2N3HA

Solution structure of drb4 dsrbd2 (viz. drb4(81-151))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding protein 4
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3hA00
1FJGE 2N3HA 4OX9E 2KHXA 1XMOE 4K0KE 2L2NA 3ADGA 4DV7E 4NXNE 4B3TE 3J7Yp 2JVAA 2RSMA 4LF6E 1WHQA 4M30A 4JI3E 2B3TB 1O0WA 2E5LE 4WYQB 2RS6A 3T1YE 1T4OA 1N36E 1J26A 2IHR1 4DR7E 4DV3E 2UUCE 1J5EE 1XNQE 4B3RE 1IBME 4LF9E 2RS7A 1EKZA 4X64E 2B7VA 4DUZE 2LUPB 2L2KB 4X62E 4JV5E 4DR5E 1ZBTA 1IBLE 2UU9E 4DR6E 1X47A 2UUAE 4DV0E 1N33E 3OTOE 2VQFE 5LMNE 5BR8E 2LTSA 1YZ9A 2L3JA 3P1XA 2YT4A 2MDRA 3ADJA 1HNWE 1IBKE 1HNXE 2LUQA 1PKPA 4NXME 3HTXA 2RTXA 2F4VE 2DMYA 4DUYE 1UILA 4DV1E 1GQEA 4JI4E 4KHPE 2L2MA 2B7TA 4WFTA 2NUEA 2NA2A 1N32E 1YYKA 4JI2E 4LF5E 1DI2A 2L3CA 2NUGA 2UXCE 1STUA 3ADIA 1HNZE 2LBSB 1UHZA 1RC7A 1XNRE 2DIXA 3VYYA 4JI1E 2LRSA 4YY3E 4JI7E 4B3ME 5LMUE 4OOGC 2CPNA 4M2ZA 2UUBE 4JI6E 4DV4E 4JI8E 2N3GA 1YYWA 1I94E 4LF4E 1WHNA 2HHHE 4YHHE 4DV6E 1HR0E 4JYAE 2L33A 3T1HE 4X65E 3ADLA 4DR4E 4GKJE 2LTRA 3VYXA 4DR2E 1RQ0A 4JI0E 4LF8E 2DB2A 4X8WA 2EZ6A 2UXBE 2NUFA 4DKKA 4JI5E 4AQYE 1QU6A 2JY9A 4DR3E 2VQEE 3LLHA 2LJHA 1N34E 1T4LB 4LFBE 1X49A 1X48A 4LFCE 4LF7E 4DV5E 4B3SE 4X66E 3C4TA 5IWAE 2UXDE 1FKAE 1YYOA 4DV2E 3C4BA 4LFAE 4GKKE 2ZM6E 4DR1E 1XMQE 1T4NA 5CFFE
chains in the Genus database with same CATH superfamily
2EOIA 2F8BA 1P47A 1FJGE 2N3HA 4OX9E 1XMOE 2EWLA 2FV4B 4K0KE 3ADGA 4DV7E 4NXNE 3L00A 5A6BD 2RSMA 3H09A 1WHQA 2YTGA 1A1KA 3QG5C 1RMDA 4BMJA 4FK5C 4R2RA 1J26A 2HC5A 2EN2A 5A6BA 2EOZA 2HGHA 4X9JA 4DUZE 2B7VA 4X62E 2MDGA 5DNYA 2M1SA 1ZBTA 2UU9E 1N3GA 1X47A 2V88A 5LMNE 1YZ9A 2LTSA 3P1XA 2EM7A 2MC6A 1IBKE 5A2QC 3J81C 2JPAA 4WPYA 3DJWA 3IWDA 1EH6A 1PJTA 1WXRA 2RTXA 4DMIA 2DGCA 2YTJA 2EN7A 2L2MA 2BB8A 2B7TA 5AE2A 1N32E 2YTQA 4JI2E 4LF5E 1IQOA 2ENAA 2YZTA 1STUA 1G2DC 1RC7A 3VYYA 2YTNA 4R2QA 2I13A 1MEYC 2K4VA 4WX9A 4JI7E 4OOGC 3MSWA 2LVHA 5A6KA 2B9DA 2N3GA 2EPZA 5KL5A 1I94E 4LF4E 2EPAA 2EMBA 2EPCA 3JTZA 2L8TA 2WCC3 2EM0A 2YRHA 5IV8B 2G7HA 1YPNA 4X65E 3VK6A 4TUGA 4P78A 3VYXA 1YFHA 4M0VA 4LF8E 2JP9A 2YSPA 2ODRC 2EN8A 2EPNA 1Z1BA 2RQLA 1X6FA 1X48A 2RSIA 2LMZA 4ZYHA 3KWRA 3HPSA 1FKAE 2EPXA 2ENHA 2EPKX 2HHHE 4DR1E 2KOUA 2EORA 1A1HA 4F2JC 2EM8A 2RPCA 3F6HA 5ADZA 1MGTA 1G2FC 4L5NC 1KJKA 2EOMA 4B3TE 2JVAA 2NABA 4LF6E 2WBTA 3HXLA 2B3TB 1TF3A 4R8OA 5LLQA 1T4OA 5IXMB 2EMCA 5AC5A 2D9HA 1UN6B 4LF9E 1DGCA 1ZAAC 1A1LA 1SR9A 2EM6A 4JV5E 2PRTA 1IBLE 2UUAE 1BBOA 3FIGA 3HQ1A 2YWQA 1PDAA 4Q35B 5BR8E 2EJ4A 2L3JA 1NCSA 5IT9C 2EQ1A 4NXME 4BHCA 2EN6A 1IMUA 4P7DA 2Q8UA 4F9AB 2DMYA 4DUYE 3RMPA 1A1GA 1GQEA 2EMXA 4JI4E 2ADRA 4KHPE 4HEIA 4WFTA 5LL6R 2NA2A 2MKDA 2NUGA 1SFEA 2YTEA 1X6HA 1UHZA 1GZ6A 1HNZE 2DIXA 5AE1A 5KL4A 3UK3C 4B3ME 2FTXB 1KYQA 2KONA 2LJUA 2N8XA 3IWBA 4M2ZA 4MLQA 4R2SA 4JI6E 4JI8E 1YYWA 4L8NA 2EL5A 2V86A 4ZYGA 2L33A 3ADLA 2DRPA 2EMLA 2LTRA 2EMWA 3J80C 3EPHA 4JI0E 2GLIA 1B69A 2UXBE 4GZNC 2L6MA 4O5GA 4JI5E 4AQYE 2EPPA 3EQ1A 2YSOA 2VE7C 1TF6A 4LF7E 2DMIA 2YTPA 3C4TA 4R2EA 2YPNA 1T39A 2YTOA 2HJJA 4F54A 4GKKE 2ZM6E 1L4SA 3DF6A 1F2IG 1DQ3A 3AV0A 3C6MA 2KHXA 2EOEA 2V8QB 3J7AG 2EN3A 4KWYA 1AH5A 2LV2A 1UBDC 4O24A 2EMGA 2E5LE 4WYQB 3EPLA 2RS6A 3THNA 3VHTB 1YSAC 2LE2A 2IHR1 3THOB 4DV3E 4R2AA 1J5EE 1XNQE 4B3RE 1IBME 3MHSC 2ENCA 4F9BB 4NHRA 1X5WA 1YUJA 4DR6E 2I9IA 2MKNA 4ZYEA 1N33E 3OTOE 5AE3A 2VQFE 1AAYA 4R2PA 3OMLA 2YT4A 2MDRA 3ADJA 4BS9A 2YTFA 5KL3A 4M9VC 1HNWE 1HNXE 5F3WA 2GHFA 2R1FA 1PKPA 4BC9A 1JK2A 3HTXA 2WBUA 2LT7A 4O4KA 2BBGA 4DV1E 2YU8A 2E1MA 1JK1A 2NUEA 2EM2A 1DI2A 2L3CA 1A1JA 5KL6A 2M7QA 1BBGA 1XNRE 2M9AA 4JI1E 4J8ZA 5LMUE 2CSHA 2EOXA 2UUBE 5FLXC 1WHNA 3EPKA 2EMAA 2EL6A 2EQ0A 2V87A 4DV6E 4JYAE 4GKJE 3BGHA 1ZBQA 2CTDA 4R2CA 3LMLA 2EZ6A 3IWCA 2EOFA 1QU6A 2EOOA 2JY9A 4DR3E 2VQEE 2LJHA 1T4LB 1X49A 2M4IA 4LFCE 4KZSA 2R76A 1X3CA 4B3SE 2EMIA 5T6JA 2EMFA 2LCEA 5IWAE 2E72A 2JYAA 2VF1A 2EPRA 1NEIA 2YTIA 3C4BA 4WSPA 3TQMA 4DV2E 1YYOA 4LTYA 4O43A 2EPUA 1T4NA 5CFFE 1A1IA 1PJSA 1WJPA 4RH8A 5KL2A 1EH7A 2EM5A 2EPOA 4F9CB 2L2NA 2JXPA 4BCAA 1WRJA 4WXCA 2EPMX 3J7Yp 1BB8A 2JOXA 2EOJA 4NZVA 2ELYA 4M30A 4JI3E 1O0WA 2ODRD 2ELZA 3BF2A 1YUIA 1TN9A 3T1YE 1N36E 2EQ3A 2EMYA 1LLMC 2UUCE 4DR7E 2YU5A 3KZYA 2DLKA 3M99B 2EP3A 2RS7A 1EKZA 2EMKA 4X64E 4ZYDA 2LUPB 2L2KB 1ZR9A 4IS1C 3BBGA 4BBYA 4GEQB 2J7JA 1A1FA 2CT1A 2YRMA 4DR5E 2EL4A 3C6KA 1GTKA 4DV0E 4R2DA 4MLVA 4F6MA 1X6EA 5AASA 4WSGA 4IJDA 5AC4A 4N4RB 4LU9A 3JU0A 2LUQA 2H36X 2VRDA 5A69A 2F4VE 2EMZA 2EOQA 2EOYA 1UILA 2A25A 2DLQA 4HTGA 3ECRA 4BHBA 1T38A 2V85A 2EM9A 2EN4A 3MHHC 2EOHA 1YYKA 3K6QA 4Q28A 2FGGA 2UXCE 3ADIA 2LBSB 2V89A 1IQSA 2EM4A 2LRSA 2EE8A 2GPIA 4YY3E 4TUIA 3KZZA 2CPNA 4I8OA 5TSEA 3EPJA 4DV4E 3BIDA 4RHBB 3HPZA 2LO3A 2MC5A 1EH8A 2V83A 4YHHE 4F6NA 5A6AA 3AUZA 5KL7A 1HR0E 3T1HE 4DR4E 4R03A 4DR2E 2JWOA 1RQ0A 2EPLX 2JOBA 2DB2A 2YTDA 3F6GA 3ZOQB 2WZOA 4X8WA 5A6JA 4WXDA 2EOSA 2NUFA 2WBSA 4DKKA 2EM3A 2EMHA 1QNTA 1ZU1A 2JR1A 1PJQA 2EN1A 3LLHA 1N34E 4LFBE 2DSYA 4DV5E 4X66E 4BC7A 2UXDE 2YRKA 2K7IA 2L92A 4LFAE 1XMQE 3JAMC
chains in the Genus database with same CATH topology
3DF6A 2F8BA 1FJGE 2N3HA 4OX9E 3F6HA 1DQ3A 3AV0A 5ADZA 2KHXA 2V8QB 1XMOE 3J7AG 2EWLA 2FV4B 4F9CB 4L5NC 4K0KE 2L2NA 3ADGA 4DV7E 4NXNE 4BCAA 4B3TE 3J7Yp 2JVAA 4GKKE 2JOXA 2RSMA 3H09A 4LF6E 1WHQA 4M30A 4JI3E 3HXLA 2B3TB 1O0WA 2E5LE 4R8OA 4WYQB 2ODRD 4BMJA 2RS6A 3T1YE 1T4OA 1N36E 1J26A 2LE2A 2IHR1 4DR7E 4DV3E 2UUCE 1J5EE 1XNQE 4B3RE 1IBME 4LF9E 2RS7A 1EKZA 4X64E 2B7VA 4DUZE 2LUPB 2L2KB 1SR9A 4BBYA 4F9BB 4X62E 4GEQB 5DNYA 4JV5E 2M1SA 4DR5E 1ZBTA 1IBLE 2UU9E 4DR6E 1X47A 2UUAE 4DV0E 2V88A 3FIGA 3OTOE 3HQ1A 5AE3A 1N33E 2VQFE 5LMNE 5BR8E 2LTSA 1YZ9A 3OMLA 2L3JA 3P1XA 5AASA 2YT4A 2MC6A 2MDRA 3ADJA 4BS9A 1HNWE 5IT9C 4LU9A 1IBKE 5A2QC 3J81C 1HNXE 3JU0A 5F3WA 2LUQA 1PKPA 2H36X 4WPYA 1XMQE 4NXME 3DJWA 4BC9A 3IWDA 1WXRA 4P7DA 3HTXA 2RTXA 4DMIA 4F9AB 2F4VE 2DMYA 4DUYE 3RMPA 1UILA 4DV1E 1GQEA 4JI4E 2V85A 4KHPE 2E1MA 2L2MA 2B7TA 4WFTA 5LL6R 2NUEA 5AE2A 2NA2A 1N32E 1YYKA 3K6QA 4JI2E 4LF5E 1DI2A 2YZTA 4Q28A 2L3CA 2FGGA 2NUGA 2UXCE 1STUA 3ADIA 1HNZE 2LBSB 1UHZA 1GZ6A 2M7QA 2V89A 1RC7A 1XNRE 2DIXA 3VYYA 5AE1A 4JI1E 2LRSA 4TUIA 4YY3E 2K4VA 4J8ZA 4JI7E 4B3ME 2FTXB 2KONA 4OOGC 3MSWA 2CPNA 4I8OA 5LMUE 3IWBA 4M2ZA 2B9DA 2UUBE 4JI6E 4DV4E 4JI8E 2N3GA 5FLXC 1YYWA 4L8NA 1I94E 1WHNA 3HPZA 2HHHE 4LF4E 2MC5A 2V83A 2L8TA 3JTZA 4YHHE 2V87A 4DV6E 2V86A 3AUZA 1HR0E 2G7HA 2L33A 3T1HE 4X65E 3ADLA 4DR4E 4JYAE 4GKJE 2LTRA 3VK6A 4TUGA 4P78A 4R03A 3VYXA 4DR2E 2JWOA 3J80C 1RQ0A 1ZBQA 4M0VA 4JI0E 4LF8E 2JOBA 2DB2A 3F6GA 3LMLA 2WZOA 4X8WA 3ZOQB 3JAMC 2EZ6A 2UXBE 2NUFA 2L6MA 4DKKA 3IWCA 4JI5E 4AQYE 2JR1A 2ODRC 1QU6A 2JY9A 4DR3E 2VQEE 3LLHA 2LJHA 1N34E 1T4LB 4LFBE 1X49A 2VE7C 1X48A 2DSYA 2M4IA 2LMZA 4LFCE 4KZSA 4LF7E 4DV5E 4B3SE 4X66E 4BC7A 5T6JA 3C4TA 5IWAE 3KWRA 2UXDE 3HPSA 1FKAE 2L92A 2VF1A 4WSPA 3C4BA 4DV2E 1YYOA 4F54A 4LFAE 4LTYA 2ZM6E 4DR1E 2KOUA 1T4NA 5CFFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG E;  2N3H A;  4OX9 E;  2KHX A;  1XMO E;  4K0K E;  2L2N A;  3ADG A;  4DV7 E;  4NXN E;  4B3T E;  3J7Y p;  2JVA A;  2RSM A;  4LF6 E;  1WHQ A;  4M30 A;  4JI3 E;  2B3T B;  1O0W A;  2E5L E;  4WYQ B;  2RS6 A;  3T1Y E;  1T4O A;  1N36 E;  1J26 A;  2IHR 1;  4DR7 E;  4DV3 E;  2UUC E;  1J5E E;  1XNQ E;  4B3R E;  1IBM E;  4LF9 E;  2RS7 A;  1EKZ A;  4X64 E;  2B7V A;  4DUZ E;  2LUP B;  2L2K B;  4X62 E;  4JV5 E;  4DR5 E;  1ZBT A;  1IBL E;  2UU9 E;  4DR6 E;  1X47 A;  2UUA E;  4DV0 E;  1N33 E;  3OTO E;  2VQF E;  5LMN E;  5BR8 E;  2LTS A;  1YZ9 A;  2L3J A;  3P1X A;  2YT4 A;  2MDR A;  3ADJ A;  1HNW E;  1IBK E;  1HNX E;  2LUQ A;  1PKP A;  4NXM E;  3HTX A;  2RTX A;  2F4V E;  2DMY A;  4DUY E;  1UIL A;  4DV1 E;  1GQE A;  4JI4 E;  4KHP E;  2L2M A;  2B7T A;  4WFT A;  2NUE A;  2NA2 A;  1N32 E;  1YYK A;  4JI2 E;  4LF5 E;  1DI2 A;  2L3C A;  2NUG A;  2UXC E;  1STU A;  3ADI A;  1HNZ E;  2LBS B;  1UHZ A;  1RC7 A;  1XNR E;  2DIX A;  3VYY A;  4JI1 E;  2LRS A;  4YY3 E;  4JI7 E;  4B3M E;  5LMU E;  4OOG C;  2CPN A;  4M2Z A;  2UUB E;  4JI6 E;  4DV4 E;  4JI8 E;  2N3G A;  1YYW A;  1I94 E;  4LF4 E;  1WHN A;  2HHH E;  4YHH E;  4DV6 E;  1HR0 E;  4JYA E;  2L33 A;  3T1H E;  4X65 E;  3ADL A;  4DR4 E;  4GKJ E;  2LTR A;  3VYX A;  4DR2 E;  1RQ0 A;  4JI0 E;  4LF8 E;  2DB2 A;  4X8W A;  2EZ6 A;  2UXB E;  2NUF A;  4DKK A;  4JI5 E;  4AQY E;  1QU6 A;  2JY9 A;  4DR3 E;  2VQE E;  3LLH A;  2LJH A;  1N34 E;  1T4L B;  4LFB E;  1X49 A;  1X48 A;  4LFC E;  4LF7 E;  4DV5 E;  4B3S E;  4X66 E;  3C4T A;  5IWA E;  2UXD E;  1FKA E;  1YYO A;  4DV2 E;  3C4B A;  4LFA E;  4GKK E;  2ZM6 E;  4DR1 E;  1XMQ E;  1T4N A;  5CFF E; 
#chains in the Genus database with same CATH topology
 2EOI A;  2F8B A;  1P47 A;  1FJG E;  2N3H A;  4OX9 E;  1XMO E;  2EWL A;  2FV4 B;  4K0K E;  3ADG A;  4DV7 E;  4NXN E;  3L00 A;  5A6B D;  2RSM A;  3H09 A;  1WHQ A;  2YTG A;  1A1K A;  3QG5 C;  1RMD A;  4BMJ A;  4FK5 C;  4R2R A;  1J26 A;  2HC5 A;  2EN2 A;  5A6B A;  2EOZ A;  2HGH A;  4X9J A;  4DUZ E;  2B7V A;  4X62 E;  2MDG A;  5DNY A;  2M1S A;  1ZBT A;  2UU9 E;  1N3G A;  1X47 A;  2V88 A;  5LMN E;  1YZ9 A;  2LTS A;  3P1X A;  2EM7 A;  2MC6 A;  1IBK E;  5A2Q C;  3J81 C;  2JPA A;  4WPY A;  3DJW A;  3IWD A;  1EH6 A;  1PJT A;  1WXR A;  2RTX A;  4DMI A;  2DGC A;  2YTJ A;  2EN7 A;  2L2M A;  2BB8 A;  2B7T A;  5AE2 A;  1N32 E;  2YTQ A;  4JI2 E;  4LF5 E;  1IQO A;  2ENA A;  2YZT A;  1STU A;  1G2D C;  1RC7 A;  3VYY A;  2YTN A;  4R2Q A;  2I13 A;  1MEY C;  2K4V A;  4WX9 A;  4JI7 E;  4OOG C;  3MSW A;  2LVH A;  5A6K A;  2B9D A;  2N3G A;  2EPZ A;  5KL5 A;  1I94 E;  4LF4 E;  2EPA A;  2EMB A;  2EPC A;  3JTZ A;  2L8T A;  2WCC 3;  2EM0 A;  2YRH A;  5IV8 B;  2G7H A;  1YPN A;  4X65 E;  3VK6 A;  4TUG A;  4P78 A;  3VYX A;  1YFH A;  4M0V A;  4LF8 E;  2JP9 A;  2YSP A;  2ODR C;  2EN8 A;  2EPN A;  1Z1B A;  2RQL A;  1X6F A;  1X48 A;  2RSI A;  2LMZ A;  4ZYH A;  3KWR A;  3HPS A;  1FKA E;  2EPX A;  2ENH A;  2EPK X;  2HHH E;  4DR1 E;  2KOU A;  2EOR A;  1A1H A;  4F2J C;  2EM8 A;  2RPC A;  3F6H A;  5ADZ A;  1MGT A;  1G2F C;  4L5N C;  1KJK A;  2EOM A;  4B3T E;  2JVA A;  2NAB A;  4LF6 E;  2WBT A;  3HXL A;  2B3T B;  1TF3 A;  4R8O A;  5LLQ A;  1T4O A;  5IXM B;  2EMC A;  5AC5 A;  2D9H A;  1UN6 B;  4LF9 E;  1DGC A;  1ZAA C;  1A1L A;  1SR9 A;  2EM6 A;  4JV5 E;  2PRT A;  1IBL E;  2UUA E;  1BBO A;  3FIG A;  3HQ1 A;  2YWQ A;  1PDA A;  4Q35 B;  5BR8 E;  2EJ4 A;  2L3J A;  1NCS A;  5IT9 C;  2EQ1 A;  4NXM E;  4BHC A;  2EN6 A;  1IMU A;  4P7D A;  2Q8U A;  4F9A B;  2DMY A;  4DUY E;  3RMP A;  1A1G A;  1GQE A;  2EMX A;  4JI4 E;  2ADR A;  4KHP E;  4HEI A;  4WFT A;  5LL6 R;  2NA2 A;  2MKD A;  2NUG A;  1SFE A;  2YTE A;  1X6H A;  1UHZ A;  1GZ6 A;  1HNZ E;  2DIX A;  5AE1 A;  5KL4 A;  3UK3 C;  4B3M E;  2FTX B;  1KYQ A;  2KON A;  2LJU A;  2N8X A;  3IWB A;  4M2Z A;  4MLQ A;  4R2S A;  4JI6 E;  4JI8 E;  1YYW A;  4L8N A;  2EL5 A;  2V86 A;  4ZYG A;  2L33 A;  3ADL A;  2DRP A;  2EML A;  2LTR A;  2EMW A;  3J80 C;  3EPH A;  4JI0 E;  2GLI A;  1B69 A;  2UXB E;  4GZN C;  2L6M A;  4O5G A;  4JI5 E;  4AQY E;  2EPP A;  3EQ1 A;  2YSO A;  2VE7 C;  1TF6 A;  4LF7 E;  2DMI A;  2YTP A;  3C4T A;  4R2E A;  2YPN A;  1T39 A;  2YTO A;  2HJJ A;  4F54 A;  4GKK E;  2ZM6 E;  1L4S A;  3DF6 A;  1F2I G;  1DQ3 A;  3AV0 A;  3C6M A;  2KHX A;  2EOE A;  2V8Q B;  3J7A G;  2EN3 A;  4KWY A;  1AH5 A;  2LV2 A;  1UBD C;  4O24 A;  2EMG A;  2E5L E;  4WYQ B;  3EPL A;  2RS6 A;  3THN A;  3VHT B;  1YSA C;  2LE2 A;  2IHR 1;  3THO B;  4DV3 E;  4R2A A;  1J5E E;  1XNQ E;  4B3R E;  1IBM E;  3MHS C;  2ENC A;  4F9B B;  4NHR A;  1X5W A;  1YUJ A;  4DR6 E;  2I9I A;  2MKN A;  4ZYE A;  1N33 E;  3OTO E;  5AE3 A;  2VQF E;  1AAY A;  4R2P A;  3OML A;  2YT4 A;  2MDR A;  3ADJ A;  4BS9 A;  2YTF A;  5KL3 A;  4M9V C;  1HNW E;  1HNX E;  5F3W A;  2GHF A;  2R1F A;  1PKP A;  4BC9 A;  1JK2 A;  3HTX A;  2WBU A;  2LT7 A;  4O4K A;  2BBG A;  4DV1 E;  2YU8 A;  2E1M A;  1JK1 A;  2NUE A;  2EM2 A;  1DI2 A;  2L3C A;  1A1J A;  5KL6 A;  2M7Q A;  1BBG A;  1XNR E;  2M9A A;  4JI1 E;  4J8Z A;  5LMU E;  2CSH A;  2EOX A;  2UUB E;  5FLX C;  1WHN A;  3EPK A;  2EMA A;  2EL6 A;  2EQ0 A;  2V87 A;  4DV6 E;  4JYA E;  4GKJ E;  3BGH A;  1ZBQ A;  2CTD A;  4R2C A;  3LML A;  2EZ6 A;  3IWC A;  2EOF A;  1QU6 A;  2EOO A;  2JY9 A;  4DR3 E;  2VQE E;  2LJH A;  1T4L B;  1X49 A;  2M4I A;  4LFC E;  4KZS A;  2R76 A;  1X3C A;  4B3S E;  2EMI A;  5T6J A;  2EMF A;  2LCE A;  5IWA E;  2E72 A;  2JYA A;  2VF1 A;  2EPR A;  1NEI A;  2YTI A;  3C4B A;  4WSP A;  3TQM A;  4DV2 E;  1YYO A;  4LTY A;  4O43 A;  2EPU A;  1T4N A;  5CFF E;  1A1I A;  1PJS A;  1WJP A;  4RH8 A;  5KL2 A;  1EH7 A;  2EM5 A;  2EPO A;  4F9C B;  2L2N A;  2JXP A;  4BCA A;  1WRJ A;  4WXC A;  2EPM X;  3J7Y p;  1BB8 A;  2JOX A;  2EOJ A;  4NZV A;  2ELY A;  4M30 A;  4JI3 E;  1O0W A;  2ODR D;  2ELZ A;  3BF2 A;  1YUI A;  1TN9 A;  3T1Y E;  1N36 E;  2EQ3 A;  2EMY A;  1LLM C;  2UUC E;  4DR7 E;  2YU5 A;  3KZY A;  2DLK A;  3M99 B;  2EP3 A;  2RS7 A;  1EKZ A;  2EMK A;  4X64 E;  4ZYD A;  2LUP B;  2L2K B;  1ZR9 A;  4IS1 C;  3BBG A;  4BBY A;  4GEQ B;  2J7J A;  1A1F A;  2CT1 A;  2YRM A;  4DR5 E;  2EL4 A;  3C6K A;  1GTK A;  4DV0 E;  4R2D A;  4MLV A;  4F6M A;  1X6E A;  5AAS A;  4WSG A;  4IJD A;  5AC4 A;  4N4R B;  4LU9 A;  3JU0 A;  2LUQ A;  2H36 X;  2VRD A;  5A69 A;  2F4V E;  2EMZ A;  2EOQ A;  2EOY A;  1UIL A;  2A25 A;  2DLQ A;  4HTG A;  3ECR A;  4BHB A;  1T38 A;  2V85 A;  2EM9 A;  2EN4 A;  3MHH C;  2EOH A;  1YYK A;  3K6Q A;  4Q28 A;  2FGG A;  2UXC E;  3ADI A;  2LBS B;  2V89 A;  1IQS A;  2EM4 A;  2LRS A;  2EE8 A;  2GPI A;  4YY3 E;  4TUI A;  3KZZ A;  2CPN A;  4I8O A;  5TSE A;  3EPJ A;  4DV4 E;  3BID A;  4RHB B;  3HPZ A;  2LO3 A;  2MC5 A;  1EH8 A;  2V83 A;  4YHH E;  4F6N A;  5A6A A;  3AUZ A;  5KL7 A;  1HR0 E;  3T1H E;  4DR4 E;  4R03 A;  4DR2 E;  2JWO A;  1RQ0 A;  2EPL X;  2JOB A;  2DB2 A;  2YTD A;  3F6G A;  3ZOQ B;  2WZO A;  4X8W A;  5A6J A;  4WXD A;  2EOS A;  2NUF A;  2WBS A;  4DKK A;  2EM3 A;  2EMH A;  1QNT A;  1ZU1 A;  2JR1 A;  1PJQ A;  2EN1 A;  3LLH A;  1N34 E;  4LFB E;  2DSY A;  4DV5 E;  4X66 E;  4BC7 A;  2UXD E;  2YRK A;  2K7I A;  2L92 A;  4LFA E;  1XMQ E;  3JAM C; 
#chains in the Genus database with same CATH homology
 3DF6 A;  2F8B A;  1FJG E;  2N3H A;  4OX9 E;  3F6H A;  1DQ3 A;  3AV0 A;  5ADZ A;  2KHX A;  2V8Q B;  1XMO E;  3J7A G;  2EWL A;  2FV4 B;  4F9C B;  4L5N C;  4K0K E;  2L2N A;  3ADG A;  4DV7 E;  4NXN E;  4BCA A;  4B3T E;  3J7Y p;  2JVA A;  4GKK E;  2JOX A;  2RSM A;  3H09 A;  4LF6 E;  1WHQ A;  4M30 A;  4JI3 E;  3HXL A;  2B3T B;  1O0W A;  2E5L E;  4R8O A;  4WYQ B;  2ODR D;  4BMJ A;  2RS6 A;  3T1Y E;  1T4O A;  1N36 E;  1J26 A;  2LE2 A;  2IHR 1;  4DR7 E;  4DV3 E;  2UUC E;  1J5E E;  1XNQ E;  4B3R E;  1IBM E;  4LF9 E;  2RS7 A;  1EKZ A;  4X64 E;  2B7V A;  4DUZ E;  2LUP B;  2L2K B;  1SR9 A;  4BBY A;  4F9B B;  4X62 E;  4GEQ B;  5DNY A;  4JV5 E;  2M1S A;  4DR5 E;  1ZBT A;  1IBL E;  2UU9 E;  4DR6 E;  1X47 A;  2UUA E;  4DV0 E;  2V88 A;  3FIG A;  3OTO E;  3HQ1 A;  5AE3 A;  1N33 E;  2VQF E;  5LMN E;  5BR8 E;  2LTS A;  1YZ9 A;  3OML A;  2L3J A;  3P1X A;  5AAS A;  2YT4 A;  2MC6 A;  2MDR A;  3ADJ A;  4BS9 A;  1HNW E;  5IT9 C;  4LU9 A;  1IBK E;  5A2Q C;  3J81 C;  1HNX E;  3JU0 A;  5F3W A;  2LUQ A;  1PKP A;  2H36 X;  4WPY A;  1XMQ E;  4NXM E;  3DJW A;  4BC9 A;  3IWD A;  1WXR A;  4P7D A;  3HTX A;  2RTX A;  4DMI A;  4F9A B;  2F4V E;  2DMY A;  4DUY E;  3RMP A;  1UIL A;  4DV1 E;  1GQE A;  4JI4 E;  2V85 A;  4KHP E;  2E1M A;  2L2M A;  2B7T A;  4WFT A;  5LL6 R;  2NUE A;  5AE2 A;  2NA2 A;  1N32 E;  1YYK A;  3K6Q A;  4JI2 E;  4LF5 E;  1DI2 A;  2YZT A;  4Q28 A;  2L3C A;  2FGG A;  2NUG A;  2UXC E;  1STU A;  3ADI A;  1HNZ E;  2LBS B;  1UHZ A;  1GZ6 A;  2M7Q A;  2V89 A;  1RC7 A;  1XNR E;  2DIX A;  3VYY A;  5AE1 A;  4JI1 E;  2LRS A;  4TUI A;  4YY3 E;  2K4V A;  4J8Z A;  4JI7 E;  4B3M E;  2FTX B;  2KON A;  4OOG C;  3MSW A;  2CPN A;  4I8O A;  5LMU E;  3IWB A;  4M2Z A;  2B9D A;  2UUB E;  4JI6 E;  4DV4 E;  4JI8 E;  2N3G A;  5FLX C;  1YYW A;  4L8N A;  1I94 E;  1WHN A;  3HPZ A;  2HHH E;  4LF4 E;  2MC5 A;  2V83 A;  2L8T A;  3JTZ A;  4YHH E;  2V87 A;  4DV6 E;  2V86 A;  3AUZ A;  1HR0 E;  2G7H A;  2L33 A;  3T1H E;  4X65 E;  3ADL A;  4DR4 E;  4JYA E;  4GKJ E;  2LTR A;  3VK6 A;  4TUG A;  4P78 A;  4R03 A;  3VYX A;  4DR2 E;  2JWO A;  3J80 C;  1RQ0 A;  1ZBQ A;  4M0V A;  4JI0 E;  4LF8 E;  2JOB A;  2DB2 A;  3F6G A;  3LML A;  2WZO A;  4X8W A;  3ZOQ B;  3JAM C;  2EZ6 A;  2UXB E;  2NUF A;  2L6M A;  4DKK A;  3IWC A;  4JI5 E;  4AQY E;  2JR1 A;  2ODR C;  1QU6 A;  2JY9 A;  4DR3 E;  2VQE E;  3LLH A;  2LJH A;  1N34 E;  1T4L B;  4LFB E;  1X49 A;  2VE7 C;  1X48 A;  2DSY A;  2M4I A;  2LMZ A;  4LFC E;  4KZS A;  4LF7 E;  4DV5 E;  4B3S E;  4X66 E;  4BC7 A;  5T6J A;  3C4T A;  5IWA E;  3KWR A;  2UXD E;  3HPS A;  1FKA E;  2L92 A;  2VF1 A;  4WSP A;  3C4B A;  4DV2 E;  1YYO A;  4F54 A;  4LFA E;  4LTY A;  2ZM6 E;  4DR1 E;  2KOU A;  1T4N A;  5CFF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...