2N3HA

Solution structure of drb4 dsrbd2 (viz. drb4(81-151))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding protein 4
publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3hA00
4OOGC 4GKKE 1FKAE 2IHR1 2NUFA 2LJHA 3C4BA 2LUQA 4M30A 2UXDE 4DV5E 4WYQB 1XMOE 4DUZE 4LFAE 1J26A 1PKPA 3C4TA 2RSMA 1YZ9A 1HNWE 2NA2A 2B7TA 2VQFE 2DB2A 4B3SE 1RC7A 4JI8E 1J5EE 4DR2E 4WFTA 4B3ME 1HNZE 4JI2E 1IBLE 4GKJE 1EKZA 4X66E 4JV5E 2RS7A 1GQEA 2LBSB 2LRSA 4LF7E 1QU6A 1T4LB 4DV7E 2NUEA 2HHHE 4DV3E 3HTXA 1N36E 4LF9E 4JI3E 4DR5E 1I94E 1HNXE 2NUGA 4KHPE 1T4OA 2L2MA 2RS6A 4DV4E 2JVAA 4DV1E 1WHNA 1IBKE 4B3TE 4X65E 2UXBE 3ADGA 2L33A 4JI5E 2DIXA 1N33E 4M2ZA 4X64E 1X48A 1FJGE 2RTXA 1HR0E 2DMYA 4DV6E 4JI0E 1X47A 1XNRE 4DR6E 1XMQE 4DR7E 4JI7E 2UXCE 2ZM6E 2L3CA 1STUA 4JYAE 1DI2A 4DR1E 3ADLA 1RQ0A 1WHQA 5IWAE 2KHXA 4AQYE 3T1HE 2L2NA 4OX9E 4K0KE 4JI1E 4DV2E 2L2KB 5CFFE 2E5LE 4NXNE 1YYWA 1N34E 3LLHA 1YYKA 1ZBTA 2EZ6A 1N32E 4B3RE 3T1YE 1YYOA 2YT4A 4LF6E 3J7Yp 1X49A 4YY3E 2UUBE 2MDRA 4X8WA 1XNQE 4X62E 3OTOE 4NXME 4JI6E 4LFBE 4LF5E 2F4VE 2B7VA 2LTSA 4LFCE 4DKKA 2VQEE 2LTRA 2UUCE 2N3GA 3P1XA 4LF4E 2LUPB 2UU9E 5LMUE 4YHHE 1UHZA 2JY9A 1O0WA 2B3TB 2N3HA 1IBME 2UUAE 1UILA 3VYXA 3ADIA 5BR8E 4DR3E 3VYYA 4DV0E 5LMNE 4DUYE 1T4NA 2CPNA 2L3JA 4DR4E 3ADJA 4JI4E 4LF8E
chains in the Genus database with same CATH superfamily
2NABA 4OOGC 4ZYGA 2LE2A 2IHR1 4TUGA 2UXDE 2EMWA 4DV5E 4LFAE 2EPXA 2RSMA 4N4RB 2B7TA 4BMJA 2EM5A 4B3SE 2FGGA 2WBTA 4R8OA 1YSAC 1EH8A 2KONA 4P78A 4B3ME 2M4IA 2JOXA 4BC7A 1X6FA 3K6QA 4X9JA 5IV8B 4LF7E 2EJ4A 2HGHA 4GZNC 2LV2A 1WJPA 1GZ6A 3J80C 2YTIA 3MHSC 4GEQB 2RS6A 4F9AB 5A2QC 1IBKE 2RPCA 1WXRA 2EMGA 2FTXB 2R76A 2DIXA 5IT9C 1X48A 3F6HA 1F2IG 1A1JA 2ODRC 1HR0E 4DV6E 3HPSA 3F6GA 2YTOA 1XMQE 2A25A 2V8QB 4F54A 2PRTA 4NZVA 1G2DC 1EH7A 3ADLA 4R2DA 4R2RA 2KHXA 2EPLX 3EQ1A 5AC4A 4AQYE 3T1HE 2YTQA 3BBGA 5KL2A 2CSHA 3JTZA 3FIGA 1YYKA 1DQ3A 5KL3A 2CTDA 1NEIA 1WRJA 3EPKA 1MEYC 2UUBE 2DLQA 2V85A 4BBYA 1XNQE 4O24A 1KYQA 4NXME 2EMBA 4JI6E 2DGCA 1X6HA 1IMUA 2LTSA 3MSWA 1A1GA 4DKKA 2GLIA 2YTGA 4F2JC 5DNYA 2VRDA 2EM3A 2V86A 5F3WA 2JY9A 1BB8A 3THNA 1IBME 2ODRD 2EMLA 2EN1A 4F9CB 5LMNE 4DUYE 3JU0A 3ZOQB 2EORA 2L92A 2LO3A 3AUZA 4JI4E 5AE3A 4LF8E 1FKAE 2EMKA 2L6MA 2NUFA 4M30A 4WSPA 5T6JA 1XMOE 3C4TA 2EN6A 1YZ9A 2NA2A 1HNWE 2DB2A 4JI8E 2YRKA 1YFHA 1IQOA 2JXPA 3DJWA 2EMCA 2MC5A 2EMYA 2ADRA 2EPNA 4M0VA 2EPOA 2EM7A 1TN9A 2RS7A 1GQEA 1QU6A 4DV7E 2EOJA 2EMIA 1A1HA 4R2SA 1AAYA 1I94E 3TQMA 5KL7A 2LCEA 3L00A 1G2FC 2NUGA 1T4OA 2L2MA 2M9AA 4DV4E 4DV1E 2EQ3A 1B69A 2YWQA 3KWRA 4B3TE 2F8BA 1YPNA 2LJUA 3ADGA 2L33A 2WBUA 2YSPA 1N33E 4M2ZA 2RSIA 1XNRE 1GTKA 2GHFA 2V83A 3IWDA 2EMZA 1Z1BA 1PJQA 2L3CA 1RMDA 1DI2A 2B9DA 2GPIA 2EM8A 2EOXA 5IWAE 2YPNA 5A6BD 2H36X 1MGTA 2MKNA 5ADZA 4KZSA 2JR1A 4JI1E 5LL6R 5CFFE 4F6MA 3VK6A 2LT7A 1YYWA 1P47A 4F9BB 1ZBTA 2YU8A 4O4KA 4LF6E 4BHBA 2EN3A 4L5NC 4X62E 2EPRA 2K4VA 2EPAA 1PJTA 2V88A 2EPMX 2EOHA 1A1LA 2EMFA 2EOMA 3QG5C 3THOB 5LLQA 4LFCE 2LTRA 2UUCE 4R2QA 4LF4E 2LUPB 5LMUE 2LMZA 3EPJA 2JWOA 2VF1A 4R2AA 1L4SA 2EOZA 3VYXA 2WBSA 2G7HA 4NHRA 4M9VC 1EH6A 4DR3E 4I8OA 1BBGA 4BCAA 3BF2A 4DV0E 3RMPA 4KWYA 2EPPA 2CT1A 2L8TA 4L8NA 2CPNA 3EPHA 4ZYHA 4WSGA 2LJHA 3H09A 3C4BA 1A1KA 2EMHA 1J26A 1PKPA 1SR9A 3JAMC 4MLVA 4R03A 4WFTA 3ECRA 1HNZE 4P7DA 2DSYA 2MKDA 1EKZA 4X66E 4JV5E 4LU9A 2ENCA 1T4LB 3MHHC 2EOEA 2HHHE 4TUIA 2YTJA 1N36E 4LF9E 2YRHA 1HNXE 2EPZA 3KZYA 1T39A 1DGCA 1WHNA 4HTGA 2R1FA 4X65E 5AASA 4X64E 4DMIA 1T38A 2M1SA 2BB8A 2RTXA 1X6EA 2DMYA 3C6KA 2WCC3 2EL6A 4FK5C 2WZOA 2EN8A 3AV0A 3C6MA 3VHTB 4DR7E 2YTPA 1ZAAC 2UXCE 2EN4A 1STUA 4JYAE 2EM4A 3EPLA 4DR1E 2EOSA 1WHQA 1X3CA 4O5GA 2L2NA 4K0KE 2YTNA 2E72A 4DV2E 3HQ1A 2E5LE 1N34E 3M99B 3UK3C 2DLKA 1N32E 3BGHA 4BHCA 4B3RE 1YYOA 2YT4A 2YTDA 1X49A 4YY3E 2MDRA 2YSOA 4X8WA 4IS1C 3OTOE 1A1FA 1LLMC 2DRPA 4J8ZA 2F4VE 2JP9A 2LVHA 2EM9A 2VQEE 3HXLA 4LTYA 1X5WA 3P1XA 2JYAA 1NCSA 4YHHE 1UHZA 2YRMA 1O0WA 1ZU1A 2B3TB 2EPCA 2N3HA 1JK2A 2UUAE 1UILA 1KJKA 5BR8E 2EE8A 1PDAA 5IXMB 4RHBB 5A69A 2YTEA 2EOQA 1T4NA 2D9HA 2L3JA 2EM6A 1ZR9A 4WXCA 5A6JA 2EQ1A 2YZTA 3LMLA 4Q35B 4GKKE 2FV4B 2EL5A 4WPYA 2LUQA 4WYQB 4DUZE 2V89A 3IWBA 4MLQA 2VQFE 1RC7A 1J5EE 5AE2A 4DR2E 2EN7A 2MDGA 2Q8UA 4JI2E 1IBLE 2KOUA 4GKJE 2V87A 2N8XA 4WXDA 1JK1A 1YUJA 2JOBA 2K7IA 2I9IA 1SFEA 2LBSB 2LRSA 2NUEA 4DV3E 4F6NA 3HTXA 4JI3E 5AC5A 2EM2A 4Q28A 4DR5E 4O43A 2EMAA 2BBGA 4KHPE 2JVAA 2EQ0A 1UN6B 1A1IA 2UXBE 4BC9A 2EWLA 4RH8A 4JI5E 1BBOA 1FJGE 4R2EA 4R2PA 4ZYEA 2ENAA 4JI0E 1X47A 2EPUA 4DR6E 3OMLA 4IJDA 2YTFA 2YU5A 5KL4A 4JI7E 5KL5A 2ZM6E 3HPZA 4ZYDA 1RQ0A 2EL4A 4OX9E 1QNTA 4HEIA 5KL6A 2L2KB 4NXNE 3DF6A 3LLHA 4WX9A 2EZ6A 3T1YE 2ELYA 2ELZA 3J7Yp 3KZZA 2HC5A 5FLXC 2JPAA 2EOFA 1IQSA 2M7QA 4R2CA 2EMXA 2E1MA 2J7JA 4LF5E 4LFBE 2HJJA 2B7VA 1YUIA 5AE1A 5A6AA 2DMIA 2EPKX 3IWCA 2N3GA 2I13A 2UU9E 1PJSA 2EOYA 2EP3A 1N3GA 2VE7C 5A6BA 3ADIA 1TF3A 2MC6A 3J7AG 2ENHA 3BIDA 2EOIA 5TSEA 1AH5A 3VYYA 4BS9A 1ZBQA 3J81C 2EM0A 2EOOA 2RQLA 1UBDC 4DR4E 3ADJA 1TF6A 2EN2A 5A6KA
chains in the Genus database with same CATH topology
2YZTA 3LMLA 2LE2A 4OOGC 4GKKE 1FKAE 2IHR1 2FV4B 2L6MA 2NUFA 2LJHA 3H09A 4WPYA 3C4BA 2LUQA 4M30A 4TUGA 2UXDE 4DV5E 4WSPA 5T6JA 4WYQB 1XMOE 4DUZE 4LFAE 1J26A 1PKPA 3C4TA 2RSMA 1YZ9A 1HNWE 2NA2A 2B7TA 1SR9A 2V89A 3IWBA 2DB2A 4BMJA 2VQFE 4JI8E 3JAMC 5AE2A 1RC7A 1J5EE 2FGGA 4R8OA 4DR2E 4R03A 4WFTA 3DJWA 2KONA 4P78A 4B3ME 1HNZE 4P7DA 1IBLE 2KOUA 2M4IA 4JI2E 2DSYA 2MC5A 2JOXA 4GKJE 2V87A 4BC7A 4M0VA 2JOBA 3K6QA 1EKZA 4X66E 4JV5E 2RS7A 1GQEA 4LU9A 2LRSA 2LBSB 1QU6A 1T4LB 4DV7E 4LF7E 2HHHE 4TUIA 4DV3E 2NUEA 3HTXA 1N36E 4LF9E 1GZ6A 4JI3E 4DR5E 4Q28A 1I94E 3J80C 1HNXE 2NUGA 4KHPE 1T4OA 2L2MA 4GEQB 2RS6A 4F9AB 2JVAA 4DV1E 1WHNA 4DV4E 5A2QC 1IBKE 1WXRA 4B3TE 3KWRA 4X65E 2F8BA 2UXBE 5AASA 4BC9A 2EWLA 3ADGA 2L33A 2FTXB 4JI5E 2DIXA 1N33E 4M2ZA 4X64E 5IT9C 1X48A 3F6HA 4DMIA 2ODRC 2M1SA 1FJGE 2RTXA 1HR0E 2DMYA 4DV6E 4JI0E 3HPSA 1X47A 1XNRE 4DR6E 2WZOA 3OMLA 3AV0A 3F6GA 2V83A 1XMQE 4B3SE 4DR7E 3IWDA 4JI7E 2V8QB 4F54A 2UXCE 2ZM6E 2L3CA 1STUA 4JYAE 3HPZA 1DI2A 2B9DA 4DR1E 3ADLA 1RQ0A 1WHQA 5IWAE 2KHXA 2H36X 5ADZA 4AQYE 3T1HE 4KZSA 2L2NA 4OX9E 4K0KE 2JR1A 4JI1E 4DV2E 5LL6R 2L2KB 5CFFE 3HQ1A 2E5LE 4NXNE 3JTZA 3VK6A 3DF6A 1YYWA 1N34E 3LLHA 3FIGA 4F9BB 1YYKA 1ZBTA 1DQ3A 2EZ6A 1N32E 4B3RE 3T1YE 1YYOA 2YT4A 4LF6E 3J7Yp 1X49A 4YY3E 5FLXC 2UUBE 2MDRA 2V85A 4X8WA 4BBYA 1XNQE 4L5NC 4X62E 2K4VA 3OTOE 2M7QA 4NXME 2V88A 4JI6E 2E1MA 4J8ZA 4LFBE 4LF5E 2F4VE 2B7VA 5AE1A 2LTSA 3MSWA 4LFCE 4DKKA 2VQEE 3IWCA 2LTRA 3HXLA 2UUCE 2N3GA 4LTYA 3P1XA 4LF4E 2LUPB 5DNYA 2UU9E 5LMUE 4YHHE 2LMZA 1UHZA 2JWOA 2V86A 2JY9A 2VF1A 1O0WA 2B3TB 2N3HA 5F3WA 1IBME 2VE7C 2ODRD 1UILA 2UUAE 3VYXA 3ADIA 2G7HA 2MC6A 3J7AG 5BR8E 4DR3E 3VYYA 4I8OA 4BS9A 1ZBQA 3J81C 4BCAA 4F9CB 4DV0E 5LMNE 3RMPA 4DUYE 1T4NA 2L8TA 3JU0A 2CPNA 4L8NA 3ZOQB 2L3JA 3ADJA 2L92A 3AUZA 4DR4E 4JI4E 5AE3A 4LF8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOG C;  4GKK E;  1FKA E;  2IHR 1;  2NUF A;  2LJH A;  3C4B A;  2LUQ A;  4M30 A;  2UXD E;  4DV5 E;  4WYQ B;  1XMO E;  4DUZ E;  4LFA E;  1J26 A;  1PKP A;  3C4T A;  2RSM A;  1YZ9 A;  1HNW E;  2NA2 A;  2B7T A;  2VQF E;  2DB2 A;  4B3S E;  1RC7 A;  4JI8 E;  1J5E E;  4DR2 E;  4WFT A;  4B3M E;  1HNZ E;  4JI2 E;  1IBL E;  4GKJ E;  1EKZ A;  4X66 E;  4JV5 E;  2RS7 A;  1GQE A;  2LBS B;  2LRS A;  4LF7 E;  1QU6 A;  1T4L B;  4DV7 E;  2NUE A;  2HHH E;  4DV3 E;  3HTX A;  1N36 E;  4LF9 E;  4JI3 E;  4DR5 E;  1I94 E;  1HNX E;  2NUG A;  4KHP E;  1T4O A;  2L2M A;  2RS6 A;  4DV4 E;  2JVA A;  4DV1 E;  1WHN A;  1IBK E;  4B3T E;  4X65 E;  2UXB E;  3ADG A;  2L33 A;  4JI5 E;  2DIX A;  1N33 E;  4M2Z A;  4X64 E;  1X48 A;  1FJG E;  2RTX A;  1HR0 E;  2DMY A;  4DV6 E;  4JI0 E;  1X47 A;  1XNR E;  4DR6 E;  1XMQ E;  4DR7 E;  4JI7 E;  2UXC E;  2ZM6 E;  2L3C A;  1STU A;  4JYA E;  1DI2 A;  4DR1 E;  3ADL A;  1RQ0 A;  1WHQ A;  5IWA E;  2KHX A;  4AQY E;  3T1H E;  2L2N A;  4OX9 E;  4K0K E;  4JI1 E;  4DV2 E;  2L2K B;  5CFF E;  2E5L E;  4NXN E;  1YYW A;  1N34 E;  3LLH A;  1YYK A;  1ZBT A;  2EZ6 A;  1N32 E;  4B3R E;  3T1Y E;  1YYO A;  2YT4 A;  4LF6 E;  3J7Y p;  1X49 A;  4YY3 E;  2UUB E;  2MDR A;  4X8W A;  1XNQ E;  4X62 E;  3OTO E;  4NXM E;  4JI6 E;  4LFB E;  4LF5 E;  2F4V E;  2B7V A;  2LTS A;  4LFC E;  4DKK A;  2VQE E;  2LTR A;  2UUC E;  2N3G A;  3P1X A;  4LF4 E;  2LUP B;  2UU9 E;  5LMU E;  4YHH E;  1UHZ A;  2JY9 A;  1O0W A;  2B3T B;  2N3H A;  1IBM E;  2UUA E;  1UIL A;  3VYX A;  3ADI A;  5BR8 E;  4DR3 E;  3VYY A;  4DV0 E;  5LMN E;  4DUY E;  1T4N A;  2CPN A;  2L3J A;  4DR4 E;  3ADJ A;  4JI4 E;  4LF8 E; 
#chains in the Genus database with same CATH topology
 2NAB A;  4OOG C;  4ZYG A;  2LE2 A;  2IHR 1;  4TUG A;  2UXD E;  2EMW A;  4DV5 E;  4LFA E;  2EPX A;  2RSM A;  4N4R B;  2B7T A;  4BMJ A;  2EM5 A;  4B3S E;  2FGG A;  2WBT A;  4R8O A;  1YSA C;  1EH8 A;  2KON A;  4P78 A;  4B3M E;  2M4I A;  2JOX A;  4BC7 A;  1X6F A;  3K6Q A;  4X9J A;  5IV8 B;  4LF7 E;  2EJ4 A;  2HGH A;  4GZN C;  2LV2 A;  1WJP A;  1GZ6 A;  3J80 C;  2YTI A;  3MHS C;  4GEQ B;  2RS6 A;  4F9A B;  5A2Q C;  1IBK E;  2RPC A;  1WXR A;  2EMG A;  2FTX B;  2R76 A;  2DIX A;  5IT9 C;  1X48 A;  3F6H A;  1F2I G;  1A1J A;  2ODR C;  1HR0 E;  4DV6 E;  3HPS A;  3F6G A;  2YTO A;  1XMQ E;  2A25 A;  2V8Q B;  4F54 A;  2PRT A;  4NZV A;  1G2D C;  1EH7 A;  3ADL A;  4R2D A;  4R2R A;  2KHX A;  2EPL X;  3EQ1 A;  5AC4 A;  4AQY E;  3T1H E;  2YTQ A;  3BBG A;  5KL2 A;  2CSH A;  3JTZ A;  3FIG A;  1YYK A;  1DQ3 A;  5KL3 A;  2CTD A;  1NEI A;  1WRJ A;  3EPK A;  1MEY C;  2UUB E;  2DLQ A;  2V85 A;  4BBY A;  1XNQ E;  4O24 A;  1KYQ A;  4NXM E;  2EMB A;  4JI6 E;  2DGC A;  1X6H A;  1IMU A;  2LTS A;  3MSW A;  1A1G A;  4DKK A;  2GLI A;  2YTG A;  4F2J C;  5DNY A;  2VRD A;  2EM3 A;  2V86 A;  5F3W A;  2JY9 A;  1BB8 A;  3THN A;  1IBM E;  2ODR D;  2EML A;  2EN1 A;  4F9C B;  5LMN E;  4DUY E;  3JU0 A;  3ZOQ B;  2EOR A;  2L92 A;  2LO3 A;  3AUZ A;  4JI4 E;  5AE3 A;  4LF8 E;  1FKA E;  2EMK A;  2L6M A;  2NUF A;  4M30 A;  4WSP A;  5T6J A;  1XMO E;  3C4T A;  2EN6 A;  1YZ9 A;  2NA2 A;  1HNW E;  2DB2 A;  4JI8 E;  2YRK A;  1YFH A;  1IQO A;  2JXP A;  3DJW A;  2EMC A;  2MC5 A;  2EMY A;  2ADR A;  2EPN A;  4M0V A;  2EPO A;  2EM7 A;  1TN9 A;  2RS7 A;  1GQE A;  1QU6 A;  4DV7 E;  2EOJ A;  2EMI A;  1A1H A;  4R2S A;  1AAY A;  1I94 E;  3TQM A;  5KL7 A;  2LCE A;  3L00 A;  1G2F C;  2NUG A;  1T4O A;  2L2M A;  2M9A A;  4DV4 E;  4DV1 E;  2EQ3 A;  1B69 A;  2YWQ A;  3KWR A;  4B3T E;  2F8B A;  1YPN A;  2LJU A;  3ADG A;  2L33 A;  2WBU A;  2YSP A;  1N33 E;  4M2Z A;  2RSI A;  1XNR E;  1GTK A;  2GHF A;  2V83 A;  3IWD A;  2EMZ A;  1Z1B A;  1PJQ A;  2L3C A;  1RMD A;  1DI2 A;  2B9D A;  2GPI A;  2EM8 A;  2EOX A;  5IWA E;  2YPN A;  5A6B D;  2H36 X;  1MGT A;  2MKN A;  5ADZ A;  4KZS A;  2JR1 A;  4JI1 E;  5LL6 R;  5CFF E;  4F6M A;  3VK6 A;  2LT7 A;  1YYW A;  1P47 A;  4F9B B;  1ZBT A;  2YU8 A;  4O4K A;  4LF6 E;  4BHB A;  2EN3 A;  4L5N C;  4X62 E;  2EPR A;  2K4V A;  2EPA A;  1PJT A;  2V88 A;  2EPM X;  2EOH A;  1A1L A;  2EMF A;  2EOM A;  3QG5 C;  3THO B;  5LLQ A;  4LFC E;  2LTR A;  2UUC E;  4R2Q A;  4LF4 E;  2LUP B;  5LMU E;  2LMZ A;  3EPJ A;  2JWO A;  2VF1 A;  4R2A A;  1L4S A;  2EOZ A;  3VYX A;  2WBS A;  2G7H A;  4NHR A;  4M9V C;  1EH6 A;  4DR3 E;  4I8O A;  1BBG A;  4BCA A;  3BF2 A;  4DV0 E;  3RMP A;  4KWY A;  2EPP A;  2CT1 A;  2L8T A;  4L8N A;  2CPN A;  3EPH A;  4ZYH A;  4WSG A;  2LJH A;  3H09 A;  3C4B A;  1A1K A;  2EMH A;  1J26 A;  1PKP A;  1SR9 A;  3JAM C;  4MLV A;  4R03 A;  4WFT A;  3ECR A;  1HNZ E;  4P7D A;  2DSY A;  2MKD A;  1EKZ A;  4X66 E;  4JV5 E;  4LU9 A;  2ENC A;  1T4L B;  3MHH C;  2EOE A;  2HHH E;  4TUI A;  2YTJ A;  1N36 E;  4LF9 E;  2YRH A;  1HNX E;  2EPZ A;  3KZY A;  1T39 A;  1DGC A;  1WHN A;  4HTG A;  2R1F A;  4X65 E;  5AAS A;  4X64 E;  4DMI A;  1T38 A;  2M1S A;  2BB8 A;  2RTX A;  1X6E A;  2DMY A;  3C6K A;  2WCC 3;  2EL6 A;  4FK5 C;  2WZO A;  2EN8 A;  3AV0 A;  3C6M A;  3VHT B;  4DR7 E;  2YTP A;  1ZAA C;  2UXC E;  2EN4 A;  1STU A;  4JYA E;  2EM4 A;  3EPL A;  4DR1 E;  2EOS A;  1WHQ A;  1X3C A;  4O5G A;  2L2N A;  4K0K E;  2YTN A;  2E72 A;  4DV2 E;  3HQ1 A;  2E5L E;  1N34 E;  3M99 B;  3UK3 C;  2DLK A;  1N32 E;  3BGH A;  4BHC A;  4B3R E;  1YYO A;  2YT4 A;  2YTD A;  1X49 A;  4YY3 E;  2MDR A;  2YSO A;  4X8W A;  4IS1 C;  3OTO E;  1A1F A;  1LLM C;  2DRP A;  4J8Z A;  2F4V E;  2JP9 A;  2LVH A;  2EM9 A;  2VQE E;  3HXL A;  4LTY A;  1X5W A;  3P1X A;  2JYA A;  1NCS A;  4YHH E;  1UHZ A;  2YRM A;  1O0W A;  1ZU1 A;  2B3T B;  2EPC A;  2N3H A;  1JK2 A;  2UUA E;  1UIL A;  1KJK A;  5BR8 E;  2EE8 A;  1PDA A;  5IXM B;  4RHB B;  5A69 A;  2YTE A;  2EOQ A;  1T4N A;  2D9H A;  2L3J A;  2EM6 A;  1ZR9 A;  4WXC A;  5A6J A;  2EQ1 A;  2YZT A;  3LML A;  4Q35 B;  4GKK E;  2FV4 B;  2EL5 A;  4WPY A;  2LUQ A;  4WYQ B;  4DUZ E;  2V89 A;  3IWB A;  4MLQ A;  2VQF E;  1RC7 A;  1J5E E;  5AE2 A;  4DR2 E;  2EN7 A;  2MDG A;  2Q8U A;  4JI2 E;  1IBL E;  2KOU A;  4GKJ E;  2V87 A;  2N8X A;  4WXD A;  1JK1 A;  1YUJ A;  2JOB A;  2K7I A;  2I9I A;  1SFE A;  2LBS B;  2LRS A;  2NUE A;  4DV3 E;  4F6N A;  3HTX A;  4JI3 E;  5AC5 A;  2EM2 A;  4Q28 A;  4DR5 E;  4O43 A;  2EMA A;  2BBG A;  4KHP E;  2JVA A;  2EQ0 A;  1UN6 B;  1A1I A;  2UXB E;  4BC9 A;  2EWL A;  4RH8 A;  4JI5 E;  1BBO A;  1FJG E;  4R2E A;  4R2P A;  4ZYE A;  2ENA A;  4JI0 E;  1X47 A;  2EPU A;  4DR6 E;  3OML A;  4IJD A;  2YTF A;  2YU5 A;  5KL4 A;  4JI7 E;  5KL5 A;  2ZM6 E;  3HPZ A;  4ZYD A;  1RQ0 A;  2EL4 A;  4OX9 E;  1QNT A;  4HEI A;  5KL6 A;  2L2K B;  4NXN E;  3DF6 A;  3LLH A;  4WX9 A;  2EZ6 A;  3T1Y E;  2ELY A;  2ELZ A;  3J7Y p;  3KZZ A;  2HC5 A;  5FLX C;  2JPA A;  2EOF A;  1IQS A;  2M7Q A;  4R2C A;  2EMX A;  2E1M A;  2J7J A;  4LF5 E;  4LFB E;  2HJJ A;  2B7V A;  1YUI A;  5AE1 A;  5A6A A;  2DMI A;  2EPK X;  3IWC A;  2N3G A;  2I13 A;  2UU9 E;  1PJS A;  2EOY A;  2EP3 A;  1N3G A;  2VE7 C;  5A6B A;  3ADI A;  1TF3 A;  2MC6 A;  3J7A G;  2ENH A;  3BID A;  2EOI A;  5TSE A;  1AH5 A;  3VYY A;  4BS9 A;  1ZBQ A;  3J81 C;  2EM0 A;  2EOO A;  2RQL A;  1UBD C;  4DR4 E;  3ADJ A;  1TF6 A;  2EN2 A;  5A6K A; 
#chains in the Genus database with same CATH homology
 2YZT A;  3LML A;  2LE2 A;  4OOG C;  4GKK E;  1FKA E;  2IHR 1;  2FV4 B;  2L6M A;  2NUF A;  2LJH A;  3H09 A;  4WPY A;  3C4B A;  2LUQ A;  4M30 A;  4TUG A;  2UXD E;  4DV5 E;  4WSP A;  5T6J A;  4WYQ B;  1XMO E;  4DUZ E;  4LFA E;  1J26 A;  1PKP A;  3C4T A;  2RSM A;  1YZ9 A;  1HNW E;  2NA2 A;  2B7T A;  1SR9 A;  2V89 A;  3IWB A;  2DB2 A;  4BMJ A;  2VQF E;  4JI8 E;  3JAM C;  5AE2 A;  1RC7 A;  1J5E E;  2FGG A;  4R8O A;  4DR2 E;  4R03 A;  4WFT A;  3DJW A;  2KON A;  4P78 A;  4B3M E;  1HNZ E;  4P7D A;  1IBL E;  2KOU A;  2M4I A;  4JI2 E;  2DSY A;  2MC5 A;  2JOX A;  4GKJ E;  2V87 A;  4BC7 A;  4M0V A;  2JOB A;  3K6Q A;  1EKZ A;  4X66 E;  4JV5 E;  2RS7 A;  1GQE A;  4LU9 A;  2LRS A;  2LBS B;  1QU6 A;  1T4L B;  4DV7 E;  4LF7 E;  2HHH E;  4TUI A;  4DV3 E;  2NUE A;  3HTX A;  1N36 E;  4LF9 E;  1GZ6 A;  4JI3 E;  4DR5 E;  4Q28 A;  1I94 E;  3J80 C;  1HNX E;  2NUG A;  4KHP E;  1T4O A;  2L2M A;  4GEQ B;  2RS6 A;  4F9A B;  2JVA A;  4DV1 E;  1WHN A;  4DV4 E;  5A2Q C;  1IBK E;  1WXR A;  4B3T E;  3KWR A;  4X65 E;  2F8B A;  2UXB E;  5AAS A;  4BC9 A;  2EWL A;  3ADG A;  2L33 A;  2FTX B;  4JI5 E;  2DIX A;  1N33 E;  4M2Z A;  4X64 E;  5IT9 C;  1X48 A;  3F6H A;  4DMI A;  2ODR C;  2M1S A;  1FJG E;  2RTX A;  1HR0 E;  2DMY A;  4DV6 E;  4JI0 E;  3HPS A;  1X47 A;  1XNR E;  4DR6 E;  2WZO A;  3OML A;  3AV0 A;  3F6G A;  2V83 A;  1XMQ E;  4B3S E;  4DR7 E;  3IWD A;  4JI7 E;  2V8Q B;  4F54 A;  2UXC E;  2ZM6 E;  2L3C A;  1STU A;  4JYA E;  3HPZ A;  1DI2 A;  2B9D A;  4DR1 E;  3ADL A;  1RQ0 A;  1WHQ A;  5IWA E;  2KHX A;  2H36 X;  5ADZ A;  4AQY E;  3T1H E;  4KZS A;  2L2N A;  4OX9 E;  4K0K E;  2JR1 A;  4JI1 E;  4DV2 E;  5LL6 R;  2L2K B;  5CFF E;  3HQ1 A;  2E5L E;  4NXN E;  3JTZ A;  3VK6 A;  3DF6 A;  1YYW A;  1N34 E;  3LLH A;  3FIG A;  4F9B B;  1YYK A;  1ZBT A;  1DQ3 A;  2EZ6 A;  1N32 E;  4B3R E;  3T1Y E;  1YYO A;  2YT4 A;  4LF6 E;  3J7Y p;  1X49 A;  4YY3 E;  5FLX C;  2UUB E;  2MDR A;  2V85 A;  4X8W A;  4BBY A;  1XNQ E;  4L5N C;  4X62 E;  2K4V A;  3OTO E;  2M7Q A;  4NXM E;  2V88 A;  4JI6 E;  2E1M A;  4J8Z A;  4LFB E;  4LF5 E;  2F4V E;  2B7V A;  5AE1 A;  2LTS A;  3MSW A;  4LFC E;  4DKK A;  2VQE E;  3IWC A;  2LTR A;  3HXL A;  2UUC E;  2N3G A;  4LTY A;  3P1X A;  4LF4 E;  2LUP B;  5DNY A;  2UU9 E;  5LMU E;  4YHH E;  2LMZ A;  1UHZ A;  2JWO A;  2V86 A;  2JY9 A;  2VF1 A;  1O0W A;  2B3T B;  2N3H A;  5F3W A;  1IBM E;  2VE7 C;  2ODR D;  1UIL A;  2UUA E;  3VYX A;  3ADI A;  2G7H A;  2MC6 A;  3J7A G;  5BR8 E;  4DR3 E;  3VYY A;  4I8O A;  4BS9 A;  1ZBQ A;  3J81 C;  4BCA A;  4F9C B;  4DV0 E;  5LMN E;  3RMP A;  4DUY E;  1T4N A;  2L8T A;  3JU0 A;  2CPN A;  4L8N A;  3ZOQ B;  2L3J A;  3ADJ A;  2L92 A;  3AUZ A;  4DR4 E;  4JI4 E;  5AE3 A;  4LF8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...