2N3HA

Solution structure of drb4 dsrbd2 (viz. drb4(81-151))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-binding protein 4
publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3hA00
2B7VA 4GKKE 4K0KE 2LUPB 1I94E 2YT4A 1YYKA 3VYXA 4M2ZA 2L2NA 2RTXA 1N33E 4AQYE 1X49A 2N3HA 4DV0E 2HHHE 4KHPE 2VQEE 4DUZE 1QU6A 4NXNE 4DV3E 1XMOE 2UUCE 2KHXA 1DI2A 2LTRA 3HTXA 1XMQE 4DKKA 2UXDE 2L3CA 4JV5E 4YHHE 4LFCE 4X65E 2JVAA 1YYOA 1RC7A 4JI4E 2DB2A 1EKZA 1FKAE 2UXBE 2N3GA 3ADGA 3T1YE 1O0WA 1X48A 1HR0E 1J5EE 3ADLA 5CFFE 4NXME 4JI5E 4M30A 1HNWE 2DIXA 4X8WA 4X66E 2EZ6A 1IBLE 4DR1E 2L2MA 1T4NA 3C4BA 5IWAE 2B3TB 2L2KB 1HNXE 1IBKE 3VYYA 2NUEA 2VQFE 2DMYA 3P1XA 4DUYE 1YYWA 4OOGC 2RS6A 3OTOE 4B3TE 3ADJA 1XNQE 4B3RE 4JI6E 4DV5E 2LJHA 4JI1E 1RQ0A 1UILA 4LF7E 4OX9E 2NA2A 2B7TA 4JI3E 3J7Yp 4GKJE 1T4OA 4DV6E 2LTSA 4DV1E 3T1HE 2NUFA 2RS7A 2LBSB 2L33A 5LMNE 2L3JA 1IBME 1FJGE 4DV7E 4WYQB 2UUBE 1YZ9A 2MDRA 1HNZE 4JI0E 4JI7E 1XNRE 4JI8E 1X47A 1N34E 2UUAE 4LFBE 4JI2E 2UXCE 4DV2E 2CPNA 4JYAE 2F4VE 4DR3E 4LF9E 4LF8E 1STUA 1ZBTA 4YY3E 1N32E 4B3SE 4X64E 2NUGA 1UHZA 4WFTA 1WHQA 1GQEA 2E5LE 4B3ME 1PKPA 5LMUE 4LFAE 3ADIA 1J26A 5BR8E 2LRSA 4X62E 1T4LB 4DR7E 1WHNA 4DR6E 2IHR1 2LUQA 4DV4E 4DR4E 4LF4E 4LF5E 4DR2E 4DR5E 2RSMA 2ZM6E 3C4TA 1N36E 2UU9E 3LLHA 2JY9A 4LF6E
chains in the Genus database with same CATH superfamily
4P7DA 2R1FA 2YT4A 1JK2A 3K6QA 1YSAC 2EN1A 2CTDA 1X49A 1ZAAC 2HHHE 2EOYA 1DQ3A 2GHFA 1QNTA 4DV3E 2UUCE 2LMZA 1T38A 2LTRA 3HTXA 2E1MA 4NHRA 3THOB 4M0VA 2L3CA 2JP9A 4LFCE 4X65E 4ZYDA 3BIDA 1YYOA 1RC7A 2ENAA 2EMGA 3JU0A 4JI4E 1EKZA 2EOHA 2MC6A 2FTXB 4HEIA 1X6FA 1AAYA 1SR9A 2HJJA 2DLKA 2KONA 5DNYA 2BB8A 1IQOA 4DMIA 2EM0A 1HNWE 2DIXA 4X8WA 2M1SA 4DR1E 2MKDA 1T4NA 2EOZA 3C4BA 2EPOA 1PJQA 1YPNA 2EN8A 2EOJA 2V88A 2EMIA 1HNXE 2MKNA 1IBKE 2RQLA 3VYYA 2VQFE 2EP3A 1A1JA 4B3RE 1MEYC 2LT7A 2I13A 2YTPA 2WZOA 2EM3A 4RHBB 2EPAA 3HXLA 1N3GA 2ODRD 2NUFA 2ENCA 2RS7A 2LBSB 4F6NA 2EORA 1IBME 2EM7A 4RH8A 1B69A 1KYQA 4JI7E 1XNRE 2UUAE 1ZBQA 2EOSA 2RPCA 2EPRA 2GLIA 2YTDA 2CPNA 3DJWA 4JYAE 4DR3E 2EN3A 4LF8E 2EL4A 2JWOA 2I9IA 1N32E 1EH6A 4B3SE 4X64E 1JK1A 2M9AA 1J26A 1RMDA 5IXMB 4GZNC 4HTGA 2IHR1 2JYAA 3THNA 4ZYHA 4R8OA 2JPAA 2FGGA 1A1LA 2ODRC 1NEIA 3LMLA 4LF6E 2B7VA 2EMBA 2LVHA 1I94E 2EM2A 1ZR9A 2RTXA 3EPKA 2EN7A 2WBTA 4DV0E 1WJPA 4KHPE 2V85A 2VQEE 2EMLA 2YSPA 1DI2A 1A1GA 3H09A 3MSWA 4ZYGA 1IQSA 4DKKA 2UXDE 1YUIA 4BC7A 2EPZA 4YHHE 2CSHA 2JVAA 2EM8A 2L8TA 4KWYA 3HPSA 1O0WA 2EN6A 5A6AA 3J80C 5A6BA 3DF6A 1J5EE 2EMZA 2FV4B 4JI5E 2B9DA 1X3CA 1IMUA 2LV2A 2EPNA 2MDGA 4X66E 5A2QC 2B3TB 3MHSC 1T39A 4X9JA 1DGCA 2EPKX 2EM4A 2YU5A 2NUEA 5AC4A 3P1XA 3FIGA 1WXRA 4DUYE 4OOGC 4F6MA 2YTJA 4JI6E 2K4VA 2MC5A 1UILA 5ADZA 3M99B 4GEQB 2EOIA 3C6MA 4J8ZA 4GKJE 4FK5C 2YSOA 1GZ6A 2WBUA 4O24A 2YTFA 3T1HE 4ZYEA 3KZZA 3IWDA 1X6HA 2L33A 5LMNE 2EMWA 2L3JA 2ADRA 2M7QA 2CT1A 4DV7E 1MGTA 2MDRA 5AE2A 2ENHA 1TN9A 4JI0E 5KL4A 2JXPA 1N34E 1X47A 4LFBE 3IWCA 4JI2E 3BF2A 2EPMX 5AC5A 4MLQA 4R2SA 1STUA 5T6JA 2EM5A 2NUGA 5FLXC 1EH8A 2E5LE 5LMUE 4LFAE 3ADIA 2HC5A 2LRSA 4O5GA 4WSGA 4BHCA 5LL6R 3AUZA 2LUQA 4DV4E 2EMYA 2YU8A 4DR2E 2ELYA 2EPCA 4L5NC 2WBSA 4NZVA 4F9CB 4DR5E 2GPIA 1N36E 1LLMC 2JY9A 4WXCA 2D9HA 2EOQA 4P78A 4GKKE 4K0KE 2LUPB 3EPHA 1YYKA 3VYXA 1UN6B 2V89A 3MHHC 5A6JA 1G2FC 2K7IA 4AQYE 2VF1A 2RSIA 4NXNE 3C6KA 2EOEA 3F6GA 2KHXA 2HGHA 2NABA 1BBGA 4N4RB 4JV5E 2DSYA 2EOFA 3VK6A 2EPUA 2DB2A 2EN2A 4F54A 3RMPA 1FKAE 2UXBE 2ELZA 2WCC3 2EJ4A 3T1YE 1X48A 2JR1A 2G7HA 5CFFE 3KWRA 2BBGA 3F6HA 3L00A 5A6BD 4I8OA 4TUGA 5KL5A 3AV0A 2EE8A 2JOBA 1L4SA 1Z1BA 4F2JC 2V8QB 3ADJA 1XNQE 4JI1E 2LJHA 3HQ1A 4BHBA 1G2DC 3J7Yp 2EMXA 4WSPA 1AH5A 5A6KA 4WX9A 1KJKA 4IJDA 2LTSA 4O4KA 4DV1E 2YRMA 4WXDA 2EM9A 4Q28A 2EPPA 2JOXA 2YTQA 3EPJA 2DRPA 3J81C 2DLQA 4KZSA 4JI8E 1A1FA 2UXCE 3ECRA 3UK3C 2EQ0A 2YTEA 2LJUA 4YY3E 3ZOQB 2V86A 1BB8A 2KOUA 2EMHA 1UHZA 4R2PA 2LE2A 2YTGA 2YPNA 1TF3A 4B3ME 5KL3A 2EM6A 3HPZA 2EOMA 5BR8E 2LO3A 1WHNA 3VHTB 1YUJA 5AE1A 4R2CA 2YZTA 4DR6E 3J7AG 4TUIA 4LF5E 1F2IG 4F9BB 2E72A 2EMCA 4M9VC 4R2QA 2RSMA 2ZM6E 2R76A 3C4TA 2YRKA 1PJSA 2M4IA 3EPLA 2Q8UA 3LLHA 3TQMA 2J7JA 2EOOA 3BBGA 2EL5A 2A25A 3IWBA 4R2AA 4M2ZA 2L2NA 2EWLA 1N33E 1PDAA 2N8XA 2N3HA 3BGHA 4WPYA 4DUZE 1QU6A 3KZYA 1XMOE 1ZU1A 2EOXA 2EQ1A 3EQ1A 4R2DA 4Q35B 1GTKA 1XMQE 4R2EA 1WRJA 2PRTA 2N3GA 1A1KA 3ADGA 1UBDC 2LCEA 1HR0E 3ADLA 2EMAA 4NXME 2EMFA 4M30A 2DGCA 2DMIA 4MLVA 2L92A 4F9AB 1P47A 2EZ6A 2EL6A 1IBLE 2L2MA 2YTOA 4IS1C 2YTIA 3JAMC 5IWAE 2L2KB 2V87A 4L8NA 1X5WA 4R2RA 5AASA 2VE7C 2DMYA 5KL6A 1YYWA 2RS6A 3OTOE 4B3TE 5TSEA 1PJTA 4DV5E 4OX9E 5F3WA 1RQ0A 3QG5C 4LF7E 2NA2A 2B7TA 4JI3E 1T4OA 2EN4A 4DV6E 5AE3A 2F8BA 3OMLA 2YTNA 2YRHA 2L6MA 5KL7A 1FJGE 2UUBE 1EH7A 4WYQB 4R03A 1YZ9A 4LU9A 1HNZE 1A1IA 3JTZA 1NCSA 4DV2E 2YWQA 5IV8B 5IT9C 4BC9A 4LF9E 2F4VE 5KL2A 1ZBTA 4BS9A 2EQ3A 4O43A 4WFTA 1WHQA 1GQEA 2V83A 1TF6A 1PKPA 1SFEA 4BBYA 4X62E 4LTYA 1T4LB 5LLQA 2EPLX 5A69A 4DR7E 1BBOA 1A1HA 2EMKA 4BCAA 1X6EA 4DR4E 4LF4E 2VRDA 4BMJA 2UU9E 2EPXA 2H36X 1YFHA
chains in the Genus database with same CATH topology
2B7VA 4P7DA 4P78A 3IWBA 4K0KE 2LUPB 1I94E 2YT4A 4GKKE 1YYKA 3VYXA 2V89A 3K6QA 4M2ZA 2L2NA 2RTXA 2EWLA 1N33E 4AQYE 1X49A 2N3HA 4WPYA 4DV0E 2VF1A 2HHHE 2V85A 2VQEE 4KHPE 1DQ3A 4DUZE 1QU6A 4NXNE 4DV3E 1XMOE 2UUCE 2LMZA 3F6GA 2KHXA 1DI2A 3H09A 3MSWA 2LTRA 3HTXA 2E1MA 1XMQE 4M0VA 4DKKA 2UXDE 2L3CA 4JV5E 4BC7A 2DSYA 4YHHE 4LFCE 4X65E 3VK6A 2JVAA 1YYOA 2L8TA 1RC7A 4JI4E 2DB2A 3JU0A 4F54A 1EKZA 3RMPA 1FKAE 2MC6A 2FTXB 2N3GA 2UXBE 3HPSA 3ADGA 3T1YE 1O0WA 1SR9A 1X48A 2JR1A 2KONA 3J80C 5DNYA 3DF6A 2G7HA 1J5EE 1HR0E 5CFFE 2FV4B 4JI5E 2B9DA 4NXME 3ADLA 4M30A 4DMIA 2L92A 1HNWE 4F9AB 2DIXA 3KWRA 4X8WA 4X66E 2M1SA 4DR1E 1IBLE 2L2MA 2EZ6A 1T4NA 3C4BA 2JY9A 5A2QC 3JAMC 3F6HA 5IWAE 4I8OA 2B3TB 2L2KB 2V87A 4L8NA 4TUGA 2V88A 1HNXE 5AASA 3AV0A 1IBKE 2VE7C 3VYYA 2NUEA 2VQFE 2JOBA 2DMYA 3P1XA 3FIGA 1WXRA 4DUYE 1YYWA 4OOGC 2RS6A 3OTOE 2V8QB 4B3TE 3ADJA 1XNQE 4B3RE 4JI6E 2K4VA 2LJHA 4DV5E 1RQ0A 1UILA 2MC5A 5ADZA 5F3WA 4JI1E 4LF7E 4GEQB 2NA2A 2B7TA 3HQ1A 4JI3E 3J7Yp 4GKJE 4J8ZA 1T4OA 4WSPA 1GZ6A 2WZOA 4DV6E 5AE3A 2F8BA 3OMLA 3HXLA 2LTSA 4DV1E 2ODRD 2L6MA 3T1HE 2NUFA 2RS7A 2LBSB 3IWDA 4OX9E 2L33A 4Q28A 5LMNE 2L3JA 1IBME 1FJGE 2M7QA 4WYQB 4DV7E 2UUBE 4R03A 1YZ9A 2JOXA 2MDRA 4LU9A 5AE2A 1HNZE 4JI7E 4JI0E 1XNRE 3J81C 3JTZA 4KZSA 1X47A 4JI8E 1ZBQA 1N34E 2UUAE 3IWCA 4JI2E 4LFBE 2UXCE 4DV2E 2CPNA 3DJWA 5IT9C 4BC9A 4DR3E 4LF9E 4LF8E 2JWOA 2F4VE 4JYAE 1STUA 1ZBTA 3ZOQB 2V86A 4YY3E 4BS9A 5T6JA 1N32E 2KOUA 4B3SE 4X64E 2NUGA 5FLXC 1UHZA 2LE2A 4WFTA 1WHQA 1GQEA 2V83A 2E5LE 4B3ME 1PKPA 5LMUE 3HPZA 4BBYA 4LFAE 3ADIA 5BR8E 2LRSA 4LTYA 4X62E 1T4LB 1J26A 4DR7E 1WHNA 5LL6R 5AE1A 4DR6E 2YZTA 3J7AG 2IHR1 3AUZA 4TUIA 4BCAA 2LUQA 4DV4E 4DR4E 4LF4E 4LF5E 4R8OA 4DR2E 4L5NC 4F9BB 4F9CB 4DR5E 2RSMA 4BMJA 2ZM6E 2FGGA 3C4TA 1N36E 2M4IA 2ODRC 2UU9E 3LLHA 2H36X 3LMLA 4LF6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7V A;  4GKK E;  4K0K E;  2LUP B;  1I94 E;  2YT4 A;  1YYK A;  3VYX A;  4M2Z A;  2L2N A;  2RTX A;  1N33 E;  4AQY E;  1X49 A;  2N3H A;  4DV0 E;  2HHH E;  4KHP E;  2VQE E;  4DUZ E;  1QU6 A;  4NXN E;  4DV3 E;  1XMO E;  2UUC E;  2KHX A;  1DI2 A;  2LTR A;  3HTX A;  1XMQ E;  4DKK A;  2UXD E;  2L3C A;  4JV5 E;  4YHH E;  4LFC E;  4X65 E;  2JVA A;  1YYO A;  1RC7 A;  4JI4 E;  2DB2 A;  1EKZ A;  1FKA E;  2UXB E;  2N3G A;  3ADG A;  3T1Y E;  1O0W A;  1X48 A;  1HR0 E;  1J5E E;  3ADL A;  5CFF E;  4NXM E;  4JI5 E;  4M30 A;  1HNW E;  2DIX A;  4X8W A;  4X66 E;  2EZ6 A;  1IBL E;  4DR1 E;  2L2M A;  1T4N A;  3C4B A;  5IWA E;  2B3T B;  2L2K B;  1HNX E;  1IBK E;  3VYY A;  2NUE A;  2VQF E;  2DMY A;  3P1X A;  4DUY E;  1YYW A;  4OOG C;  2RS6 A;  3OTO E;  4B3T E;  3ADJ A;  1XNQ E;  4B3R E;  4JI6 E;  4DV5 E;  2LJH A;  4JI1 E;  1RQ0 A;  1UIL A;  4LF7 E;  4OX9 E;  2NA2 A;  2B7T A;  4JI3 E;  3J7Y p;  4GKJ E;  1T4O A;  4DV6 E;  2LTS A;  4DV1 E;  3T1H E;  2NUF A;  2RS7 A;  2LBS B;  2L33 A;  5LMN E;  2L3J A;  1IBM E;  1FJG E;  4DV7 E;  4WYQ B;  2UUB E;  1YZ9 A;  2MDR A;  1HNZ E;  4JI0 E;  4JI7 E;  1XNR E;  4JI8 E;  1X47 A;  1N34 E;  2UUA E;  4LFB E;  4JI2 E;  2UXC E;  4DV2 E;  2CPN A;  4JYA E;  2F4V E;  4DR3 E;  4LF9 E;  4LF8 E;  1STU A;  1ZBT A;  4YY3 E;  1N32 E;  4B3S E;  4X64 E;  2NUG A;  1UHZ A;  4WFT A;  1WHQ A;  1GQE A;  2E5L E;  4B3M E;  1PKP A;  5LMU E;  4LFA E;  3ADI A;  1J26 A;  5BR8 E;  2LRS A;  4X62 E;  1T4L B;  4DR7 E;  1WHN A;  4DR6 E;  2IHR 1;  2LUQ A;  4DV4 E;  4DR4 E;  4LF4 E;  4LF5 E;  4DR2 E;  4DR5 E;  2RSM A;  2ZM6 E;  3C4T A;  1N36 E;  2UU9 E;  3LLH A;  2JY9 A;  4LF6 E; 
#chains in the Genus database with same CATH topology
 4P7D A;  2R1F A;  2YT4 A;  1JK2 A;  3K6Q A;  1YSA C;  2EN1 A;  2CTD A;  1X49 A;  1ZAA C;  2HHH E;  2EOY A;  1DQ3 A;  2GHF A;  1QNT A;  4DV3 E;  2UUC E;  2LMZ A;  1T38 A;  2LTR A;  3HTX A;  2E1M A;  4NHR A;  3THO B;  4M0V A;  2L3C A;  2JP9 A;  4LFC E;  4X65 E;  4ZYD A;  3BID A;  1YYO A;  1RC7 A;  2ENA A;  2EMG A;  3JU0 A;  4JI4 E;  1EKZ A;  2EOH A;  2MC6 A;  2FTX B;  4HEI A;  1X6F A;  1AAY A;  1SR9 A;  2HJJ A;  2DLK A;  2KON A;  5DNY A;  2BB8 A;  1IQO A;  4DMI A;  2EM0 A;  1HNW E;  2DIX A;  4X8W A;  2M1S A;  4DR1 E;  2MKD A;  1T4N A;  2EOZ A;  3C4B A;  2EPO A;  1PJQ A;  1YPN A;  2EN8 A;  2EOJ A;  2V88 A;  2EMI A;  1HNX E;  2MKN A;  1IBK E;  2RQL A;  3VYY A;  2VQF E;  2EP3 A;  1A1J A;  4B3R E;  1MEY C;  2LT7 A;  2I13 A;  2YTP A;  2WZO A;  2EM3 A;  4RHB B;  2EPA A;  3HXL A;  1N3G A;  2ODR D;  2NUF A;  2ENC A;  2RS7 A;  2LBS B;  4F6N A;  2EOR A;  1IBM E;  2EM7 A;  4RH8 A;  1B69 A;  1KYQ A;  4JI7 E;  1XNR E;  2UUA E;  1ZBQ A;  2EOS A;  2RPC A;  2EPR A;  2GLI A;  2YTD A;  2CPN A;  3DJW A;  4JYA E;  4DR3 E;  2EN3 A;  4LF8 E;  2EL4 A;  2JWO A;  2I9I A;  1N32 E;  1EH6 A;  4B3S E;  4X64 E;  1JK1 A;  2M9A A;  1J26 A;  1RMD A;  5IXM B;  4GZN C;  4HTG A;  2IHR 1;  2JYA A;  3THN A;  4ZYH A;  4R8O A;  2JPA A;  2FGG A;  1A1L A;  2ODR C;  1NEI A;  3LML A;  4LF6 E;  2B7V A;  2EMB A;  2LVH A;  1I94 E;  2EM2 A;  1ZR9 A;  2RTX A;  3EPK A;  2EN7 A;  2WBT A;  4DV0 E;  1WJP A;  4KHP E;  2V85 A;  2VQE E;  2EML A;  2YSP A;  1DI2 A;  1A1G A;  3H09 A;  3MSW A;  4ZYG A;  1IQS A;  4DKK A;  2UXD E;  1YUI A;  4BC7 A;  2EPZ A;  4YHH E;  2CSH A;  2JVA A;  2EM8 A;  2L8T A;  4KWY A;  3HPS A;  1O0W A;  2EN6 A;  5A6A A;  3J80 C;  5A6B A;  3DF6 A;  1J5E E;  2EMZ A;  2FV4 B;  4JI5 E;  2B9D A;  1X3C A;  1IMU A;  2LV2 A;  2EPN A;  2MDG A;  4X66 E;  5A2Q C;  2B3T B;  3MHS C;  1T39 A;  4X9J A;  1DGC A;  2EPK X;  2EM4 A;  2YU5 A;  2NUE A;  5AC4 A;  3P1X A;  3FIG A;  1WXR A;  4DUY E;  4OOG C;  4F6M A;  2YTJ A;  4JI6 E;  2K4V A;  2MC5 A;  1UIL A;  5ADZ A;  3M99 B;  4GEQ B;  2EOI A;  3C6M A;  4J8Z A;  4GKJ E;  4FK5 C;  2YSO A;  1GZ6 A;  2WBU A;  4O24 A;  2YTF A;  3T1H E;  4ZYE A;  3KZZ A;  3IWD A;  1X6H A;  2L33 A;  5LMN E;  2EMW A;  2L3J A;  2ADR A;  2M7Q A;  2CT1 A;  4DV7 E;  1MGT A;  2MDR A;  5AE2 A;  2ENH A;  1TN9 A;  4JI0 E;  5KL4 A;  2JXP A;  1N34 E;  1X47 A;  4LFB E;  3IWC A;  4JI2 E;  3BF2 A;  2EPM X;  5AC5 A;  4MLQ A;  4R2S A;  1STU A;  5T6J A;  2EM5 A;  2NUG A;  5FLX C;  1EH8 A;  2E5L E;  5LMU E;  4LFA E;  3ADI A;  2HC5 A;  2LRS A;  4O5G A;  4WSG A;  4BHC A;  5LL6 R;  3AUZ A;  2LUQ A;  4DV4 E;  2EMY A;  2YU8 A;  4DR2 E;  2ELY A;  2EPC A;  4L5N C;  2WBS A;  4NZV A;  4F9C B;  4DR5 E;  2GPI A;  1N36 E;  1LLM C;  2JY9 A;  4WXC A;  2D9H A;  2EOQ A;  4P78 A;  4GKK E;  4K0K E;  2LUP B;  3EPH A;  1YYK A;  3VYX A;  1UN6 B;  2V89 A;  3MHH C;  5A6J A;  1G2F C;  2K7I A;  4AQY E;  2VF1 A;  2RSI A;  4NXN E;  3C6K A;  2EOE A;  3F6G A;  2KHX A;  2HGH A;  2NAB A;  1BBG A;  4N4R B;  4JV5 E;  2DSY A;  2EOF A;  3VK6 A;  2EPU A;  2DB2 A;  2EN2 A;  4F54 A;  3RMP A;  1FKA E;  2UXB E;  2ELZ A;  2WCC 3;  2EJ4 A;  3T1Y E;  1X48 A;  2JR1 A;  2G7H A;  5CFF E;  3KWR A;  2BBG A;  3F6H A;  3L00 A;  5A6B D;  4I8O A;  4TUG A;  5KL5 A;  3AV0 A;  2EE8 A;  2JOB A;  1L4S A;  1Z1B A;  4F2J C;  2V8Q B;  3ADJ A;  1XNQ E;  4JI1 E;  2LJH A;  3HQ1 A;  4BHB A;  1G2D C;  3J7Y p;  2EMX A;  4WSP A;  1AH5 A;  5A6K A;  4WX9 A;  1KJK A;  4IJD A;  2LTS A;  4O4K A;  4DV1 E;  2YRM A;  4WXD A;  2EM9 A;  4Q28 A;  2EPP A;  2JOX A;  2YTQ A;  3EPJ A;  2DRP A;  3J81 C;  2DLQ A;  4KZS A;  4JI8 E;  1A1F A;  2UXC E;  3ECR A;  3UK3 C;  2EQ0 A;  2YTE A;  2LJU A;  4YY3 E;  3ZOQ B;  2V86 A;  1BB8 A;  2KOU A;  2EMH A;  1UHZ A;  4R2P A;  2LE2 A;  2YTG A;  2YPN A;  1TF3 A;  4B3M E;  5KL3 A;  2EM6 A;  3HPZ A;  2EOM A;  5BR8 E;  2LO3 A;  1WHN A;  3VHT B;  1YUJ A;  5AE1 A;  4R2C A;  2YZT A;  4DR6 E;  3J7A G;  4TUI A;  4LF5 E;  1F2I G;  4F9B B;  2E72 A;  2EMC A;  4M9V C;  4R2Q A;  2RSM A;  2ZM6 E;  2R76 A;  3C4T A;  2YRK A;  1PJS A;  2M4I A;  3EPL A;  2Q8U A;  3LLH A;  3TQM A;  2J7J A;  2EOO A;  3BBG A;  2EL5 A;  2A25 A;  3IWB A;  4R2A A;  4M2Z A;  2L2N A;  2EWL A;  1N33 E;  1PDA A;  2N8X A;  2N3H A;  3BGH A;  4WPY A;  4DUZ E;  1QU6 A;  3KZY A;  1XMO E;  1ZU1 A;  2EOX A;  2EQ1 A;  3EQ1 A;  4R2D A;  4Q35 B;  1GTK A;  1XMQ E;  4R2E A;  1WRJ A;  2PRT A;  2N3G A;  1A1K A;  3ADG A;  1UBD C;  2LCE A;  1HR0 E;  3ADL A;  2EMA A;  4NXM E;  2EMF A;  4M30 A;  2DGC A;  2DMI A;  4MLV A;  2L92 A;  4F9A B;  1P47 A;  2EZ6 A;  2EL6 A;  1IBL E;  2L2M A;  2YTO A;  4IS1 C;  2YTI A;  3JAM C;  5IWA E;  2L2K B;  2V87 A;  4L8N A;  1X5W A;  4R2R A;  5AAS A;  2VE7 C;  2DMY A;  5KL6 A;  1YYW A;  2RS6 A;  3OTO E;  4B3T E;  5TSE A;  1PJT A;  4DV5 E;  4OX9 E;  5F3W A;  1RQ0 A;  3QG5 C;  4LF7 E;  2NA2 A;  2B7T A;  4JI3 E;  1T4O A;  2EN4 A;  4DV6 E;  5AE3 A;  2F8B A;  3OML A;  2YTN A;  2YRH A;  2L6M A;  5KL7 A;  1FJG E;  2UUB E;  1EH7 A;  4WYQ B;  4R03 A;  1YZ9 A;  4LU9 A;  1HNZ E;  1A1I A;  3JTZ A;  1NCS A;  4DV2 E;  2YWQ A;  5IV8 B;  5IT9 C;  4BC9 A;  4LF9 E;  2F4V E;  5KL2 A;  1ZBT A;  4BS9 A;  2EQ3 A;  4O43 A;  4WFT A;  1WHQ A;  1GQE A;  2V83 A;  1TF6 A;  1PKP A;  1SFE A;  4BBY A;  4X62 E;  4LTY A;  1T4L B;  5LLQ A;  2EPL X;  5A69 A;  4DR7 E;  1BBO A;  1A1H A;  2EMK A;  4BCA A;  1X6E A;  4DR4 E;  4LF4 E;  2VRD A;  4BMJ A;  2UU9 E;  2EPX A;  2H36 X;  1YFH A; 
#chains in the Genus database with same CATH homology
 2B7V A;  4P7D A;  4P78 A;  3IWB A;  4K0K E;  2LUP B;  1I94 E;  2YT4 A;  4GKK E;  1YYK A;  3VYX A;  2V89 A;  3K6Q A;  4M2Z A;  2L2N A;  2RTX A;  2EWL A;  1N33 E;  4AQY E;  1X49 A;  2N3H A;  4WPY A;  4DV0 E;  2VF1 A;  2HHH E;  2V85 A;  2VQE E;  4KHP E;  1DQ3 A;  4DUZ E;  1QU6 A;  4NXN E;  4DV3 E;  1XMO E;  2UUC E;  2LMZ A;  3F6G A;  2KHX A;  1DI2 A;  3H09 A;  3MSW A;  2LTR A;  3HTX A;  2E1M A;  1XMQ E;  4M0V A;  4DKK A;  2UXD E;  2L3C A;  4JV5 E;  4BC7 A;  2DSY A;  4YHH E;  4LFC E;  4X65 E;  3VK6 A;  2JVA A;  1YYO A;  2L8T A;  1RC7 A;  4JI4 E;  2DB2 A;  3JU0 A;  4F54 A;  1EKZ A;  3RMP A;  1FKA E;  2MC6 A;  2FTX B;  2N3G A;  2UXB E;  3HPS A;  3ADG A;  3T1Y E;  1O0W A;  1SR9 A;  1X48 A;  2JR1 A;  2KON A;  3J80 C;  5DNY A;  3DF6 A;  2G7H A;  1J5E E;  1HR0 E;  5CFF E;  2FV4 B;  4JI5 E;  2B9D A;  4NXM E;  3ADL A;  4M30 A;  4DMI A;  2L92 A;  1HNW E;  4F9A B;  2DIX A;  3KWR A;  4X8W A;  4X66 E;  2M1S A;  4DR1 E;  1IBL E;  2L2M A;  2EZ6 A;  1T4N A;  3C4B A;  2JY9 A;  5A2Q C;  3JAM C;  3F6H A;  5IWA E;  4I8O A;  2B3T B;  2L2K B;  2V87 A;  4L8N A;  4TUG A;  2V88 A;  1HNX E;  5AAS A;  3AV0 A;  1IBK E;  2VE7 C;  3VYY A;  2NUE A;  2VQF E;  2JOB A;  2DMY A;  3P1X A;  3FIG A;  1WXR A;  4DUY E;  1YYW A;  4OOG C;  2RS6 A;  3OTO E;  2V8Q B;  4B3T E;  3ADJ A;  1XNQ E;  4B3R E;  4JI6 E;  2K4V A;  2LJH A;  4DV5 E;  1RQ0 A;  1UIL A;  2MC5 A;  5ADZ A;  5F3W A;  4JI1 E;  4LF7 E;  4GEQ B;  2NA2 A;  2B7T A;  3HQ1 A;  4JI3 E;  3J7Y p;  4GKJ E;  4J8Z A;  1T4O A;  4WSP A;  1GZ6 A;  2WZO A;  4DV6 E;  5AE3 A;  2F8B A;  3OML A;  3HXL A;  2LTS A;  4DV1 E;  2ODR D;  2L6M A;  3T1H E;  2NUF A;  2RS7 A;  2LBS B;  3IWD A;  4OX9 E;  2L33 A;  4Q28 A;  5LMN E;  2L3J A;  1IBM E;  1FJG E;  2M7Q A;  4WYQ B;  4DV7 E;  2UUB E;  4R03 A;  1YZ9 A;  2JOX A;  2MDR A;  4LU9 A;  5AE2 A;  1HNZ E;  4JI7 E;  4JI0 E;  1XNR E;  3J81 C;  3JTZ A;  4KZS A;  1X47 A;  4JI8 E;  1ZBQ A;  1N34 E;  2UUA E;  3IWC A;  4JI2 E;  4LFB E;  2UXC E;  4DV2 E;  2CPN A;  3DJW A;  5IT9 C;  4BC9 A;  4DR3 E;  4LF9 E;  4LF8 E;  2JWO A;  2F4V E;  4JYA E;  1STU A;  1ZBT A;  3ZOQ B;  2V86 A;  4YY3 E;  4BS9 A;  5T6J A;  1N32 E;  2KOU A;  4B3S E;  4X64 E;  2NUG A;  5FLX C;  1UHZ A;  2LE2 A;  4WFT A;  1WHQ A;  1GQE A;  2V83 A;  2E5L E;  4B3M E;  1PKP A;  5LMU E;  3HPZ A;  4BBY A;  4LFA E;  3ADI A;  5BR8 E;  2LRS A;  4LTY A;  4X62 E;  1T4L B;  1J26 A;  4DR7 E;  1WHN A;  5LL6 R;  5AE1 A;  4DR6 E;  2YZT A;  3J7A G;  2IHR 1;  3AUZ A;  4TUI A;  4BCA A;  2LUQ A;  4DV4 E;  4DR4 E;  4LF4 E;  4LF5 E;  4R8O A;  4DR2 E;  4L5N C;  4F9B B;  4F9C B;  4DR5 E;  2RSM A;  4BMJ A;  2ZM6 E;  2FGG A;  3C4T A;  1N36 E;  2M4I A;  2ODR C;  2UU9 E;  3LLH A;  2H36 X;  3LML A;  4LF6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...