LF9E 3WE2A 1WJAA 2KIMA 2WA0A 2F48A 1J9IA 2XGEA 3OIPA 5ADZA 2EPOA 1DQUA 3PL8A 3K4MA 1I94E 1D5YA 2L2KB 4XSXF 2BY3A 1XN7A 1YIOA 1ZYRF 2MH2A 1HBXG 1TQIA 4G7OF 2BY1A 1AOYA 2JUGA 1U78A 1YQAA 2VJJA 2FNAA 1DI2A 2EOJA 2JZYA 2E7WA 2KIFA 2CQKA 3E6BA 1S3JA 4XN3A 1FYMA 2EPXA 3ADIA 4EJOA 2EWNA 3MQ0A 5DTDA 3GLXA 1ZR4A 3Q5FA 2JSCA 3VYTB 4DJAA 1YPNA 5FJ8J 2FNPA 1TWCJ 4IPAA 4B48A 3J80C 3L9FA 2JWOA 5DD8A 4CCKA 1HDDC 2DA4A 3GO5A 1MMAA 5GP9A 1APLC 2LF8A 3KZIC 2MABA 1LUJB 2EOEA 1B9MA 3WTVC 3WTZA 2L9VA 2ETHA 2ENAA 2LSOA 3OYGA 1I5ZA 3EQ1A 5KNLA 1QBJA 4JI5E 4B3XA 4BHPA 3HPHA 2BBGA 3OYMA 2CW8A 1SVOA 1HKTA 4HZFA 1YTYA 2E72A 1Z7LA 1YJ9I 2Y9YA 3FXRA 1VQ8I 4HV5A 2UUCE 1SVMA 3PFIA 2DA3A 2L02A 1X3ZB 4G6QA 2YTJA 5LHHA 3IKVA 2EZ6A 2EOHA 4F9CB 2F5FA 3F22A 4I02A 3H5NA 2HVQA 3V7CA 1R6RA 3A03A 2EMKA 3C6KA 4DR2E 1OYIA 3L2VA 3L2UA 3T8RA 2W00A 4KNYA 1P4XA 2ID6A 1VF9A 2FGGA 4WX9A 5IT9Z 5JFRA 4F6MA 5CVRA 4CUGA 5IOZA 1USSA 2CRGA 1PKPA 1QVUA 2V4JC 1BBGA 4FISA 3QU3A 4XMYA 2M30A 5F3WA 4ESBA 3RTRA 4YFXF 4XRMA 1OCPA 2EFNA 1U9NA 2EL6A 1RR7A 3K6QA 1ETYA 3OYDA 5A6BD 5CJ9A 1MGTA 1Z21A 1X19A 2VKVA 4CCJA 1P7JA 2Y69H 4NHRA 1GZ6A 1BIBA 4IKFA 3KCCA 3NWTA 2V1NA 4R8OA 1QHHD 3HUGB 2V8QB 2V1DA 1DPUA 3GW2A 1Z67A 4D9JA 1XCBA 3FX3A 1PDNC 1HNZE 4G7ZF 2K7IA 3SFZA 2DFEA 4MFDA 2DBBA 2CU7A 3ASOH 3J81K 4LF5E 4RGSA 5AONA 3H09A 4JYAE 1K83J 3HOYJ 4LG0A 2PJRA 4IHYA 4OU0A 1YYWA 3OYCA 2GBYA 2NVQJ 1TN9A 4FK5C 3TMOA 2IJLA 4BKXA 3FXQA 5KAIC 2LDUA 2DLLA 4XLNF 2EN7A 3JSPA 4IRIA 5JLWA 1IV8A 1TTYA 1F4KA 4PDKA 1VQNI 2BEOA 2OCCH 4HNVA 3S1NJ 3LSTA 4CYDA 2E2IJ 2EOMA 3TQMA 3RI4A 2I13A 2QM3A 4ZDOA 4MIMA 2L9NA 3SFIA 3RPUA 3SDGA 2B0LA 3O3KA 2EN1A 3DKYA 1MDMA 2GXGA 4BXFA 2NNYA 5AC5A 3HC7A 5HODA 4I8OA 4B3AA 2BZTA 2R7QA 2IA2A 4L5JA 3K70D 4RAFA 5JHFA 4JI3E 4GO1A 3QAHA 2EM5A 2RSMA 4FT8A 3GYHX 3GLLA 3HOZJ 3S1MJ 4C2MJ 2EZHA 2HTJA 3TP3A 4XK4A 3ERED 2BB8A 2YSRA 2EOZA 2L9RA 5DM7F 1QGPA 2EOFA 2LUPB 3KLNA 3L2QA 2OTLI 2DIXA 2E36A 1P7IA 5L3BA 2LVSA 1BI1A 4XORA 3CC7I 4HSRA 1MEYC 4CYCB 4GXOA 1BW5A 3F23A 2B7VA 2W48A 1IUYA 3OYAA 1ETQA 2F5CA 4A0ZA 1GQEA 4I01A 4WWCA 3LQRA 4GDFA 3B6CA 3FXJA 2VBZA 3BJAA 2H09A 1ETWA 2VQHA 4RB1A 1RKWA 1IRZA 2W24A 2ZXWH 5IYDJ 1X3UA 3BR0A 2OA4A 5J4YA 1T56A 2Y0SN 4BH9A 3ASNH 2EFOA 4IEJA 4WXDA 4A3LJ 1OR7A 3S3OA 2ID3A 2AQFA 4X8WA 2RQPA 2HTSA 2DLKA 4S04A 4ZYEA 1GDTA 1TWAJ 4F3QA 2EMLA 2EMFA 4JI1E 2PMUA 1TQPA 2V83A 5CVUA 1X47A 2ZB9A 1HOMA 4IS1C 4J19A 1JTYA 4JX5A 3MMYB 3J7AG 2L3JA 2XV4S 4BQQA 2MC5A 5FLXK 3M3YJ 2XVCA 3LL7A 5HS7A 5EG0A 2JJ7A 1SMTA 4AIKA 3LFUA 2O7OA 2KHMA 2ELYA 5FD6A 3EYYA 4OOIA 1M1EB 4GYIA 4B4CA 5DD4A 4ENKA 2RSIA 4DYQA 3BPXA 4ZYDA 4LF4E 1O3QA 4MNUA 3DFGA 2RTXA 3WODF 2UUZA 2I8DA 3QOPA 1XDUA 4LK1F 4U88A 3MZYA 2ZJ2A 5AC4A 2IXSA 2WV0A 3E6DA 4BE0A 2JTVA 1VQ5I 1I3QJ 3BCAA 2PJPA 5K7FA 1HSTA 1USTA 1A6IA 1MBJA 5GADJ 2M1SA 3EPKA 1X58A 1IN6A 4L18B 4LIVA 3H92A 1TF6A 1HW5A 2XRLA 1T98A 1X4PA 2ZC2A 1T6SA 2WADA 3R0AA 3FM3A 2R5YA 4DV5E 2KKOA 3HTXA 1YOVB 3FDYA 2X51A 4LOCA 2BW3B 3EETA 1QHGA 4B44A 3TO7A 3J81Z 3H5RA 2LE2A 3GZ5A 3SQNA 1KONA 3KFWX 2JWTA 1JE8A 3FKJA 1J75A 1WRJA 2OZUA 2RKHA 5ICEA 1UB9A 5CQGA 4ENNA 3F0CA 3BTJA 5E3MA 3OYHA 1IRFA 3SEZA 1JUPA 1EKEA 3Q9SA 3KYLA 4G9YA 1T4OA 3BBGA 2EMZA 5IWAE 1XMAA 3HRMA 2STTA 2L33A 3MHHC 4UB6C 3LAPA 2JR1A 1Z6TA 2WCC3 2XC7A 4U87A 4IOAF 3DU6A 2V85A 2HHHE 3K4LA 1ZH5A 2K9SA 1JGGA 3H3ZA 4D0PA 5J1UA 4ZYAA 2KRFA 1BBYA 3K4NA 1ZRFA 5EZHA 2L8TA 3REOA 2YRKA 1YYVA 4IHWA 2EORA 2ENCA 1BJAA 2L2OA 1EA3A 2NS7A 2A5WA 2YTFA 3IWZA 2E1MB 3K2ZA 3T8TA 3O6BB 3H1CA 3ZQQA 3GTOJ 3J7AO 1WPKA 3BOQA 4E7JA 4BHCA 1T4NA 3JAMC 3BR2A 2CS3A 4M9XA 4XLCA 4CSWA 2DMIA 3RSNA 4CDGA 1LVAA 4N4OB 2XB0X 2COMA 3CCUI 4XRSG 2R7OA 3QPHA 3GEZA 3K70C 5M3FJ 2DJNA 2QA4I 3I53A 5BPDA 4IHVA 2V89A 2J5PA 2R7UA 2JA6J 2QENA 5F27A 1B69A 1K6YA 5FB2A 2R0QC 3WHCA 2RPCA 4DV4E 3K4KA 1LE8A 1N32E 3ABLH 2NNNA 2P5VA 3THOB 4XBFA 4JI6E 3FWEA 3TO9A 4LFAE 2JA5J 4RLQA 3DV8A 2JPBA
chains in the Genus database with same CATH topology
1S8NA 5HDGA 1BC7C 3E97A 1U5TA 3QU6A 3PQJA 2XROA 2ISZA 1SD4A 4AIHA 3HSFA 1C0WA 4DQ2A 1F1ZA 1G6NA 5FLXZ 1ZN2A 4UV8A 3P9CA 4BAYA 3LFKA 5CVVA 4O3MA 3I5UA 1Y0UA 1CGPA 3P7NA 1LJ9A 1EH7A 4LG0B 2HYGD 1WKMA 1P6RA 1T2KA 5BS6A 3IRQA 4R8HA 1K78A 1J0RA 1TNSA 1CF7A 2KIUA 5ERIA 4PGHA 1STZA 5E1ZB 3DKWA 2V79A 1MDMB 4KUMA 5E1WA 2A6HF 4HYEA 3L09A 2H6CA 3BROA 5DEQA 3H3UA 3NRVA 3P9IA 1YW7A 1R5GA 1BN5A 3F6OA 5ILVA 1T0FA 4DNCA 2BYVE 4KMUX 2HDCA 3F21A 6PAXA 4ESJA 2QWWA 3J80Z 4LLLA 3CUQA 1E2XA 3V4GA 5HVQC 3MCZA 3I58A 3KZYA 5AIQA 2ZMEA 3TDUC 2VBXA 3WTYC 5J6XA 4UVAA 1Z91A 4G94A 4RGRA 3E5UA 1Q1HA 2ESNA 3WTXC 1D8KA 4M71A 2XUBA 2IVMA 5BQTA 3HSEA 2GAUA 3WE3A 3MWMA 4LB5A 2VC0A 1O3RA 1B9NA 3ABUA 1IRGA 4RB3C 1RNLA 1HW2A 3AAFA 2P6TA 4MTDA 1TLHB 3ECOA 1K7AA 2VN2A 2XRNA 1IF1A 2XAHA 1W7PD 2HZTA 3C7JA 2A61A 2MC3A 1T38A 4IRHA 2WWYA 4CXFA 2BV6A 2MLKA 5DCMA 4Q5SF 2E1CA 1TW3A 1R1UA 1MJBA 4I7HA 3V8KA 1ZG1A 2PG4A 2DQLA 5L3EA 1LQ1A 1IXCA 3K0LA 2DQRA 2VONA 2CWEA 5DV5A 3BP8A 2AXLA 4FX4A 4A6DA 1IN7A 2YU3A 4IVNA 3E5XA 1PUEE 2OU2A 3DPTA 2P6SA 1ZGAA 4Q47A 2DTRA 2W57A 4P96A 3RKWA 2FMLA 5D4SA 1SMYF 1W5SA 3I71A 2W85A 3FZVA 1G3WA 1D5VA 2P7CB 2ZXJA 2A68F 4R79A 5CYVA 4G8XA 4RAZA 5K5OA 5FD5A 5IT3A 1LEAA 1U5TB 2DI3A 1S7AA 2EB7A 5E20A 2L01A 1RUOA 4S05A 1MJ9A 2IA1A 2W25A 1FPQA 2L3DA 3ZMZA 2L4AA 5K5RA 1ZG3A 3I4PA 1H9GA 1O57A 4PGGA 4TV7A 4ZH4F 2V9VA 3CLOA 2UXNA 4LD5A 2EV0A 2Z33A 1EH6A 2KJCA 1BOAA 2R7DA 3O2PE 4G6DA 4NB5A 4L0YB 5BMZA 3QP5A 4Z2YA 2IPQX 1K78B 5D8KB 1CF7B 1S6LA 2YX4A 1UCRA 2PEXA 1YS7A 3K1NA 2R3SA 3FXUA 3CJNA 3BJ6A 2DFIA 2HS5A 3T5XA 5LHGA 1G3SA 4L9VA 3VFZA 1XGMA 4IF4A 4OIQF 1FLIA 3IL2A 4LLGF 4U7BA 4MGRA 2RC4A 4LB6B 1FT9A 5D5XB 3N4MA 1U2WA 1IXSB 5E18F 3LA7A 1KQ8A 4IHSA 1ONVA 1ZREA 3CUQB 1EH8A 4A6EA 4CHUA 2ZMEB 3JAMZ 1IN8A 4Q48A 4IRGA 2RV8A 5L3GA 2IT0A 4PCQA 3COAC 2K27A 3OV8A 1B6AA 3CDHA 3I54A 5FGMA 3ZQ7A 2K4BA 4LMYA 4EGYA 1O3SA 3I0TA 4UUVA 2KJBA 2A3SA 2OAZA 2FSWA 2V1XA 4IXAA 4HF1A 3C1DA 2PLYA 1OMIA 2E7XA 3ZN1A 3P9KA 5LGTA 4KIFA 3WU0A 5LBQA 3ZMDA 1K6OA 4P55A 1GXQA 5DCMB 2EA2A 2O3FA 1RIOH 4HDUA 2EV6A 2ZCWA 3M9AA 1SFXA 4XLPF 3ZN0A 1ON2A 1PP7U 2ZFWA 3RDIA 1FBQA 2AS5F 4HBLA 1ODDA 2HKXA 3HIFA 4AVPA 4HX8A 2D1HA 4M9ZA 2QQBA 1SD7A 2OQGA 5DUKA 2PQ8A 3F8MA 2MA3A 3VODA 2J5OA 2O0YA 2QYOA 1HW1A 2X4HA 4N9HA 4EJWA 1XB4A 3IHUA 1OKRA 4LGWA 3GFJA 2XAFA 3N97A 2IRFG 3TOAA 4AWXB 1JXSA 1ZLKA 1PP8F 3F6VA 4Y17A 2VT2A 2UWMA 4N9IA 2M45A 4RB2C 1YW8A 3K1MA 1S7OA 1KU3A 2WTEA 4G7HF 3TQNA 5DDGA 1B1BA 1BC8C 5DUIA 4LFUA 3ELKA 2MH9A 2GXBA 1HQCA 5F1RA 3EUHA 2DAOA 2VBYA 1R23A 2DPDA 2QBYA 1XSVA 3HHHA 3TGNA 4A5NA 3LA2A 2A07F 4ASNA 3HRUA 1R1TA 3D5LA 3GZ6A 1WQ2A 3RYPA 2FE3A 2JT1A 4L9TA 2FF4A 3F8NA 1FOKA 3J80K 3U2RA 5FFZA 2VODA 1AWCA 5FFXA 3CUOA 2HR3A 3V8JA 1J2XA 4MEXF 5LEKA 2R7FA 4HW0A 3HOSA 1XSXA 3WGIA 3IWFA 1O3TA 2Y0MA 1GVJA 3F8FA 3WTSC 4YIFA 1XGSA 1MZBA 4ZYHA 1YLFA 3EYIA 3DF8A 4UVCA 3BJOA 2FBHA 2CGPA 4HA8A 5FO5A 4U0YA 1XD7A 2P5LC 5HOOA 3Q9VA 2QVOA 4HX7A 3SXYA 2C6YA 2Z5UA 2GA2A 1SD6A 4ENMA 1DUXC 4LLNA 5JVTA 3I59A 2GA1A 5K5QA 5CLSA 1IN5A 3IKTA 5J8CA 4KT5C 4WXHA 1ZRDA 1XCVA 4NQWA 5BOXA 1YFHA 3TOBA 3ABTA 3C18A 2K86A 2ACJA 1JHFA 3RYRA 4FX0A 1U3EM 3TDZC 3ROUA 5ILUA 3M1EA 1SFEA 3F8BA 1XMKA 2HYFA 2HWVA 2O8XA 3ZMSA 3D0SA 2IA0A 2GWRA 1QNTA 4UHTA 2FEZA 4EM1A 5J8FA 1E17A 5D6EA 2DPUA 2M8EA 3LAJA 2O61A 3BWGA 2LKPA 1XGOA 2BBYA 3FMSA 4RGUA 3F3XA 1F9NA 5H6QA 3F8CA 1R00A 3IRRA 4I09A 4Y15A 1YO5C 4BNCA 1VTNC 4IJAA 1LEBA 2CSOA 2JPCA 3ZMUA 1ZLJA 4CZZA 2FRHA 2FBIA 2ZBKA 1L0OC 2F5DA 3KP7A 1I1GA 2Z99A 5LGNA 1LDJA 1KQ9A 3KP3A 4YG2F 3L00A 4M74A 1KYZA 2FU4A 1IN4A 2XAQA 1EV7A 4YFNF 2M1BA 4HLXA 2DK8A 4ETSA 1RUNA 2ADUA 5LRRA 3CO7C 2VOPA 3KE2A 4MTEA 4LJZF 1TW2A 1R36A 3OOPA 3MEXA 2EK5A 2XGXA 3M8EA 4EMSA 2D45A 2L54A 1YW9A 1QZYA 3KP6A 1FBSA 3WTTC 3QRFF 4I0BA 2K7LA 1FYKA 1FWZA 2M5WA 3RKXA 5L3DA 3ZPLA 4ESFA 3KEQA 4OMYA 2IP2A 2QZ8A 2NYXA 4M6YA 5TRDA 2XKOA 2OD5A 1J59A 1XSDA 1FBUA 4HAMA 3BY6A 2P8TA 4MEYF 1BM9A 3V7RA 1Z9CA 1UHMA 2JRTA 4CO8A 1ZHFA 4MHGA 3G73A 3U1DA 2Y48A 4CGZA 2D1VA 3WGHA 2IW5A 1OYYA 1IAWA 1O7FA 2P4WA 3JAMK 1LDKB 4MQVA 1QZZA 5AIPA 4B09A 1FSHA 2XIGA 4KN4X 3K1PA 5H6RA 2L4MA 3FMQA 3CO6C 2VE8A 4EJVA 1TQMA 2EV5A 3EQLF 1MJAA 2OZ6A 4OMZA 4OINF 4HOBA 3HYIA 2CW0F 4GYGA 2VE9A 4OIOF 3JSOA 3FF5A 4PZJA 4EM2A 4A12A 1P2FA 2FMYA 4KIBA 1JGSA 1XGNA 3I59B 1R5HA 4BYYA 1BI2A 5D5VB 2G7HA 2VT3A 2TDXA 3HTUA 2ZO4A 4HDVA 4OIRF 4QWQA 1ZARA 2K02A 4EJUA 3L7WA 3R6SA 1YG2A 2M87A 1FP2A 2HOEA 2F5EA 4KFCA 4HQEA 3ISPA 3T1BA 1P92A 2O6GE 3DQVC 3IC7A 5D4RA 3KP2A 3TO6A 3QPTA 3LWFA 2A69F 3PQKA 2FQ3A 3GXOA 4BQAA 4RB0A 1HKSA 4I98B 2V1UA 4ZYGA 1QQIA 4HF0A 1REPC 2LNBA 3I64A 1KYWA 4EGZA 2RGVA 3ML6A 2QLZA 1G3TA 5ICCA 2GZWA 3M7GA 2H94A 5ICGA 3E6MA 2CO5A 2MLGA 4JQFA 2XAGA 4P5OA 3MAJA 2K4JA 1FNNA 5HDKA 2QUFA 5HDNA 1WWXA 2XHKA 4XRFA 3K69A 3KZZA 2HEOA 3FHZA 2PN6A 2CYYA 3QP6A 1K79A 5BPIA 2MD5A 5D5UB 3GFLA 1KU7A 1QPMA 4YIIA 4R1HA 2O03A 2ESHA 2G7UA 2OQRA 2NS0A 4FHTA 2XAJA 2PBIA 3HRTA 1RZ4A 2F2EA 5LGUA 2VBWA 1H9TA 1P4WA 1Z7UA 4B8XA 5A2QK 1B4AA 2E1NA 4I2OA 1P4AA 4UNOA 1FC3A 1IW7F 5E8GA 1OPCA 4JK1X 4A2UA 4MQ9F 4Q4ZF 5LLQA 2P5KA 1KGSA 1U6GA 2Q2EA 3JW4A 1U5TC 2W84A 2EA4A 2HQNA 4HQMA 4UXNA 3FM5A 1GHCA 3V8LA 4A0XA 3WTWC 2V6CA 4KIGA 1HXDA 3G3ZA 4L9JA 2OBPA 3E3VA 3GFIA 4KYWA 2CFXA 5HLIA 1HSJA 5L3CA 1JHHA 1G4DA 2A5YB 1FY7A 1IXRC 3M8FA 4EJTA 1XDSA 4M6XA 5LEJA 1WI9A 4F7ZA 2EFQA 3VEPA 4UV9A 3GUDA 2ELHA 1ON1A 1FSEA 2YPRA 4EVIA 1D8JA 1Z05A 5D6FA 1I1SA 2EFPA 4KDPA 3GF2A 4NHJA 1U8RA 2Q8KA 2DU9A 2D2WA 1I27A 5EEGA 2BGCA 4HX4A 1R7JA 3WG9A 1SD5A 5E8IA 5LRSA 4M73A 4P9UA 3ZP5A 1FZPB 1S29A 2ISYA 2XASA 3CUQC 5HS9A 3NEUA 3V7SA 2Z9OA 1HKQA 2QQ9A 1W5TA 1W7PA 3TKYA 4WCGA 4HV6A 4KMFA 1KQ0A 1W4MA 4RGXA 4U7DA 3KP5A 2VOOA 5A2QZ 1OYWA 1DP7P 3W6KB 3L2CA 3WU1B 1ZGJA 4O6JA 5HS8A 3ECHA 5H20A 2Z3YA 2HFHA 1SFUA 4E70A 4ENJA 4Y13A 3B02A 1ZG5A 2RVCA 4CICA 4JBAA 4RS8A 4KA4A 1ZRCA 1ZAOA 1DDNA 2DT5A 3EDPA 1R1VA 3W6JB 3GWZA 2A6EF 1DPRA 1KU2A 3JTHA 2RN7A 5E1XA 4WK8F 3WTUC 2NRAC 3BDDA 3GFMA 4UVBA 2P7VB 4A5MA 5EEHA 1G3YA 1R58A 5D5WB 1NHAA 3SZPA 1L3LA 1FX7A 5HLHA 1H0MA 1R22A 4BXUA 2HKOA 4ZZLA 4M9SA 3BZ6A 2Q0OA 3RPQA 2WC2A 3GX4X 1SAXA 1FP1D 3VOEA 3K9TA 2GIVA 4QLCU 5DYMA 3C3WA 4AD9A 4HF2A 3R0JA 1ULYA 2GQQA 4IHTA 1IZ1A 3E5QA 5CVJA 3RJPA 3R61A 4XSZF 5CVIA 4KICA 3HHGA 1F5TA 2BE5F 5F64A 2LF7A 4ZZDA 2EJRA 3SZTA 2NAZA 4WF2A 5HLGA 2HQRA 5KK1A 3FMRA 3ZMTA 3WGGA 1WSUA 3ZMVA 5JHUA 1V3FA 3R4KA 5K1YA 1T39A 2FBKA 2CG4A 3KEOA 3HUGA 1Z6RA 1KU9A 4AIJA 5ED4A 2FOKA 4H0EA 2ZNZA 4L0ZB 4P9FA 4BHBA 1LNWA 1YS6A 3DXJF 3HRSA 4U0WA 3MZHA 3KETA 1QO0D 3T0YA 4K2EA 3R60A 4I0AA 1LDDA 3F72A 3VB2A 5DCFA 3HTSB 3KP4A 1UFMA 2STWA 2FXAA 3GVAA 4N0BA 5LHIA 4L5IA 2PFBA 5F6FA 1I6XA 3DP7A 4EV0A 4GCVA 1O7LA 5JI6A 4M72A 1MD0A 2PI0A 4HLYA 2YR2A 2QBYB 4EQQA 5E17F 1W7PB 5L3FA 2HGCA 3RIRA 2ZKZA 1B59A 4LK0F 4O5VA 4RAYA 1A04A 2H6BA 2EFWA 5IT9K 5JR3A 2Y75A 1FYLA 1GXPA 2UZKA 2FA5A 4L9NA 2G9WA 3U9GA 1TBXA 1UHWA 4OIPF 5ICFA 3HSRA 2PMHA 2QQAA 1V4RA 3DPLC 2DO7A 1J7KA 2DK5A 3LQQA 1MKMA 2X0LA 4ON0A 4YFKF 2XKPA 1TNTA 4GGGA 1BIAA 2VC1A 2RDPA 3E6CC 3SHFA 2VXZA 1RI7A 5D8LB 3DEUA 3HOTA 2DW4A 2MBFA 3BPVA 3NQOA 4U0VA 3CTAA 4KN7X 3ULQB 5ILSA 2UXXA 3B73A 3KLOA 5KVRA 3MFKA 4EM0B 1J5YA 2YX7A 4WXCA 1KA8A 3RKYA 1BI0A 1BI3A 1Z1DA 5TJJA 1D3YA 2RNJA 3S2WA 2H27A 1LB2A 2ZNYA 4A0YA 3LA3A 3JTGA 3WE2A 2KIMA 1J9IA 4XSXF 1XN7A 1YIOA 1ZYRF 2MH2A 1HBXG 1TQIA 4G7OF 1AOYA 1U78A 1YQAA 2FNAA 2JZYA 2E7WA 2KIFA 2CQKA 3E6BA 1S3JA 1FYMA 4EJOA 2EWNA 3MQ0A 3GLXA 3Q5FA 2JSCA 2FNPA 4IPAA 3L9FA 5DD8A 3GO5A 2LF8A 1B9MA 3WTVC 3WTZA 2ETHA 2LSOA 1I5ZA 1QBJA 4BHPA 1HKTA 4HZFA 1YTYA 3FXRA 4HV5A 3PFIA 2L02A 4G6QA 5LHHA 3IKVA 2F5FA 3F22A 4I02A 3V7CA 1OYIA 3T8RA 4KNYA 1P4XA 4WX9A 5IT9Z 5JFRA 5CVRA 1USSA 3QU3A 2M30A 4ESBA 3RTRA 4YFXF 2EFNA 5CJ9A 1MGTA 1BIBA 3KCCA 2V1DA 1DPUA 3GW2A 1XCBA 3FX3A 1PDNC 4G7ZF 3SFZA 2DBBA 3J81K 4RGSA 5AONA 4LG0A 4OU0A 2IJLA 3FXQA 2LDUA 2DLLA 4XLNF 3JSPA 4IRIA 1TTYA 1F4KA 4PDKA 2BEOA 3LSTA 4CYDA 3RI4A 2QM3A 3RPUA 2B0LA 3O3KA 1MDMA 2GXGA 2NNYA 2IA2A 4L5JA 4GO1A 3QAHA 4FT8A 3GYHX 2HTJA 3ERED 2YSRA 1QGPA 3KLNA 5L3BA 1BI1A 4GXOA 3F23A 1IUYA 2F5CA 4A0ZA 4I01A 4WWCA 3LQRA 2VBZA 3BJAA 2H09A 4RB1A 2W24A 1X3UA 2OA4A 4BH9A 2EFOA 4WXDA 1OR7A 2RQPA 2HTSA 4S04A 4ZYEA 2PMUA 1TQPA 5CVUA 2XV4S 5FLXK 2XVCA 5HS7A 1SMTA 4AIKA 5FD6A 3EYYA 4OOIA 4GYIA 4ENKA 5DD4A 3BPXA 4ZYDA 1O3QA 4MNUA 3DFGA 3WODF 3QOPA 1XDUA 4LK1F 4U88A 3MZYA 2ZJ2A 2WV0A 3E6DA 2JTVA 2PJPA 1HSTA 1USTA 1IN6A 4L18B 3H92A 1HW5A 1T98A 1T6SA 3R0AA 3FM3A 2KKOA 3EETA 3TO7A 3J81Z 3GZ5A 3SQNA 3KFWX 1JE8A 1J75A 1WRJA 2OZUA 2RKHA 5ICEA 1UB9A 4ENNA