2N3HA

Solution structure of drb4 dsrbd2 (viz. drb4(81-151))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-binding protein 4
publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3hA00
3ADIA 2UUCE 4JI0E 4DKKA 2UXBE 1T4NA 1PKPA 2JY9A 1WHNA 2UUAE 1N32E 4M30A 1QU6A 1GQEA 2DB2A 4JI6E 3ADGA 2E5LE 1I94E 2L2NA 2VQFE 4LF5E 4DV7E 2L3JA 4LF4E 5LMNE 2N3GA 4B3ME 4B3TE 5BR8E 2DMYA 4GKKE 1UILA 2L33A 3ADJA 3HTXA 4K0KE 1XMOE 2HHHE 1IBLE 4JI2E 4JYAE 4DV4E 4LF7E 4X64E 3T1HE 2L3CA 1YYOA 4LFCE 2B7VA 4DR4E 4DR7E 1N36E 4JV5E 1ZBTA 2YT4A 3VYXA 4B3SE 1FKAE 1O0WA 2N3HA 3T1YE 1XMQE 4NXME 2L2MA 1IBME 1N33E 2UXDE 4X66E 1J26A 2LRSA 1X49A 2B7TA 2RS7A 1RC7A 2NUGA 2RTXA 2CPNA 1YYWA 4X62E 4B3RE 1N34E 1YYKA 1RQ0A 2B3TB 1J5EE 4DV0E 4DUZE 4NXNE 4JI7E 2ZM6E 4DR5E 2RSMA 1X48A 1YZ9A 1WHQA 3VYYA 4X8WA 2UUBE 1HNWE 1T4OA 4DV6E 4LFBE 2L2KB 3C4TA 4DV1E 4LF6E 2F4VE 1T4LB 5CFFE 4WFTA 4M2ZA 4JI4E 2NA2A 3OTOE 4JI3E 4JI8E 2LUQA 2RS6A 4YHHE 1FJGE 2UU9E 4DV3E 4DR3E 3J7Yp 3P1XA 1UHZA 1DI2A 4AQYE 4OX9E 4KHPE 4DR2E 1HNZE 1IBKE 2KHXA 4JI1E 2LTSA 2LUPB 4LF8E 2IHR1 2LJHA 1EKZA 2JVAA 4JI5E 1HNXE 2UXCE 4DUYE 4LF9E 2NUFA 3ADLA 4X65E 2LTRA 4DV2E 2MDRA 5IWAE 4DR1E 4YY3E 4OOGC 1X47A 1HR0E 4DR6E 2EZ6A 2VQEE 2LBSB 4LFAE 4DV5E 1XNRE 2NUEA 3C4BA 1STUA 4GKJE 1XNQE 3LLHA 2DIXA 4WYQB 5LMUE
chains in the Genus database with same CATH superfamily
4JI0E 2EWLA 2G7HA 2JY9A 2UUAE 4BCAA 1PJTA 4L8NA 1BBGA 4JI6E 4MLVA 2GPIA 2HJJA 1I94E 5LMNE 4NHRA 4WXCA 2HC5A 3J81C 2EOJA 1YPNA 4GKKE 2N8XA 3MSWA 2EOEA 5IXMB 4RHBB 2FGGA 3ADJA 3BF2A 1TN9A 3HTXA 1XMOE 4F9CB 2E1MA 2V85A 3C6KA 2WBUA 2L3CA 2V87A 2B7VA 4DR7E 1WRJA 4JV5E 5AC5A 1IMUA 3VYXA 4B3SE 1RMDA 4WPYA 1XMQE 2EPMX 1NEIA 4R2RA 3IWDA 1J26A 2EMIA 2RTXA 2CPNA 3IWCA 2EJ4A 1B69A 1YYWA 2WCC3 4R2EA 1TF6A 3FIGA 2B3TB 5KL7A 1G2FC 3VYYA 4X8WA 1ZAAC 2EOHA 2EOOA 4DV6E 1MGTA 1YUJA 1A1LA 2R1FA 3C4TA 3F6GA 1T4LB 4ZYHA 3VHTB 2EM4A 2RPCA 3OTOE 2DSYA 3DJWA 2EMGA 4GZNC 2UU9E 1KJKA 4DV3E 1ZBQA 2EMBA 4IJDA 2EPKX 4AQYE 2VE7C 4DR2E 4JI1E 1QNTA 2LJHA 2JVAA 2EL4A 5AE3A 2LMZA 4Q35B 1YUIA 2DLKA 4DUYE 2NUFA 2KONA 2M9AA 1JK1A 2ENCA 2LTRA 2YTIA 3AUZA 4X65E 3F6HA 4F2JC 3JTZA 4F6MA 4R2QA 1HR0E 2EZ6A 5A6JA 4O24A 4LFAE 4DV5E 4R2PA 1STUA 2EPPA 3THOB 2EM5A 4WYQB 5AC4A 2YRHA 4DKKA 1PKPA 2V83A 1WHNA 4NZVA 4M30A 4R2AA 1QU6A 2Q8UA 3ADGA 4ZYEA 2M1SA 1X6HA 3IWBA 4LF5E 2LO3A 2L3JA 2EN2A 1IQOA 1G2DC 2EOXA 3LMLA 5DNYA 5ADZA 2ODRC 2HHHE 2I13A 3T1HE 5IV8B 4R2CA 1YYOA 2M4IA 2YU8A 2EL5A 5LLQA 3HPSA 4KZSA 1AH5A 3BBGA 2ELZA 1FKAE 4P7DA 5KL5A 5KL2A 4NXME 1PJQA 1N33E 2UXDE 1DQ3A 2LRSA 1X49A 2B9DA 2RS7A 1A1KA 2DMIA 1DGCA 4F54A 1N34E 2EPRA 2LE2A 1JK2A 2EOFA 2YPNA 3KWRA 3EPHA 1HNWE 2EM6A 4LFBE 2L2KB 5A69A 2PRTA 1EH8A 1WJPA 4WSPA 2DRPA 4LF6E 2EN3A 2F4VE 2EMLA 2EQ1A 4M2ZA 2WBTA 4JI3E 2EOIA 2GLIA 2LUQA 1KYQA 2RS6A 2FV4B 4DR3E 3J7Yp 2EOQA 3P1XA 2CT1A 4MLQA 3ECRA 3HPZA 4R2SA 4P78A 1DI2A 4O43A 1IBKE 5IT9C 4LF8E 2LVHA 3KZZA 4JI5E 2ENAA 5AE1A 2EN1A 2EN7A 1HNXE 2L6MA 2UXCE 2VF1A 4LF9E 4BMJA 2VRDA 4L5NC 4DV2E 3DF6A 2MDRA 4DR6E 5A6AA 2EOZA 4BBYA 2VQEE 4HTGA 3C4BA 2GHFA 1UBDC 2EM2A 4HEIA 4GKJE 1XNQE 3LLHA 4N4RB 5LMUE 1L4SA 3C6MA 2UUCE 2UXBE 1EH6A 1T4NA 2EPLX 1N32E 5KL4A 2EL6A 3K6QA 5TSEA 2YSPA 2V89A 2JR1A 2VQFE 2JOXA 4DV7E 2JP9A 4LF4E 2EP3A 2ADRA 2RSIA 2N3GA 4B3ME 3RMPA 4R8OA 2J7JA 2YTEA 3BGHA 5BR8E 2DMYA 5KL6A 4TUIA 2K7IA 2WZOA 5LL6R 1UILA 2EORA 2L33A 1A1FA 1T38A 2YRKA 1IBLE 4JI2E 4X64E 1ZR9A 4J8ZA 4LFCE 4DR4E 2MKDA 1N36E 1X5WA 4BHCA 2V8QB 3EPKA 2N3HA 2EPAA 1GTKA 1IBME 1AAYA 2B7TA 2NUGA 4ZYGA 4M9VC 4B3RE 2EOMA 3MHHC 4R03A 1J5EE 4NXNE 4DV0E 4DR5E 2RSMA 1X48A 1YZ9A 2YTOA 1WHQA 2EM3A 2EMXA 2KOUA 2UUBE 1T4OA 3HQ1A 1T39A 3EPJA 2E72A 4DV1E 2HGHA 2FTXB 1BBOA 5AE2A 2YWQA 2YTPA 4BC9A 2NA2A 2LT7A 2JOBA 4O5GA 2LCEA 3OMLA 1SFEA 2JWOA 2EMCA 3ZOQB 1FJGE 4RH8A 2MKNA 2L8TA 2EMAA 1UHZA 2LV2A 3JU0A 4DMIA 1X3CA 4KHPE 2R76A 1HNZE 3HXLA 2LTSA 2LUPB 3EPLA 1EKZA 2EE8A 2A25A 4IS1C 1Z1BA 3L00A 2MC5A 4LU9A 3H09A 2EPXA 2DLQA 3J7AG 4DR1E 2YRMA 4YY3E 4OOGC 1A1HA 2DGCA 2H36X 2LBSB 1GZ6A 5KL3A 2JPAA 1EH7A 3J80C 2DIXA 2EMFA 2YSOA 2EQ3A 4TUGA 4F9AB 3ADIA 4O4KA 4ZYDA 2CSHA 4R2DA 1GQEA 4WX9A 2DB2A 5T6JA 3JAMC 2E5LE 3MHSC 2L2NA 3ADLA 2YTJA 5A6BA 3VK6A 1A1IA 4B3TE 2EN6A 1TF3A 2JXPA 1P47A 3UK3C 2M7QA 1NCSA 4K0KE 4JYAE 1SR9A 2EM8A 4DV4E 4LF7E 2EMZA 2YTQA 3AV0A 2EMHA 2EPUA 5A6BD 2EM9A 3KZYA 1ZBTA 2V88A 4LTYA 2YT4A 1WXRA 1O0WA 3T1YE 2L2MA 2EMYA 4X66E 2EMKA 4BC7A 2L92A 1RC7A 5F3WA 1A1JA 1F2IG 4X62E 2D9HA 2EOSA 1YYKA 1RQ0A 2EPNA 2EMWA 4DUZE 1X6FA 4JI7E 2ZM6E 2EPCA 4BS9A 5A6KA 4I8OA 2ELYA 1BB8A 3BIDA 4GEQB 5FLXC 1A1GA 2I9IA 2EM0A 2MC6A 2YTGA 1X6EA 2ODRD 3THNA 5CFFE 2CTDA 2BB8A 2F8BA 4WFTA 5A2QC 2MDGA 1IQSA 2ENHA 4JI4E 3TQMA 2EN4A 4JI8E 1LLMC 1YFHA 1YSAC 2EN8A 2RQLA 2V86A 4YHHE 1PDAA 4X9JA 1ZU1A 4F9BB 1MEYC 4F6NA 2YTFA 4OX9E 4KWYA 4WXDA 2KHXA 2WBSA 2IHR1 1PJSA 4WSGA 3M99B 2YZTA 4BHBA 3EQ1A 4FK5C 5AASA 2LJUA 3QG5C 2YU5A 2BBGA 5IWAE 1X47A 2EOYA 2EPZA 4M0VA 1XNRE 2YTNA 1UN6B 2NUEA 2EM7A 2K4VA 2EQ0A 2YTDA 4Q28A 2EPOA 2NABA 2JYAA 1N3GA
chains in the Genus database with same CATH topology
4F9AB 3ADIA 2UUCE 4JI0E 4DKKA 2EWLA 2UXBE 1T4NA 2G7HA 1PKPA 2JY9A 1WHNA 2V83A 2UUAE 1N32E 4M30A 4BCAA 1QU6A 1GQEA 4L8NA 2DB2A 5T6JA 3K6QA 4JI6E 3ADGA 3JAMC 2E5LE 2M1SA 1I94E 2V89A 2JR1A 2L2NA 3IWBA 2JOXA 2VQFE 4DV7E 2L3JA 4LF4E 4LF5E 5LMNE 2N3GA 4B3ME 3VK6A 3RMPA 3J81C 4R8OA 4B3TE 5BR8E 2DMYA 4GKKE 4TUIA 2WZOA 3LMLA 2M7QA 3MSWA 5DNYA 5LL6R 1UILA 2L33A 2FGGA 3ADJA 5ADZA 3HTXA 4K0KE 2ODRC 1XMOE 1SR9A 1IBLE 2HHHE 4F9CB 4DV4E 2E1MA 2V85A 4X64E 3T1HE 4JI2E 4LF7E 2L3CA 1YYOA 2M4IA 4J8ZA 2V87A 4LFCE 4TUGA 3HPSA 2B7VA 3AV0A 4KZSA 4DR4E 4DR7E 1N36E 4JV5E 2V8QB 1ZBTA 2V88A 4LTYA 2YT4A 1WXRA 4B3SE 1FKAE 3VYXA 1O0WA 2N3HA 4P7DA 3T1YE 4WPYA 1XMQE 4NXME 2L2MA 1IBME 1N33E 3IWDA 4X66E 1DQ3A 2UXDE 1J26A 2LRSA 1X49A 2L92A 4BC7A 2B7TA 2B9DA 2RS7A 1RC7A 2NUGA 5F3WA 2RTXA 2CPNA 3IWCA 1YYWA 4X62E 4B3RE 4F54A 1N34E 1YYKA 4R03A 1RQ0A 2B3TB 3FIGA 2LE2A 4DUZE 4DV0E 4JI7E 1J5EE 4NXNE 2ZM6E 4JYAE 4DR5E 4BS9A 2RSMA 1X48A 3KWRA 4I8OA 1WHQA 3VYYA 4X8WA 2UUBE 1YZ9A 2KOUA 1HNWE 1T4OA 4DV6E 4GEQB 4LFBE 2L2KB 5FLXC 3HQ1A 2MC6A 3C4TA 4WSPA 3F6GA 4DV1E 4LF6E 2F4VE 1T4LB 2ODRD 5CFFE 2F8BA 4WFTA 5A2QC 2FTXB 5AE2A 4M2ZA 4BC9A 4JI4E 2NA2A 3OTOE 2DSYA 4JI3E 2JOBA 4JI8E 3DJWA 3OMLA 2LUQA 2JWOA 2RS6A 3ZOQB 2V86A 4YHHE 2UU9E 1FJGE 2L8TA 2FV4B 4DV3E 4DR3E 3J7Yp 3P1XA 1UHZA 1ZBQA 3JU0A 3HPZA 4F9BB 4P78A 4DMIA 1DI2A 4AQYE 4OX9E 4KHPE 2VE7C 4DR2E 3HXLA 1HNZE 1IBKE 2KHXA 4JI1E 2LTSA 2LUPB 5IT9C 4LF8E 2IHR1 2LJHA 1EKZA 2JVAA 5AE3A 4JI5E 5AE1A 2LMZA 2YZTA 1HNXE 2L6MA 2UXCE 2MC5A 2VF1A 4LU9A 4DUYE 5AASA 3H09A 4LF9E 2NUFA 2KONA 3J7AG 3ADLA 4X65E 2LTRA 3AUZA 4BMJA 3F6HA 3JTZA 4L5NC 4DV2E 3DF6A 2MDRA 5IWAE 4DR1E 4YY3E 4OOGC 1X47A 1HR0E 4DR6E 2EZ6A 2H36X 4BBYA 2VQEE 2LBSB 4LFAE 4DV5E 1XNRE 2NUEA 3C4BA 1STUA 2K4VA 1GZ6A 4GKJE 1XNQE 3J80C 3LLHA 2DIXA 4Q28A 4M0VA 4WYQB 5LMUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADI A;  2UUC E;  4JI0 E;  4DKK A;  2UXB E;  1T4N A;  1PKP A;  2JY9 A;  1WHN A;  2UUA E;  1N32 E;  4M30 A;  1QU6 A;  1GQE A;  2DB2 A;  4JI6 E;  3ADG A;  2E5L E;  1I94 E;  2L2N A;  2VQF E;  4LF5 E;  4DV7 E;  2L3J A;  4LF4 E;  5LMN E;  2N3G A;  4B3M E;  4B3T E;  5BR8 E;  2DMY A;  4GKK E;  1UIL A;  2L33 A;  3ADJ A;  3HTX A;  4K0K E;  1XMO E;  2HHH E;  1IBL E;  4JI2 E;  4JYA E;  4DV4 E;  4LF7 E;  4X64 E;  3T1H E;  2L3C A;  1YYO A;  4LFC E;  2B7V A;  4DR4 E;  4DR7 E;  1N36 E;  4JV5 E;  1ZBT A;  2YT4 A;  3VYX A;  4B3S E;  1FKA E;  1O0W A;  2N3H A;  3T1Y E;  1XMQ E;  4NXM E;  2L2M A;  1IBM E;  1N33 E;  2UXD E;  4X66 E;  1J26 A;  2LRS A;  1X49 A;  2B7T A;  2RS7 A;  1RC7 A;  2NUG A;  2RTX A;  2CPN A;  1YYW A;  4X62 E;  4B3R E;  1N34 E;  1YYK A;  1RQ0 A;  2B3T B;  1J5E E;  4DV0 E;  4DUZ E;  4NXN E;  4JI7 E;  2ZM6 E;  4DR5 E;  2RSM A;  1X48 A;  1YZ9 A;  1WHQ A;  3VYY A;  4X8W A;  2UUB E;  1HNW E;  1T4O A;  4DV6 E;  4LFB E;  2L2K B;  3C4T A;  4DV1 E;  4LF6 E;  2F4V E;  1T4L B;  5CFF E;  4WFT A;  4M2Z A;  4JI4 E;  2NA2 A;  3OTO E;  4JI3 E;  4JI8 E;  2LUQ A;  2RS6 A;  4YHH E;  1FJG E;  2UU9 E;  4DV3 E;  4DR3 E;  3J7Y p;  3P1X A;  1UHZ A;  1DI2 A;  4AQY E;  4OX9 E;  4KHP E;  4DR2 E;  1HNZ E;  1IBK E;  2KHX A;  4JI1 E;  2LTS A;  2LUP B;  4LF8 E;  2IHR 1;  2LJH A;  1EKZ A;  2JVA A;  4JI5 E;  1HNX E;  2UXC E;  4DUY E;  4LF9 E;  2NUF A;  3ADL A;  4X65 E;  2LTR A;  4DV2 E;  2MDR A;  5IWA E;  4DR1 E;  4YY3 E;  4OOG C;  1X47 A;  1HR0 E;  4DR6 E;  2EZ6 A;  2VQE E;  2LBS B;  4LFA E;  4DV5 E;  1XNR E;  2NUE A;  3C4B A;  1STU A;  4GKJ E;  1XNQ E;  3LLH A;  2DIX A;  4WYQ B;  5LMU E; 
#chains in the Genus database with same CATH topology
 4JI0 E;  2EWL A;  2G7H A;  2JY9 A;  2UUA E;  4BCA A;  1PJT A;  4L8N A;  1BBG A;  4JI6 E;  4MLV A;  2GPI A;  2HJJ A;  1I94 E;  5LMN E;  4NHR A;  4WXC A;  2HC5 A;  3J81 C;  2EOJ A;  1YPN A;  4GKK E;  2N8X A;  3MSW A;  2EOE A;  5IXM B;  4RHB B;  2FGG A;  3ADJ A;  3BF2 A;  1TN9 A;  3HTX A;  1XMO E;  4F9C B;  2E1M A;  2V85 A;  3C6K A;  2WBU A;  2L3C A;  2V87 A;  2B7V A;  4DR7 E;  1WRJ A;  4JV5 E;  5AC5 A;  1IMU A;  3VYX A;  4B3S E;  1RMD A;  4WPY A;  1XMQ E;  2EPM X;  1NEI A;  4R2R A;  3IWD A;  1J26 A;  2EMI A;  2RTX A;  2CPN A;  3IWC A;  2EJ4 A;  1B69 A;  1YYW A;  2WCC 3;  4R2E A;  1TF6 A;  3FIG A;  2B3T B;  5KL7 A;  1G2F C;  3VYY A;  4X8W A;  1ZAA C;  2EOH A;  2EOO A;  4DV6 E;  1MGT A;  1YUJ A;  1A1L A;  2R1F A;  3C4T A;  3F6G A;  1T4L B;  4ZYH A;  3VHT B;  2EM4 A;  2RPC A;  3OTO E;  2DSY A;  3DJW A;  2EMG A;  4GZN C;  2UU9 E;  1KJK A;  4DV3 E;  1ZBQ A;  2EMB A;  4IJD A;  2EPK X;  4AQY E;  2VE7 C;  4DR2 E;  4JI1 E;  1QNT A;  2LJH A;  2JVA A;  2EL4 A;  5AE3 A;  2LMZ A;  4Q35 B;  1YUI A;  2DLK A;  4DUY E;  2NUF A;  2KON A;  2M9A A;  1JK1 A;  2ENC A;  2LTR A;  2YTI A;  3AUZ A;  4X65 E;  3F6H A;  4F2J C;  3JTZ A;  4F6M A;  4R2Q A;  1HR0 E;  2EZ6 A;  5A6J A;  4O24 A;  4LFA E;  4DV5 E;  4R2P A;  1STU A;  2EPP A;  3THO B;  2EM5 A;  4WYQ B;  5AC4 A;  2YRH A;  4DKK A;  1PKP A;  2V83 A;  1WHN A;  4NZV A;  4M30 A;  4R2A A;  1QU6 A;  2Q8U A;  3ADG A;  4ZYE A;  2M1S A;  1X6H A;  3IWB A;  4LF5 E;  2LO3 A;  2L3J A;  2EN2 A;  1IQO A;  1G2D C;  2EOX A;  3LML A;  5DNY A;  5ADZ A;  2ODR C;  2HHH E;  2I13 A;  3T1H E;  5IV8 B;  4R2C A;  1YYO A;  2M4I A;  2YU8 A;  2EL5 A;  5LLQ A;  3HPS A;  4KZS A;  1AH5 A;  3BBG A;  2ELZ A;  1FKA E;  4P7D A;  5KL5 A;  5KL2 A;  4NXM E;  1PJQ A;  1N33 E;  2UXD E;  1DQ3 A;  2LRS A;  1X49 A;  2B9D A;  2RS7 A;  1A1K A;  2DMI A;  1DGC A;  4F54 A;  1N34 E;  2EPR A;  2LE2 A;  1JK2 A;  2EOF A;  2YPN A;  3KWR A;  3EPH A;  1HNW E;  2EM6 A;  4LFB E;  2L2K B;  5A69 A;  2PRT A;  1EH8 A;  1WJP A;  4WSP A;  2DRP A;  4LF6 E;  2EN3 A;  2F4V E;  2EML A;  2EQ1 A;  4M2Z A;  2WBT A;  4JI3 E;  2EOI A;  2GLI A;  2LUQ A;  1KYQ A;  2RS6 A;  2FV4 B;  4DR3 E;  3J7Y p;  2EOQ A;  3P1X A;  2CT1 A;  4MLQ A;  3ECR A;  3HPZ A;  4R2S A;  4P78 A;  1DI2 A;  4O43 A;  1IBK E;  5IT9 C;  4LF8 E;  2LVH A;  3KZZ A;  4JI5 E;  2ENA A;  5AE1 A;  2EN1 A;  2EN7 A;  1HNX E;  2L6M A;  2UXC E;  2VF1 A;  4LF9 E;  4BMJ A;  2VRD A;  4L5N C;  4DV2 E;  3DF6 A;  2MDR A;  4DR6 E;  5A6A A;  2EOZ A;  4BBY A;  2VQE E;  4HTG A;  3C4B A;  2GHF A;  1UBD C;  2EM2 A;  4HEI A;  4GKJ E;  1XNQ E;  3LLH A;  4N4R B;  5LMU E;  1L4S A;  3C6M A;  2UUC E;  2UXB E;  1EH6 A;  1T4N A;  2EPL X;  1N32 E;  5KL4 A;  2EL6 A;  3K6Q A;  5TSE A;  2YSP A;  2V89 A;  2JR1 A;  2VQF E;  2JOX A;  4DV7 E;  2JP9 A;  4LF4 E;  2EP3 A;  2ADR A;  2RSI A;  2N3G A;  4B3M E;  3RMP A;  4R8O A;  2J7J A;  2YTE A;  3BGH A;  5BR8 E;  2DMY A;  5KL6 A;  4TUI A;  2K7I A;  2WZO A;  5LL6 R;  1UIL A;  2EOR A;  2L33 A;  1A1F A;  1T38 A;  2YRK A;  1IBL E;  4JI2 E;  4X64 E;  1ZR9 A;  4J8Z A;  4LFC E;  4DR4 E;  2MKD A;  1N36 E;  1X5W A;  4BHC A;  2V8Q B;  3EPK A;  2N3H A;  2EPA A;  1GTK A;  1IBM E;  1AAY A;  2B7T A;  2NUG A;  4ZYG A;  4M9V C;  4B3R E;  2EOM A;  3MHH C;  4R03 A;  1J5E E;  4NXN E;  4DV0 E;  4DR5 E;  2RSM A;  1X48 A;  1YZ9 A;  2YTO A;  1WHQ A;  2EM3 A;  2EMX A;  2KOU A;  2UUB E;  1T4O A;  3HQ1 A;  1T39 A;  3EPJ A;  2E72 A;  4DV1 E;  2HGH A;  2FTX B;  1BBO A;  5AE2 A;  2YWQ A;  2YTP A;  4BC9 A;  2NA2 A;  2LT7 A;  2JOB A;  4O5G A;  2LCE A;  3OML A;  1SFE A;  2JWO A;  2EMC A;  3ZOQ B;  1FJG E;  4RH8 A;  2MKN A;  2L8T A;  2EMA A;  1UHZ A;  2LV2 A;  3JU0 A;  4DMI A;  1X3C A;  4KHP E;  2R76 A;  1HNZ E;  3HXL A;  2LTS A;  2LUP B;  3EPL A;  1EKZ A;  2EE8 A;  2A25 A;  4IS1 C;  1Z1B A;  3L00 A;  2MC5 A;  4LU9 A;  3H09 A;  2EPX A;  2DLQ A;  3J7A G;  4DR1 E;  2YRM A;  4YY3 E;  4OOG C;  1A1H A;  2DGC A;  2H36 X;  2LBS B;  1GZ6 A;  5KL3 A;  2JPA A;  1EH7 A;  3J80 C;  2DIX A;  2EMF A;  2YSO A;  2EQ3 A;  4TUG A;  4F9A B;  3ADI A;  4O4K A;  4ZYD A;  2CSH A;  4R2D A;  1GQE A;  4WX9 A;  2DB2 A;  5T6J A;  3JAM C;  2E5L E;  3MHS C;  2L2N A;  3ADL A;  2YTJ A;  5A6B A;  3VK6 A;  1A1I A;  4B3T E;  2EN6 A;  1TF3 A;  2JXP A;  1P47 A;  3UK3 C;  2M7Q A;  1NCS A;  4K0K E;  4JYA E;  1SR9 A;  2EM8 A;  4DV4 E;  4LF7 E;  2EMZ A;  2YTQ A;  3AV0 A;  2EMH A;  2EPU A;  5A6B D;  2EM9 A;  3KZY A;  1ZBT A;  2V88 A;  4LTY A;  2YT4 A;  1WXR A;  1O0W A;  3T1Y E;  2L2M A;  2EMY A;  4X66 E;  2EMK A;  4BC7 A;  2L92 A;  1RC7 A;  5F3W A;  1A1J A;  1F2I G;  4X62 E;  2D9H A;  2EOS A;  1YYK A;  1RQ0 A;  2EPN A;  2EMW A;  4DUZ E;  1X6F A;  4JI7 E;  2ZM6 E;  2EPC A;  4BS9 A;  5A6K A;  4I8O A;  2ELY A;  1BB8 A;  3BID A;  4GEQ B;  5FLX C;  1A1G A;  2I9I A;  2EM0 A;  2MC6 A;  2YTG A;  1X6E A;  2ODR D;  3THN A;  5CFF E;  2CTD A;  2BB8 A;  2F8B A;  4WFT A;  5A2Q C;  2MDG A;  1IQS A;  2ENH A;  4JI4 E;  3TQM A;  2EN4 A;  4JI8 E;  1LLM C;  1YFH A;  1YSA C;  2EN8 A;  2RQL A;  2V86 A;  4YHH E;  1PDA A;  4X9J A;  1ZU1 A;  4F9B B;  1MEY C;  4F6N A;  2YTF A;  4OX9 E;  4KWY A;  4WXD A;  2KHX A;  2WBS A;  2IHR 1;  1PJS A;  4WSG A;  3M99 B;  2YZT A;  4BHB A;  3EQ1 A;  4FK5 C;  5AAS A;  2LJU A;  3QG5 C;  2YU5 A;  2BBG A;  5IWA E;  1X47 A;  2EOY A;  2EPZ A;  4M0V A;  1XNR E;  2YTN A;  1UN6 B;  2NUE A;  2EM7 A;  2K4V A;  2EQ0 A;  2YTD A;  4Q28 A;  2EPO A;  2NAB A;  2JYA A;  1N3G A; 
#chains in the Genus database with same CATH homology
 4F9A B;  3ADI A;  2UUC E;  4JI0 E;  4DKK A;  2EWL A;  2UXB E;  1T4N A;  2G7H A;  1PKP A;  2JY9 A;  1WHN A;  2V83 A;  2UUA E;  1N32 E;  4M30 A;  4BCA A;  1QU6 A;  1GQE A;  4L8N A;  2DB2 A;  5T6J A;  3K6Q A;  4JI6 E;  3ADG A;  3JAM C;  2E5L E;  2M1S A;  1I94 E;  2V89 A;  2JR1 A;  2L2N A;  3IWB A;  2JOX A;  2VQF E;  4DV7 E;  2L3J A;  4LF4 E;  4LF5 E;  5LMN E;  2N3G A;  4B3M E;  3VK6 A;  3RMP A;  3J81 C;  4R8O A;  4B3T E;  5BR8 E;  2DMY A;  4GKK E;  4TUI A;  2WZO A;  3LML A;  2M7Q A;  3MSW A;  5DNY A;  5LL6 R;  1UIL A;  2L33 A;  2FGG A;  3ADJ A;  5ADZ A;  3HTX A;  4K0K E;  2ODR C;  1XMO E;  1SR9 A;  1IBL E;  2HHH E;  4F9C B;  4DV4 E;  2E1M A;  2V85 A;  4X64 E;  3T1H E;  4JI2 E;  4LF7 E;  2L3C A;  1YYO A;  2M4I A;  4J8Z A;  2V87 A;  4LFC E;  4TUG A;  3HPS A;  2B7V A;  3AV0 A;  4KZS A;  4DR4 E;  4DR7 E;  1N36 E;  4JV5 E;  2V8Q B;  1ZBT A;  2V88 A;  4LTY A;  2YT4 A;  1WXR A;  4B3S E;  1FKA E;  3VYX A;  1O0W A;  2N3H A;  4P7D A;  3T1Y E;  4WPY A;  1XMQ E;  4NXM E;  2L2M A;  1IBM E;  1N33 E;  3IWD A;  4X66 E;  1DQ3 A;  2UXD E;  1J26 A;  2LRS A;  1X49 A;  2L92 A;  4BC7 A;  2B7T A;  2B9D A;  2RS7 A;  1RC7 A;  2NUG A;  5F3W A;  2RTX A;  2CPN A;  3IWC A;  1YYW A;  4X62 E;  4B3R E;  4F54 A;  1N34 E;  1YYK A;  4R03 A;  1RQ0 A;  2B3T B;  3FIG A;  2LE2 A;  4DUZ E;  4DV0 E;  4JI7 E;  1J5E E;  4NXN E;  2ZM6 E;  4JYA E;  4DR5 E;  4BS9 A;  2RSM A;  1X48 A;  3KWR A;  4I8O A;  1WHQ A;  3VYY A;  4X8W A;  2UUB E;  1YZ9 A;  2KOU A;  1HNW E;  1T4O A;  4DV6 E;  4GEQ B;  4LFB E;  2L2K B;  5FLX C;  3HQ1 A;  2MC6 A;  3C4T A;  4WSP A;  3F6G A;  4DV1 E;  4LF6 E;  2F4V E;  1T4L B;  2ODR D;  5CFF E;  2F8B A;  4WFT A;  5A2Q C;  2FTX B;  5AE2 A;  4M2Z A;  4BC9 A;  4JI4 E;  2NA2 A;  3OTO E;  2DSY A;  4JI3 E;  2JOB A;  4JI8 E;  3DJW A;  3OML A;  2LUQ A;  2JWO A;  2RS6 A;  3ZOQ B;  2V86 A;  4YHH E;  2UU9 E;  1FJG E;  2L8T A;  2FV4 B;  4DV3 E;  4DR3 E;  3J7Y p;  3P1X A;  1UHZ A;  1ZBQ A;  3JU0 A;  3HPZ A;  4F9B B;  4P78 A;  4DMI A;  1DI2 A;  4AQY E;  4OX9 E;  4KHP E;  2VE7 C;  4DR2 E;  3HXL A;  1HNZ E;  1IBK E;  2KHX A;  4JI1 E;  2LTS A;  2LUP B;  5IT9 C;  4LF8 E;  2IHR 1;  2LJH A;  1EKZ A;  2JVA A;  5AE3 A;  4JI5 E;  5AE1 A;  2LMZ A;  2YZT A;  1HNX E;  2L6M A;  2UXC E;  2MC5 A;  2VF1 A;  4LU9 A;  4DUY E;  5AAS A;  3H09 A;  4LF9 E;  2NUF A;  2KON A;  3J7A G;  3ADL A;  4X65 E;  2LTR A;  3AUZ A;  4BMJ A;  3F6H A;  3JTZ A;  4L5N C;  4DV2 E;  3DF6 A;  2MDR A;  5IWA E;  4DR1 E;  4YY3 E;  4OOG C;  1X47 A;  1HR0 E;  4DR6 E;  2EZ6 A;  2H36 X;  4BBY A;  2VQE E;  2LBS B;  4LFA E;  4DV5 E;  1XNR E;  2NUE A;  3C4B A;  1STU A;  2K4V A;  1GZ6 A;  4GKJ E;  1XNQ E;  3J80 C;  3LLH A;  2DIX A;  4Q28 A;  4M0V A;  4WYQ B;  5LMU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...