2N3HA

Solution structure of drb4 dsrbd2 (viz. drb4(81-151))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding protein 4
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3hA00
1WHNA 2RSMA 5IWAE 1YYOA 4DV4E 4JV5E 3OTOE 1YZ9A 2UXCE 1J26A 1STUA 2F4VE 2JY9A 2KHXA 4GKKE 4AQYE 4NXME 4JI8E 1N33E 2LUPB 2B7TA 1I94E 1DI2A 3ADLA 4LFCE 2UXBE 2RS6A 4X8WA 2LRSA 4JI5E 2DMYA 4DV1E 4LFAE 4DUZE 4DV6E 4LF6E 4DV0E 3J7Yp 1FKAE 5CFFE 4DR5E 2CPNA 4B3TE 1XNQE 3VYYA 4B3RE 1XNRE 2N3HA 4DV3E 2LTSA 2NA2A 3C4BA 2N3GA 2ZM6E 1HNWE 2IHR1 2L3JA 4KHPE 4K0KE 1X48A 2JVAA 4DR6E 2L2NA 4JI7E 2NUEA 4B3SE 4JI6E 2DIXA 4JI3E 4DR4E 1XMOE 4DV7E 4DR2E 1X47A 5LMNE 3LLHA 1N32E 1XMQE 2L2MA 1ZBTA 2UUAE 1GQEA 3ADGA 1YYWA 5LMUE 2B3TB 2RS7A 5BR8E 4X66E 4LF4E 4OX9E 3VYXA 1QU6A 4B3ME 4DKKA 4JYAE 2L33A 4OOGC 1N36E 4DR7E 1EKZA 4LF8E 4M2ZA 4DUYE 4LF5E 4YY3E 1HR0E 2HHHE 1RQ0A 1UHZA 2YT4A 4WFTA 1YYKA 3T1YE 1HNXE 2RTXA 2MDRA 4YHHE 4DR3E 4JI1E 2LTRA 1O0WA 4GKJE 2UU9E 4X62E 2LUQA 4LFBE 3P1XA 4M30A 4X64E 2E5LE 4JI4E 3ADJA 1T4LB 2NUGA 1T4OA 2UUCE 3T1HE 4LF7E 4X65E 1IBKE 2LBSB 4DV5E 4NXNE 2UUBE 2UXDE 2L2KB 1WHQA 1HNZE 3ADIA 1N34E 4LF9E 1T4NA 4DV2E 4DR1E 1RC7A 2VQEE 4JI0E 3C4TA 2L3CA 2B7VA 2LJHA 1FJGE 2NUFA 4WYQB 4JI2E 2VQFE 1IBME 1PKPA 1IBLE 1UILA 3HTXA 2DB2A 2EZ6A 1J5EE 1X49A
chains in the Genus database with same CATH superfamily
2RSMA 5IWAE 2FTXB 2EN7A 3BBGA 1P47A 2EORA 4BC7A 2F4VE 2EP3A 2WBTA 2YSOA 3EPJA 4LU9A 2M9AA 4F9CB 2VE7C 5A6BA 4BMJA 1LLMC 4X8WA 2LRSA 2EOFA 1TN9A 2EMGA 2VF1A 2EM2A 3KWRA 4M9VC 4LFAE 2ENAA 4DUZE 4LF6E 4DV0E 2EPPA 3J7Yp 4DR5E 4WSPA 2EJ4A 2N3HA 2JYAA 2ODRC 2L3JA 2K4VA 2EMHA 2EM9A 1X48A 2EN6A 4DR6E 1JK2A 2EM7A 1T38A 3IWBA 1PDAA 2DLQA 4B3SE 2CTDA 2EMAA 3THOB 1YPNA 3AUZA 4WSGA 2DIXA 4DR4E 1XMOE 1X47A 3J81C 5LMNE 3EQ1A 1NCSA 2EN2A 4IJDA 2EE8A 2EQ0A 4X9JA 2EPCA 2UUAE 1GQEA 3ADGA 2RS7A 5BR8E 1GTKA 4X66E 4R2SA 4LF4E 2YU5A 1IQOA 1QU6A 2YTPA 4R03A 2LCEA 4WPYA 3RMPA 2RSIA 5AASA 1IMUA 1EKZA 3OMLA 1AH5A 4O5GA 4YY3E 1HR0E 2DLKA 2JPAA 4WFTA 3T1YE 1YFHA 1HNXE 2EM0A 4M30A 2EPXA 4O4KA 4X64E 2V87A 2E5LE 3EPLA 2VRDA 4Q28A 1ZU1A 1JK1A 2UUCE 1EH7A 2EN4A 5IT9C 4P7DA 2HGHA 1PJTA 1IBKE 1L4SA 4DV5E 4NZVA 5A6JA 1A1GA 2HC5A 2VQEE 2E72A 4I8OA 2ELYA 2LJHA 4JI2E 2EM4A 2LJUA 2VQFE 2JOBA 2EOEA 4RHBB 1PKPA 3HTXA 2EZ6A 2EM6A 4MLQA 1N3GA 2FGGA 3L00A 4R8OA 3ZOQB 4R2EA 2HJJA 4F6MA 2YTNA 1WHNA 2BBGA 2M4IA 1YZ9A 1STUA 2JY9A 4NHRA 4AQYE 3TQMA 1N33E 2LUPB 3F6HA 2EPKX 1ZBQA 1X3CA 1I94E 1DI2A 2EMKA 2UXBE 2EM5A 2YTOA 5CFFE 2YRMA 2CPNA 3H09A 4BBYA 2BB8A 4R2CA 2YPNA 3UK3C 4HTGA 2JXPA 2J7JA 1XNRE 4B3RE 1HNWE 2LT7A 2I9IA 3C6KA 2ELZA 2YTIA 1G2FC 3FIGA 1ZBTA 1NEIA 5ADZA 1A1JA 3VYXA 2L33A 2M1SA 4F2JC 1N36E 4DR7E 4J8ZA 4RH8A 4LF8E 4F54A 4R2RA 3JAMC 4LF5E 1X6FA 2R1FA 4YHHE 4F9BB 2EWLA 1O0WA 2UU9E 2YTFA 2V8QB 2EOOA 2LMZA 4ZYGA 4DMIA 4IS1C 1YUIA 2EN1A 4LF7E 2EN8A 1AAYA 4ZYHA 1QNTA 1YUJA 4BC9A 4L5NC 2UUBE 2LE2A 2LO3A 3MHSC 1WHQA 2EPOA 2EM3A 1N34E 4LF9E 1WRJA 4DR1E 1ZR9A 2JWOA 2EL6A 5TSEA 1EH6A 3M99B 3J7AG 4BHCA 1IBME 2WBUA 1BBOA 1UILA 2DB2A 1T39A 5AE3A 2CT1A 4BCAA 3JU0A 2EMLA 3AV0A 1YYOA 4DV4E 3OTOE 5FLXC 2EMIA 2DGCA 3HPZA 3IWCA 4NXME 2EMZA 4JI8E 2JP9A 1EH8A 2YTJA 1A1FA 1TF3A 1BBGA 1PJQA 3ADLA 3HPSA 2RS6A 5LLQA 2EMCA 2V83A 5A69A 2N8XA 1FKAE 5DNYA 4B3TE 2EMFA 2V89A 1XNQE 2WBSA 3EPHA 2EPAA 2EOSA 2LTSA 2GPIA 2ZM6E 4L8NA 2Q8UA 2L92A 2YTGA 4K0KE 2EPRA 4R2DA 4R2PA 2JVAA 2YTDA 4Q35B 2F8BA 4JI7E 2NUEA 2MC5A 4WX9A 4JI6E 4JI3E 5KL3A 4P78A 4DV7E 2L8TA 5A6BD 2EMWA 3JTZA 5LMUE 2B3TB 2EOIA 2H36X 2E1MA 3MHHC 4WXCA 3K6QA 4DKKA 1G2DC 1YSAC 4OOGC 2EOXA 5AE1A 3EPKA 4M2ZA 4DUYE 2EM8A 4HEIA 2MC6A 4O43A 1YYKA 2A25A 2EPUA 5IXMB 3F6GA 1WXRA 4GKJE 4F6NA 4LFBE 2LUQA 3P1XA 2EOJA 2LV2A 2WZOA 5AE2A 4JI4E 4TUIA 3VHTB 1T4OA 3T1HE 2JOXA 2ENCA 5T6JA 4NXNE 2DSYA 2UXDE 1Z1BA 5KL6A 2ENHA 2EOYA 2EPNA 3LMLA 1GZ6A 3MSWA 4M0VA 2YU8A 4ZYEA 2L3CA 2B7VA 1FJGE 2EN3A 5A6AA 4WYQB 4F9AB 5KL2A 3KZYA 1PJSA 1A1KA 1ZAAC 2YTQA 3KZZA 2I13A 1J5EE 1X49A 2EOMA 5A6KA 1KJKA 5AC4A 5KL7A 4KZSA 3BGHA 3ECRA 4JV5E 2EQ3A 2UXCE 2ADRA 1J26A 1SFEA 1X6HA 1F2IG 5KL5A 2KHXA 4GKKE 4GEQB 2V88A 2EL4A 1RMDA 2B7TA 4LFCE 4R2AA 2EMXA 1A1LA 1IQSA 5IV8B 4JI5E 1BB8A 2EOZA 2DMYA 4DV1E 1UBDC 4DV6E 2EPMX 3QG5C 3HXLA 5AC5A 2K7IA 3BF2A 2KOUA 2MKNA 3VYYA 1KYQA 4DV3E 4KWYA 3C4BA 2NA2A 1A1IA 2N3GA 2CSHA 2IHR1 4KHPE 2EPZA 4N4RB 2YSPA 3DF6A 1DGCA 4LTYA 2WCC3 2EMYA 2L2NA 2V86A 1DQ3A 2ODRD 2B9DA 2YRKA 4DR2E 1UN6B 2YRHA 3LLHA 2PRTA 1N32E 4FK5C 1XMQE 2L2MA 2MDGA 3C6MA 2YTEA 1YYWA 2EOQA 5A2QC 4OX9E 2RPCA 3J80C 4B3ME 5F3WA 2RQLA 4JYAE 2R76A 1A1HA 3DJWA 2V85A 4BS9A 2M7QA 1TF6A 2HHHE 1RQ0A 1UHZA 2YT4A 1SR9A 2RTXA 2MDRA 4DR3E 4JI1E 2LTRA 4X62E 4MLVA 2L6MA 4WXDA 3THNA 2YZTA 3IWDA 4ZYDA 3ADJA 2FV4B 1T4LB 2NUGA 1MEYC 1MGTA 4GZNC 3HQ1A 2DMIA 2D9HA 2YWQA 5KL4A 4X65E 2KONA 2LBSB 2G7HA 2EL5A 2GLIA 2L2KB 2DRPA 1HNZE 2NABA 4TUGA 3ADIA 1WJPA 2EPLX 1T4NA 1B69A 2EOHA 4DV2E 1X6EA 1RC7A 1X5WA 4JI0E 4BHBA 2MKDA 3C4TA 5LL6R 2LVHA 4O24A 3VK6A 2JR1A 2EQ1A 2NUFA 2EMBA 1IBLE 3BIDA 2GHFA 4R2QA
chains in the Genus database with same CATH topology
1WHNA 4KZSA 2RSMA 5IWAE 2FTXB 4DV4E 2M4IA 1YYOA 3OTOE 1YZ9A 5FLXC 4JV5E 2UXCE 1J26A 1STUA 4BC7A 2F4VE 2JY9A 2KHXA 3HPZA 3IWCA 4GKKE 4AQYE 4GEQB 2V88A 4NXME 4JI8E 1N33E 4LU9A 3F6HA 2LUPB 2B7TA 1ZBQA 4F9CB 2VE7C 1I94E 1DI2A 3ADLA 3HPSA 4LFCE 2UXBE 4BMJA 2RS6A 4X8WA 2LRSA 2V83A 2VF1A 3KWRA 4JI5E 2DMYA 4DV1E 4LFAE 4DUZE 4DV6E 4LF6E 4DV0E 3J7Yp 1FKAE 5CFFE 5DNYA 3HXLA 4DR5E 2CPNA 4B3TE 3H09A 2V89A 2KOUA 4BBYA 1XNQE 4WSPA 3VYYA 4B3RE 1XNRE 2N3HA 4DV3E 2LTSA 2NA2A 3C4BA 2N3GA 2ZM6E 2ODRC 4L8NA 1HNWE 2IHR1 2L3JA 2L92A 4KHPE 4K0KE 2K4VA 3DF6A 1X48A 2JVAA 4DR6E 4LTYA 2F8BA 2L2NA 2V86A 3IWBA 1DQ3A 2MC5A 4JI7E 4B3SE 2NUEA 2ODRD 3FIGA 2B9DA 3AUZA 4JI6E 2DIXA 4JI3E 4DR4E 1XMOE 4P78A 4DV7E 4DR2E 1X47A 3J81C 5LMNE 3LLHA 1N32E 2L8TA 1XMQE 2L2MA 1ZBTA 2UUAE 1GQEA 3ADGA 3JTZA 1YYWA 5LMUE 2B3TB 2RS7A 5BR8E 5ADZA 4X66E 5A2QC 4LF4E 2H36X 4OX9E 2E1MA 3VYXA 3J80C 1QU6A 4B3ME 3K6QA 5F3WA 4DKKA 4JYAE 2L33A 2M1SA 4R03A 4WPYA 4OOGC 5AASA 3RMPA 1N36E 4J8ZA 4DR7E 3DJWA 1EKZA 5AE1A 4LF8E 4M2ZA 2V85A 4DUYE 4F54A 3OMLA 4BS9A 2M7QA 3JAMC 4LF5E 2MC6A 4YY3E 1HR0E 2HHHE 1RQ0A 1UHZA 2YT4A 4WFTA 1YYKA 3T1YE 1HNXE 1SR9A 2RTXA 2MDRA 4YHHE 3F6GA 4F9BB 2EWLA 4DR3E 4JI1E 2LTRA 1WXRA 1O0WA 4GKJE 2UU9E 4X62E 2LUQA 4LFBE 3P1XA 4M30A 4X64E 2V8QB 2WZOA 2LMZA 2V87A 4DMIA 2L6MA 2E5LE 5AE2A 2YZTA 3IWDA 4TUIA 4JI4E 3ADJA 2FV4B 1T4LB 2NUGA 4Q28A 1T4OA 2UUCE 3T1HE 3HQ1A 4LF7E 5IT9C 4P7DA 2JOXA 2KONA 4X65E 1IBKE 2LBSB 5T6JA 2G7HA 4BC9A 4DV5E 4NXNE 4L5NC 2DSYA 2UUBE 2UXDE 2LE2A 2L2KB 1WHQA 1HNZE 4TUGA 3ADIA 1N34E 4LF9E 1T4NA 3LMLA 4DV2E 1GZ6A 3MSWA 2VQEE 4DR1E 4M0VA 1RC7A 4JI0E 4I8OA 2JWOA 3C4TA 5LL6R 2L3CA 2B7VA 2LJHA 1FJGE 3VK6A 2JR1A 4WYQB 4F9AB 2NUFA 4JI2E 3J7AG 2VQFE 2JOBA 1IBME 1PKPA 1IBLE 1UILA 3HTXA 2DB2A 2EZ6A 2FGGA 5AE3A 1J5EE 4R8OA 3ZOQB 4BCAA 1X49A 3JU0A 3AV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHN A;  2RSM A;  5IWA E;  1YYO A;  4DV4 E;  4JV5 E;  3OTO E;  1YZ9 A;  2UXC E;  1J26 A;  1STU A;  2F4V E;  2JY9 A;  2KHX A;  4GKK E;  4AQY E;  4NXM E;  4JI8 E;  1N33 E;  2LUP B;  2B7T A;  1I94 E;  1DI2 A;  3ADL A;  4LFC E;  2UXB E;  2RS6 A;  4X8W A;  2LRS A;  4JI5 E;  2DMY A;  4DV1 E;  4LFA E;  4DUZ E;  4DV6 E;  4LF6 E;  4DV0 E;  3J7Y p;  1FKA E;  5CFF E;  4DR5 E;  2CPN A;  4B3T E;  1XNQ E;  3VYY A;  4B3R E;  1XNR E;  2N3H A;  4DV3 E;  2LTS A;  2NA2 A;  3C4B A;  2N3G A;  2ZM6 E;  1HNW E;  2IHR 1;  2L3J A;  4KHP E;  4K0K E;  1X48 A;  2JVA A;  4DR6 E;  2L2N A;  4JI7 E;  2NUE A;  4B3S E;  4JI6 E;  2DIX A;  4JI3 E;  4DR4 E;  1XMO E;  4DV7 E;  4DR2 E;  1X47 A;  5LMN E;  3LLH A;  1N32 E;  1XMQ E;  2L2M A;  1ZBT A;  2UUA E;  1GQE A;  3ADG A;  1YYW A;  5LMU E;  2B3T B;  2RS7 A;  5BR8 E;  4X66 E;  4LF4 E;  4OX9 E;  3VYX A;  1QU6 A;  4B3M E;  4DKK A;  4JYA E;  2L33 A;  4OOG C;  1N36 E;  4DR7 E;  1EKZ A;  4LF8 E;  4M2Z A;  4DUY E;  4LF5 E;  4YY3 E;  1HR0 E;  2HHH E;  1RQ0 A;  1UHZ A;  2YT4 A;  4WFT A;  1YYK A;  3T1Y E;  1HNX E;  2RTX A;  2MDR A;  4YHH E;  4DR3 E;  4JI1 E;  2LTR A;  1O0W A;  4GKJ E;  2UU9 E;  4X62 E;  2LUQ A;  4LFB E;  3P1X A;  4M30 A;  4X64 E;  2E5L E;  4JI4 E;  3ADJ A;  1T4L B;  2NUG A;  1T4O A;  2UUC E;  3T1H E;  4LF7 E;  4X65 E;  1IBK E;  2LBS B;  4DV5 E;  4NXN E;  2UUB E;  2UXD E;  2L2K B;  1WHQ A;  1HNZ E;  3ADI A;  1N34 E;  4LF9 E;  1T4N A;  4DV2 E;  4DR1 E;  1RC7 A;  2VQE E;  4JI0 E;  3C4T A;  2L3C A;  2B7V A;  2LJH A;  1FJG E;  2NUF A;  4WYQ B;  4JI2 E;  2VQF E;  1IBM E;  1PKP A;  1IBL E;  1UIL A;  3HTX A;  2DB2 A;  2EZ6 A;  1J5E E;  1X49 A; 
#chains in the Genus database with same CATH topology
 2RSM A;  5IWA E;  2FTX B;  2EN7 A;  3BBG A;  1P47 A;  2EOR A;  4BC7 A;  2F4V E;  2EP3 A;  2WBT A;  2YSO A;  3EPJ A;  4LU9 A;  2M9A A;  4F9C B;  2VE7 C;  5A6B A;  4BMJ A;  1LLM C;  4X8W A;  2LRS A;  2EOF A;  1TN9 A;  2EMG A;  2VF1 A;  2EM2 A;  3KWR A;  4M9V C;  4LFA E;  2ENA A;  4DUZ E;  4LF6 E;  4DV0 E;  2EPP A;  3J7Y p;  4DR5 E;  4WSP A;  2EJ4 A;  2N3H A;  2JYA A;  2ODR C;  2L3J A;  2K4V A;  2EMH A;  2EM9 A;  1X48 A;  2EN6 A;  4DR6 E;  1JK2 A;  2EM7 A;  1T38 A;  3IWB A;  1PDA A;  2DLQ A;  4B3S E;  2CTD A;  2EMA A;  3THO B;  1YPN A;  3AUZ A;  4WSG A;  2DIX A;  4DR4 E;  1XMO E;  1X47 A;  3J81 C;  5LMN E;  3EQ1 A;  1NCS A;  2EN2 A;  4IJD A;  2EE8 A;  2EQ0 A;  4X9J A;  2EPC A;  2UUA E;  1GQE A;  3ADG A;  2RS7 A;  5BR8 E;  1GTK A;  4X66 E;  4R2S A;  4LF4 E;  2YU5 A;  1IQO A;  1QU6 A;  2YTP A;  4R03 A;  2LCE A;  4WPY A;  3RMP A;  2RSI A;  5AAS A;  1IMU A;  1EKZ A;  3OML A;  1AH5 A;  4O5G A;  4YY3 E;  1HR0 E;  2DLK A;  2JPA A;  4WFT A;  3T1Y E;  1YFH A;  1HNX E;  2EM0 A;  4M30 A;  2EPX A;  4O4K A;  4X64 E;  2V87 A;  2E5L E;  3EPL A;  2VRD A;  4Q28 A;  1ZU1 A;  1JK1 A;  2UUC E;  1EH7 A;  2EN4 A;  5IT9 C;  4P7D A;  2HGH A;  1PJT A;  1IBK E;  1L4S A;  4DV5 E;  4NZV A;  5A6J A;  1A1G A;  2HC5 A;  2VQE E;  2E72 A;  4I8O A;  2ELY A;  2LJH A;  4JI2 E;  2EM4 A;  2LJU A;  2VQF E;  2JOB A;  2EOE A;  4RHB B;  1PKP A;  3HTX A;  2EZ6 A;  2EM6 A;  4MLQ A;  1N3G A;  2FGG A;  3L00 A;  4R8O A;  3ZOQ B;  4R2E A;  2HJJ A;  4F6M A;  2YTN A;  1WHN A;  2BBG A;  2M4I A;  1YZ9 A;  1STU A;  2JY9 A;  4NHR A;  4AQY E;  3TQM A;  1N33 E;  2LUP B;  3F6H A;  2EPK X;  1ZBQ A;  1X3C A;  1I94 E;  1DI2 A;  2EMK A;  2UXB E;  2EM5 A;  2YTO A;  5CFF E;  2YRM A;  2CPN A;  3H09 A;  4BBY A;  2BB8 A;  4R2C A;  2YPN A;  3UK3 C;  4HTG A;  2JXP A;  2J7J A;  1XNR E;  4B3R E;  1HNW E;  2LT7 A;  2I9I A;  3C6K A;  2ELZ A;  2YTI A;  1G2F C;  3FIG A;  1ZBT A;  1NEI A;  5ADZ A;  1A1J A;  3VYX A;  2L33 A;  2M1S A;  4F2J C;  1N36 E;  4DR7 E;  4J8Z A;  4RH8 A;  4LF8 E;  4F54 A;  4R2R A;  3JAM C;  4LF5 E;  1X6F A;  2R1F A;  4YHH E;  4F9B B;  2EWL A;  1O0W A;  2UU9 E;  2YTF A;  2V8Q B;  2EOO A;  2LMZ A;  4ZYG A;  4DMI A;  4IS1 C;  1YUI A;  2EN1 A;  4LF7 E;  2EN8 A;  1AAY A;  4ZYH A;  1QNT A;  1YUJ A;  4BC9 A;  4L5N C;  2UUB E;  2LE2 A;  2LO3 A;  3MHS C;  1WHQ A;  2EPO A;  2EM3 A;  1N34 E;  4LF9 E;  1WRJ A;  4DR1 E;  1ZR9 A;  2JWO A;  2EL6 A;  5TSE A;  1EH6 A;  3M99 B;  3J7A G;  4BHC A;  1IBM E;  2WBU A;  1BBO A;  1UIL A;  2DB2 A;  1T39 A;  5AE3 A;  2CT1 A;  4BCA A;  3JU0 A;  2EML A;  3AV0 A;  1YYO A;  4DV4 E;  3OTO E;  5FLX C;  2EMI A;  2DGC A;  3HPZ A;  3IWC A;  4NXM E;  2EMZ A;  4JI8 E;  2JP9 A;  1EH8 A;  2YTJ A;  1A1F A;  1TF3 A;  1BBG A;  1PJQ A;  3ADL A;  3HPS A;  2RS6 A;  5LLQ A;  2EMC A;  2V83 A;  5A69 A;  2N8X A;  1FKA E;  5DNY A;  4B3T E;  2EMF A;  2V89 A;  1XNQ E;  2WBS A;  3EPH A;  2EPA A;  2EOS A;  2LTS A;  2GPI A;  2ZM6 E;  4L8N A;  2Q8U A;  2L92 A;  2YTG A;  4K0K E;  2EPR A;  4R2D A;  4R2P A;  2JVA A;  2YTD A;  4Q35 B;  2F8B A;  4JI7 E;  2NUE A;  2MC5 A;  4WX9 A;  4JI6 E;  4JI3 E;  5KL3 A;  4P78 A;  4DV7 E;  2L8T A;  5A6B D;  2EMW A;  3JTZ A;  5LMU E;  2B3T B;  2EOI A;  2H36 X;  2E1M A;  3MHH C;  4WXC A;  3K6Q A;  4DKK A;  1G2D C;  1YSA C;  4OOG C;  2EOX A;  5AE1 A;  3EPK A;  4M2Z A;  4DUY E;  2EM8 A;  4HEI A;  2MC6 A;  4O43 A;  1YYK A;  2A25 A;  2EPU A;  5IXM B;  3F6G A;  1WXR A;  4GKJ E;  4F6N A;  4LFB E;  2LUQ A;  3P1X A;  2EOJ A;  2LV2 A;  2WZO A;  5AE2 A;  4JI4 E;  4TUI A;  3VHT B;  1T4O A;  3T1H E;  2JOX A;  2ENC A;  5T6J A;  4NXN E;  2DSY A;  2UXD E;  1Z1B A;  5KL6 A;  2ENH A;  2EOY A;  2EPN A;  3LML A;  1GZ6 A;  3MSW A;  4M0V A;  2YU8 A;  4ZYE A;  2L3C A;  2B7V A;  1FJG E;  2EN3 A;  5A6A A;  4WYQ B;  4F9A B;  5KL2 A;  3KZY A;  1PJS A;  1A1K A;  1ZAA C;  2YTQ A;  3KZZ A;  2I13 A;  1J5E E;  1X49 A;  2EOM A;  5A6K A;  1KJK A;  5AC4 A;  5KL7 A;  4KZS A;  3BGH A;  3ECR A;  4JV5 E;  2EQ3 A;  2UXC E;  2ADR A;  1J26 A;  1SFE A;  1X6H A;  1F2I G;  5KL5 A;  2KHX A;  4GKK E;  4GEQ B;  2V88 A;  2EL4 A;  1RMD A;  2B7T A;  4LFC E;  4R2A A;  2EMX A;  1A1L A;  1IQS A;  5IV8 B;  4JI5 E;  1BB8 A;  2EOZ A;  2DMY A;  4DV1 E;  1UBD C;  4DV6 E;  2EPM X;  3QG5 C;  3HXL A;  5AC5 A;  2K7I A;  3BF2 A;  2KOU A;  2MKN A;  3VYY A;  1KYQ A;  4DV3 E;  4KWY A;  3C4B A;  2NA2 A;  1A1I A;  2N3G A;  2CSH A;  2IHR 1;  4KHP E;  2EPZ A;  4N4R B;  2YSP A;  3DF6 A;  1DGC A;  4LTY A;  2WCC 3;  2EMY A;  2L2N A;  2V86 A;  1DQ3 A;  2ODR D;  2B9D A;  2YRK A;  4DR2 E;  1UN6 B;  2YRH A;  3LLH A;  2PRT A;  1N32 E;  4FK5 C;  1XMQ E;  2L2M A;  2MDG A;  3C6M A;  2YTE A;  1YYW A;  2EOQ A;  5A2Q C;  4OX9 E;  2RPC A;  3J80 C;  4B3M E;  5F3W A;  2RQL A;  4JYA E;  2R76 A;  1A1H A;  3DJW A;  2V85 A;  4BS9 A;  2M7Q A;  1TF6 A;  2HHH E;  1RQ0 A;  1UHZ A;  2YT4 A;  1SR9 A;  2RTX A;  2MDR A;  4DR3 E;  4JI1 E;  2LTR A;  4X62 E;  4MLV A;  2L6M A;  4WXD A;  3THN A;  2YZT A;  3IWD A;  4ZYD A;  3ADJ A;  2FV4 B;  1T4L B;  2NUG A;  1MEY C;  1MGT A;  4GZN C;  3HQ1 A;  2DMI A;  2D9H A;  2YWQ A;  5KL4 A;  4X65 E;  2KON A;  2LBS B;  2G7H A;  2EL5 A;  2GLI A;  2L2K B;  2DRP A;  1HNZ E;  2NAB A;  4TUG A;  3ADI A;  1WJP A;  2EPL X;  1T4N A;  1B69 A;  2EOH A;  4DV2 E;  1X6E A;  1RC7 A;  1X5W A;  4JI0 E;  4BHB A;  2MKD A;  3C4T A;  5LL6 R;  2LVH A;  4O24 A;  3VK6 A;  2JR1 A;  2EQ1 A;  2NUF A;  2EMB A;  1IBL E;  3BID A;  2GHF A;  4R2Q A; 
#chains in the Genus database with same CATH homology
 1WHN A;  4KZS A;  2RSM A;  5IWA E;  2FTX B;  4DV4 E;  2M4I A;  1YYO A;  3OTO E;  1YZ9 A;  5FLX C;  4JV5 E;  2UXC E;  1J26 A;  1STU A;  4BC7 A;  2F4V E;  2JY9 A;  2KHX A;  3HPZ A;  3IWC A;  4GKK E;  4AQY E;  4GEQ B;  2V88 A;  4NXM E;  4JI8 E;  1N33 E;  4LU9 A;  3F6H A;  2LUP B;  2B7T A;  1ZBQ A;  4F9C B;  2VE7 C;  1I94 E;  1DI2 A;  3ADL A;  3HPS A;  4LFC E;  2UXB E;  4BMJ A;  2RS6 A;  4X8W A;  2LRS A;  2V83 A;  2VF1 A;  3KWR A;  4JI5 E;  2DMY A;  4DV1 E;  4LFA E;  4DUZ E;  4DV6 E;  4LF6 E;  4DV0 E;  3J7Y p;  1FKA E;  5CFF E;  5DNY A;  3HXL A;  4DR5 E;  2CPN A;  4B3T E;  3H09 A;  2V89 A;  2KOU A;  4BBY A;  1XNQ E;  4WSP A;  3VYY A;  4B3R E;  1XNR E;  2N3H A;  4DV3 E;  2LTS A;  2NA2 A;  3C4B A;  2N3G A;  2ZM6 E;  2ODR C;  4L8N A;  1HNW E;  2IHR 1;  2L3J A;  2L92 A;  4KHP E;  4K0K E;  2K4V A;  3DF6 A;  1X48 A;  2JVA A;  4DR6 E;  4LTY A;  2F8B A;  2L2N A;  2V86 A;  3IWB A;  1DQ3 A;  2MC5 A;  4JI7 E;  4B3S E;  2NUE A;  2ODR D;  3FIG A;  2B9D A;  3AUZ A;  4JI6 E;  2DIX A;  4JI3 E;  4DR4 E;  1XMO E;  4P78 A;  4DV7 E;  4DR2 E;  1X47 A;  3J81 C;  5LMN E;  3LLH A;  1N32 E;  2L8T A;  1XMQ E;  2L2M A;  1ZBT A;  2UUA E;  1GQE A;  3ADG A;  3JTZ A;  1YYW A;  5LMU E;  2B3T B;  2RS7 A;  5BR8 E;  5ADZ A;  4X66 E;  5A2Q C;  4LF4 E;  2H36 X;  4OX9 E;  2E1M A;  3VYX A;  3J80 C;  1QU6 A;  4B3M E;  3K6Q A;  5F3W A;  4DKK A;  4JYA E;  2L33 A;  2M1S A;  4R03 A;  4WPY A;  4OOG C;  5AAS A;  3RMP A;  1N36 E;  4J8Z A;  4DR7 E;  3DJW A;  1EKZ A;  5AE1 A;  4LF8 E;  4M2Z A;  2V85 A;  4DUY E;  4F54 A;  3OML A;  4BS9 A;  2M7Q A;  3JAM C;  4LF5 E;  2MC6 A;  4YY3 E;  1HR0 E;  2HHH E;  1RQ0 A;  1UHZ A;  2YT4 A;  4WFT A;  1YYK A;  3T1Y E;  1HNX E;  1SR9 A;  2RTX A;  2MDR A;  4YHH E;  3F6G A;  4F9B B;  2EWL A;  4DR3 E;  4JI1 E;  2LTR A;  1WXR A;  1O0W A;  4GKJ E;  2UU9 E;  4X62 E;  2LUQ A;  4LFB E;  3P1X A;  4M30 A;  4X64 E;  2V8Q B;  2WZO A;  2LMZ A;  2V87 A;  4DMI A;  2L6M A;  2E5L E;  5AE2 A;  2YZT A;  3IWD A;  4TUI A;  4JI4 E;  3ADJ A;  2FV4 B;  1T4L B;  2NUG A;  4Q28 A;  1T4O A;  2UUC E;  3T1H E;  3HQ1 A;  4LF7 E;  5IT9 C;  4P7D A;  2JOX A;  2KON A;  4X65 E;  1IBK E;  2LBS B;  5T6J A;  2G7H A;  4BC9 A;  4DV5 E;  4NXN E;  4L5N C;  2DSY A;  2UUB E;  2UXD E;  2LE2 A;  2L2K B;  1WHQ A;  1HNZ E;  4TUG A;  3ADI A;  1N34 E;  4LF9 E;  1T4N A;  3LML A;  4DV2 E;  1GZ6 A;  3MSW A;  2VQE E;  4DR1 E;  4M0V A;  1RC7 A;  4JI0 E;  4I8O A;  2JWO A;  3C4T A;  5LL6 R;  2L3C A;  2B7V A;  2LJH A;  1FJG E;  3VK6 A;  2JR1 A;  4WYQ B;  4F9A B;  2NUF A;  4JI2 E;  3J7A G;  2VQF E;  2JOB A;  1IBM E;  1PKP A;  1IBL E;  1UIL A;  3HTX A;  2DB2 A;  2EZ6 A;  2FGG A;  5AE3 A;  1J5E E;  4R8O A;  3ZOQ B;  4BCA A;  1X49 A;  3JU0 A;  3AV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...