2N3HA

Solution structure of drb4 dsrbd2 (viz. drb4(81-151))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-binding protein 4
publication title DRB4 dsRBD1 drives dsRNA recognition in Arabidopsis thaliana tasi/siRNA pathway.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2n3hA00
2UUCE 4DUZE 1PKPA 1RC7A 2DB2A 2VQEE 2L3CA 4DV7E 1O0WA 2KHXA 1QU6A 2NUGA 4NXME 4GKKE 4OOGC 1X49A 1J5EE 4DR6E 1IBKE 2LRSA 4DV1E 4X64E 2L2KB 1STUA 4DV4E 4NXNE 1XNQE 3ADLA 2UXDE 2IHR1 4JI6E 4B3TE 2YT4A 2L3JA 4LF8E 4YY3E 3ADGA 1RQ0A 4DR5E 2CPNA 4JV5E 4B3ME 2LUQA 4DR2E 1N34E 4M2ZA 4JI2E 4YHHE 4JYAE 3VYYA 3OTOE 4DUYE 2LJHA 1DI2A 2L33A 4LF5E 1YYKA 1HNXE 2UU9E 2DMYA 1X47A 4JI1E 2L2NA 2N3HA 4DV3E 1N32E 2NA2A 4JI8E 4LFCE 1T4OA 3T1YE 4B3SE 2F4VE 3C4TA 5LMUE 2MDRA 4DV5E 3P1XA 1UILA 4M30A 4DKKA 1XMOE 4WFTA 1XNRE 1HR0E 2NUEA 2DIXA 1YYWA 4X65E 4LFBE 4B3RE 4DV0E 3ADJA 1T4NA 4LFAE 1WHNA 5CFFE 4LF4E 1YZ9A 4DR7E 2LTSA 2E5LE 1N33E 5IWAE 1FJGE 2N3GA 4AQYE 4DV2E 1EKZA 2B3TB 2RTXA 4X66E 5BR8E 3T1HE 1I94E 4KHPE 1X48A 2LTRA 3J7Yp 2UUAE 1WHQA 2B7TA 2NUFA 2LBSB 4LF7E 1FKAE 4JI4E 4GKJE 2UXBE 1J26A 1UHZA 4X8WA 4JI3E 2B7VA 2JY9A 2EZ6A 2JVAA 1HNZE 3HTXA 5LMNE 1GQEA 2HHHE 2UUBE 1HNWE 4LF9E 1XMQE 1ZBTA 4DR1E 3VYXA 3LLHA 2RSMA 2ZM6E 2RS7A 4WYQB 4X62E 2VQFE 4JI7E 4OX9E 2LUPB 4K0KE 1T4LB 1IBLE 4DV6E 3ADIA 4LF6E 4JI5E 2UXCE 1IBME 4DR4E 4DR3E 4JI0E 2L2MA 1YYOA 1N36E 3C4BA 2RS6A
chains in the Genus database with same CATH superfamily
2ODRD 1RC7A 2VQEE 2YTNA 4MLQA 2EPZA 2DLKA 4O24A 2LO3A 3BIDA 2DRPA 3EPKA 4NXME 1YSAC 2CT1A 2E72A 2EPNA 4Q35B 1XNQE 2EN4A 1DQ3A 2EOZA 2EN7A 2WCC3 1ZBQA 1PJSA 2M4IA 2EM5A 2YT4A 1TN9A 2EPLX 3KZZA 2CSHA 2YTEA 3H09A 4B3ME 1X3CA 4JV5E 4JI2E 3VYYA 2D9HA 2JPAA 1DI2A 2ELYA 2YWQA 2L33A 3LMLA 2KOUA 2EE8A 1HNXE 2DMYA 2JR1A 2L2NA 2N3HA 3THNA 2EN6A 2EL6A 2MDGA 1TF3A 3P1XA 1GZ6A 1ZAAC 4WFTA 2V89A 1HR0E 1XNRE 4F9BB 2NUEA 2B9DA 2DIXA 1YYWA 4LFBE 3F6HA 3ADJA 2EOHA 4WSGA 1WHNA 2R76A 5CFFE 2HJJA 2EPOA 1N33E 4WXDA 2N3GA 4AQYE 4DV2E 2B3TB 1I94E 5BR8E 2EWLA 2JXPA 4KHPE 1X48A 3KZYA 2B7TA 2EOXA 1FKAE 2V88A 1UHZA 2E1MA 2EZ6A 2K4VA 4LTYA 4WPYA 2EMFA 2YU8A 4HEIA 3AUZA 5IXMB 3VYXA 1NCSA 2VQFE 1ZU1A 5ADZA 2GHFA 4OX9E 1IBLE 2Q8UA 4F6NA 1X5WA 2EN3A 4BBYA 2FTXB 2L8TA 3HPZA 2EM3A 1YUIA 2YU5A 4GZNC 1IBME 4DR4E 1MGTA 4DR3E 2EOIA 1YYOA 4R2PA 5DNYA 4L5NC 2EMGA 2RS6A 2EPMX 4DUZE 2LCEA 1UN6B 4Q28A 4R2SA 2L3CA 1O0WA 3EPJA 2DLQA 1QU6A 3DJWA 2EOQA 2YTOA 4GKKE 1X49A 2L6MA 3J7AG 4DR6E 1IQSA 4F54A 3HXLA 1IBKE 2J7JA 2L2KB 1STUA 4BC9A 1AH5A 4NXNE 2EM7A 1X6EA 2WBTA 1BBOA 4JI6E 2BBGA 2L3JA 4YY3E 3IWDA 2MKDA 3M99B 2CPNA 2EM9A 2EPUA 2EMWA 2YTGA 2G7HA 4JYAE 4DUYE 3J80C 1YUJA 4BHBA 2UU9E 5AC5A 1X47A 1P47A 4JI1E 1IQOA 4DV3E 1N32E 2DGCA 2NA2A 3AV0A 4LFCE 2EMIA 2EMLA 2WZOA 5LMUE 1UBDC 3C6KA 5AE2A 4R2DA 3JU0A 2HGHA 2EQ1A 1XMOE 1BBGA 4TUGA 2EPRA 4IS1C 2EP3A 2WBSA 1T4NA 4BS9A 1A1KA 4LFAE 2EN2A 4M9VC 1IMUA 4DR7E 2EM2A 2E5LE 5KL5A 1FJGE 4M0VA 4P7DA 2RTXA 4R2CA 3T1HE 1NEIA 2LTRA 2UUAE 4DMIA 1T38A 4LF7E 3IWCA 2UXBE 1SR9A 2YSOA 4JI3E 3BGHA 2LVHA 2EPPA 3RMPA 1GQEA 2HHHE 2M1SA 3F6GA 1XMQE 1ZBTA 2EQ0A 2JOXA 4F9AB 4O5GA 5A2QC 4KZSA 5A69A 1TF6A 1JK2A 2EPXA 3J81C 3EPHA 4JI7E 2YRHA 2LUPB 4K0KE 4O4KA 1T4LB 5KL4A 5A6BA 3ADIA 4F9CB 1ZR9A 4TUIA 2UXCE 1PJQA 2N8XA 2EL4A 4RH8A 2JWOA 4JI0E 2GPIA 2MKNA 3C4BA 3BBGA 5IT9C 4ZYHA 2WBUA 2JOBA 4MLVA 1KJKA 3DF6A 2MC6A 2DB2A 4DV7E 2KHXA 2NUGA 1G2DC 4OOGC 1F2IG 2LRSA 4DV1E 2UXDE 1AAYA 4R03A 4B3TE 4LF8E 4LU9A 3ADGA 2EPCA 4ZYEA 1RQ0A 2M7QA 4R2QA 4DR5E 2V86A 2FV4B 4DR2E 3MHHC 2VF1A 2EOYA 4YHHE 3IWBA 1A1GA 1WXRA 2ENAA 1A1JA 2ODRC 4LF5E 1YYKA 2A25A 2KONA 4JI8E 2YPNA 3T1YE 2F4VE 4GEQB 3C4TA 3HPSA 4M30A 4DKKA 1Z1BA 3BF2A 2R1FA 1EH6A 2EMXA 2EM8A 2HC5A 2JYAA 2LE2A 5F3WA 1PJTA 1T39A 1BB8A 2EJ4A 4B3RE 4DV0E 2EMHA 2EMAA 2ENHA 1KYQA 5AC4A 4WX9A 1RMDA 1B69A 1WRJA 1EKZA 2YTJA 1WJPA 2K7IA 1WHQA 2V85A 5FLXC 5AASA 2LJUA 4X8WA 4RHBB 2EM4A 2EPAA 4L8NA 2B7VA 2JY9A 3EPLA 2EOFA 1HNZE 3HTXA 2JP9A 5LMNE 1YFHA 1EH7A 4LF9E 5A6BD 5A6KA 2LV2A 1PDAA 2VRDA 2EPKX 4P78A 3LLHA 4FK5C 5IV8B 2V83A 2RS7A 4WYQB 2YRKA 1L4SA 4KWYA 1SFEA 1N3GA 4DV6E 2L92A 2EM0A 1EH8A 4N4RB 2FGGA 1YPNA 2RSIA 5AE3A 1N36E 2EORA 3MSWA 5KL3A 4WSPA 2UUCE 1QNTA 3QG5C 1PKPA 4J8ZA 5KL7A 2EN8A 2EN1A 1DGCA 1A1LA 2H36X 2LMZA 2NABA 2ADRA 5A6AA 2ELZA 4X64E 3L00A 5KL6A 1X6HA 4DV4E 2I13A 3ADLA 3KWRA 2IHR1 4HTGA 2EOSA 3VHTB 1X6FA 2MC5A 5LL6R 2ENCA 2YTIA 4IJDA 2YTDA 2LUQA 1MEYC 1N34E 4M2ZA 2EL5A 3OTOE 2LJHA 2EOMA 4I8OA 2EOOA 2BB8A 2EQ3A 4O43A 3C6MA 2EM6A 4BMJA 2PRTA 1T4OA 4B3SE 2EMBA 2MDRA 5LLQA 3OMLA 4DV5E 2DSYA 4R8OA 2YTPA 5TSEA 1UILA 4X9JA 5T6JA 4BCAA 4F2JC 5A6JA 3THOB 4BHCA 2EOEA 3JAMC 4X65E 4ZYDA 2EMYA 3EQ1A 1JK1A 4LF4E 1YZ9A 2LTSA 2EMKA 3FIGA 1A1HA 2EOJA 5IWAE 2LT7A 5KL2A 4X66E 3J7Yp 2NUFA 4NZVA 2LBSB 4JI4E 4GKJE 2YTQA 1J26A 2V87A 2EMCA 1LLMC 4BC7A 4WXCA 2JVAA 3ZOQB 4F6MA 1G2FC 2YSPA 2UUBE 2YTFA 1HNWE 2GLIA 3ECRA 3MHSC 2YZTA 4DR1E 2I9IA 2CTDA 1A1FA 2M9AA 5AE1A 4R2RA 2RSMA 2ZM6E 4X62E 1A1IA 4R2AA 2RQLA 3TQMA 2F8BA 3UK3C 4NHRA 1GTKA 3JTZA 4LF6E 2EMZA 4JI5E 2VE7C 2RPCA 2L2MA 2V8QB 3HQ1A 4ZYGA 3VK6A 3K6QA 2YRMA 2DMIA 1J5EE 4R2EA
chains in the Genus database with same CATH topology
2ODRD 2UUCE 4DUZE 1PKPA 4J8ZA 3DF6A 4Q28A 2MC6A 1RC7A 2DB2A 2VQEE 2L3CA 4DV7E 1O0WA 2KHXA 1QU6A 2NUGA 3DJWA 2H36X 4NXME 4GKKE 4OOGC 2LMZA 1X49A 2L6MA 1J5EE 3J7AG 4DR6E 4F54A 3HXLA 1IBKE 4LF7E 2LRSA 4DV1E 4X64E 2L2KB 1STUA 4BC9A 4DV4E 4NXNE 1XNQE 3ADLA 2UXDE 1DQ3A 3KWRA 2IHR1 4JI6E 4R03A 1ZBQA 4B3TE 2M4IA 2YT4A 2MC5A 5LL6R 2L3JA 4YY3E 4LU9A 3ADGA 3IWDA 4LF8E 1RQ0A 2M7QA 4DR5E 2CPNA 2V86A 2FV4B 3H09A 4B3ME 4JV5E 2LUQA 4DR2E 1N34E 2VF1A 4M2ZA 2G7HA 4JI2E 4YHHE 4JYAE 3VYYA 3OTOE 4DUYE 2LJHA 3IWBA 1DI2A 1WXRA 3J80C 4I8OA 2L33A 3LMLA 2KOUA 2ODRC 4LF5E 1YYKA 1HNXE 2UU9E 2DMYA 1X47A 2KONA 2JR1A 2L2NA 2N3HA 4DV3E 4JI1E 1N32E 2NA2A 4JI8E 3AV0A 4BMJA 4LFCE 1T4OA 3T1YE 4B3SE 2WZOA 2F4VE 4GEQB 3C4TA 5LMUE 2MDRA 3OMLA 5AE2A 4DV5E 2DSYA 3HPSA 3P1XA 4R8OA 1GZ6A 3JU0A 1UILA 4M30A 4DKKA 1XMOE 4WFTA 4TUGA 5T6JA 2V89A 4BCAA 1HR0E 1XNRE 4F9BB 2LE2A 2NUEA 2B9DA 2DIXA 5F3WA 1YYWA 3JAMC 4X65E 4LFBE 4B3RE 3F6HA 4DV0E 3ADJA 1T4NA 4BS9A 4LFAE 1WHNA 5CFFE 4LF4E 1YZ9A 4DR7E 2LTSA 2E5LE 3FIGA 1N33E 5IWAE 1FJGE 4M0VA 2N3GA 4AQYE 4P7DA 4DV2E 2B3TB 2RTXA 4X66E 5BR8E 3T1HE 2EWLA 1I94E 1EKZA 4KHPE 1X48A 2LTRA 3J7Yp 4DMIA 1WHQA 2B7TA 3IWCA 2LBSB 2V85A 2NUFA 2UUAE 5FLXC 1FKAE 4JI4E 4GKJE 2UXBE 1SR9A 5AASA 2V88A 2V87A 1J26A 1UHZA 4X8WA 2E1MA 4JI3E 4L8NA 2B7VA 2JY9A 4BC7A 2EZ6A 2K4VA 2JVAA 1HNZE 3HTXA 3ZOQB 5LMNE 3RMPA 1GQEA 4LTYA 2M1SA 4WPYA 2HHHE 3F6GA 2UUBE 1HNWE 4LF9E 1XMQE 2YZTA 1ZBTA 4DR1E 3AUZA 3VYXA 4P78A 5AE1A 2JOXA 2RSMA 3LLHA 2V83A 4F9AB 2RS7A 2ZM6E 4WYQB 4X62E 4KZSA 5A2QC 2VQFE 5ADZA 3J81C 4JI7E 4OX9E 2LUPB 2F8BA 4K0KE 1T4LB 1IBLE 4DV6E 3ADIA 2L92A 3JTZA 4BBYA 4F9CB 4LF6E 2FTXB 2L8TA 3HPZA 4JI5E 4TUIA 2UXCE 2FGGA 1IBME 4DR4E 2JWOA 2VE7C 4DR3E 2L2MA 2V8QB 5AE3A 5DNYA 1YYOA 3HQ1A 1N36E 4JI0E 4L5NC 3MSWA 3C4BA 3VK6A 5IT9C 3K6QA 2JOBA 4WSPA 2RS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC E;  4DUZ E;  1PKP A;  1RC7 A;  2DB2 A;  2VQE E;  2L3C A;  4DV7 E;  1O0W A;  2KHX A;  1QU6 A;  2NUG A;  4NXM E;  4GKK E;  4OOG C;  1X49 A;  1J5E E;  4DR6 E;  1IBK E;  2LRS A;  4DV1 E;  4X64 E;  2L2K B;  1STU A;  4DV4 E;  4NXN E;  1XNQ E;  3ADL A;  2UXD E;  2IHR 1;  4JI6 E;  4B3T E;  2YT4 A;  2L3J A;  4LF8 E;  4YY3 E;  3ADG A;  1RQ0 A;  4DR5 E;  2CPN A;  4JV5 E;  4B3M E;  2LUQ A;  4DR2 E;  1N34 E;  4M2Z A;  4JI2 E;  4YHH E;  4JYA E;  3VYY A;  3OTO E;  4DUY E;  2LJH A;  1DI2 A;  2L33 A;  4LF5 E;  1YYK A;  1HNX E;  2UU9 E;  2DMY A;  1X47 A;  4JI1 E;  2L2N A;  2N3H A;  4DV3 E;  1N32 E;  2NA2 A;  4JI8 E;  4LFC E;  1T4O A;  3T1Y E;  4B3S E;  2F4V E;  3C4T A;  5LMU E;  2MDR A;  4DV5 E;  3P1X A;  1UIL A;  4M30 A;  4DKK A;  1XMO E;  4WFT A;  1XNR E;  1HR0 E;  2NUE A;  2DIX A;  1YYW A;  4X65 E;  4LFB E;  4B3R E;  4DV0 E;  3ADJ A;  1T4N A;  4LFA E;  1WHN A;  5CFF E;  4LF4 E;  1YZ9 A;  4DR7 E;  2LTS A;  2E5L E;  1N33 E;  5IWA E;  1FJG E;  2N3G A;  4AQY E;  4DV2 E;  1EKZ A;  2B3T B;  2RTX A;  4X66 E;  5BR8 E;  3T1H E;  1I94 E;  4KHP E;  1X48 A;  2LTR A;  3J7Y p;  2UUA E;  1WHQ A;  2B7T A;  2NUF A;  2LBS B;  4LF7 E;  1FKA E;  4JI4 E;  4GKJ E;  2UXB E;  1J26 A;  1UHZ A;  4X8W A;  4JI3 E;  2B7V A;  2JY9 A;  2EZ6 A;  2JVA A;  1HNZ E;  3HTX A;  5LMN E;  1GQE A;  2HHH E;  2UUB E;  1HNW E;  4LF9 E;  1XMQ E;  1ZBT A;  4DR1 E;  3VYX A;  3LLH A;  2RSM A;  2ZM6 E;  2RS7 A;  4WYQ B;  4X62 E;  2VQF E;  4JI7 E;  4OX9 E;  2LUP B;  4K0K E;  1T4L B;  1IBL E;  4DV6 E;  3ADI A;  4LF6 E;  4JI5 E;  2UXC E;  1IBM E;  4DR4 E;  4DR3 E;  4JI0 E;  2L2M A;  1YYO A;  1N36 E;  3C4B A;  2RS6 A; 
#chains in the Genus database with same CATH topology
 2ODR D;  1RC7 A;  2VQE E;  2YTN A;  4MLQ A;  2EPZ A;  2DLK A;  4O24 A;  2LO3 A;  3BID A;  2DRP A;  3EPK A;  4NXM E;  1YSA C;  2CT1 A;  2E72 A;  2EPN A;  4Q35 B;  1XNQ E;  2EN4 A;  1DQ3 A;  2EOZ A;  2EN7 A;  2WCC 3;  1ZBQ A;  1PJS A;  2M4I A;  2EM5 A;  2YT4 A;  1TN9 A;  2EPL X;  3KZZ A;  2CSH A;  2YTE A;  3H09 A;  4B3M E;  1X3C A;  4JV5 E;  4JI2 E;  3VYY A;  2D9H A;  2JPA A;  1DI2 A;  2ELY A;  2YWQ A;  2L33 A;  3LML A;  2KOU A;  2EE8 A;  1HNX E;  2DMY A;  2JR1 A;  2L2N A;  2N3H A;  3THN A;  2EN6 A;  2EL6 A;  2MDG A;  1TF3 A;  3P1X A;  1GZ6 A;  1ZAA C;  4WFT A;  2V89 A;  1HR0 E;  1XNR E;  4F9B B;  2NUE A;  2B9D A;  2DIX A;  1YYW A;  4LFB E;  3F6H A;  3ADJ A;  2EOH A;  4WSG A;  1WHN A;  2R76 A;  5CFF E;  2HJJ A;  2EPO A;  1N33 E;  4WXD A;  2N3G A;  4AQY E;  4DV2 E;  2B3T B;  1I94 E;  5BR8 E;  2EWL A;  2JXP A;  4KHP E;  1X48 A;  3KZY A;  2B7T A;  2EOX A;  1FKA E;  2V88 A;  1UHZ A;  2E1M A;  2EZ6 A;  2K4V A;  4LTY A;  4WPY A;  2EMF A;  2YU8 A;  4HEI A;  3AUZ A;  5IXM B;  3VYX A;  1NCS A;  2VQF E;  1ZU1 A;  5ADZ A;  2GHF A;  4OX9 E;  1IBL E;  2Q8U A;  4F6N A;  1X5W A;  2EN3 A;  4BBY A;  2FTX B;  2L8T A;  3HPZ A;  2EM3 A;  1YUI A;  2YU5 A;  4GZN C;  1IBM E;  4DR4 E;  1MGT A;  4DR3 E;  2EOI A;  1YYO A;  4R2P A;  5DNY A;  4L5N C;  2EMG A;  2RS6 A;  2EPM X;  4DUZ E;  2LCE A;  1UN6 B;  4Q28 A;  4R2S A;  2L3C A;  1O0W A;  3EPJ A;  2DLQ A;  1QU6 A;  3DJW A;  2EOQ A;  2YTO A;  4GKK E;  1X49 A;  2L6M A;  3J7A G;  4DR6 E;  1IQS A;  4F54 A;  3HXL A;  1IBK E;  2J7J A;  2L2K B;  1STU A;  4BC9 A;  1AH5 A;  4NXN E;  2EM7 A;  1X6E A;  2WBT A;  1BBO A;  4JI6 E;  2BBG A;  2L3J A;  4YY3 E;  3IWD A;  2MKD A;  3M99 B;  2CPN A;  2EM9 A;  2EPU A;  2EMW A;  2YTG A;  2G7H A;  4JYA E;  4DUY E;  3J80 C;  1YUJ A;  4BHB A;  2UU9 E;  5AC5 A;  1X47 A;  1P47 A;  4JI1 E;  1IQO A;  4DV3 E;  1N32 E;  2DGC A;  2NA2 A;  3AV0 A;  4LFC E;  2EMI A;  2EML A;  2WZO A;  5LMU E;  1UBD C;  3C6K A;  5AE2 A;  4R2D A;  3JU0 A;  2HGH A;  2EQ1 A;  1XMO E;  1BBG A;  4TUG A;  2EPR A;  4IS1 C;  2EP3 A;  2WBS A;  1T4N A;  4BS9 A;  1A1K A;  4LFA E;  2EN2 A;  4M9V C;  1IMU A;  4DR7 E;  2EM2 A;  2E5L E;  5KL5 A;  1FJG E;  4M0V A;  4P7D A;  2RTX A;  4R2C A;  3T1H E;  1NEI A;  2LTR A;  2UUA E;  4DMI A;  1T38 A;  4LF7 E;  3IWC A;  2UXB E;  1SR9 A;  2YSO A;  4JI3 E;  3BGH A;  2LVH A;  2EPP A;  3RMP A;  1GQE A;  2HHH E;  2M1S A;  3F6G A;  1XMQ E;  1ZBT A;  2EQ0 A;  2JOX A;  4F9A B;  4O5G A;  5A2Q C;  4KZS A;  5A69 A;  1TF6 A;  1JK2 A;  2EPX A;  3J81 C;  3EPH A;  4JI7 E;  2YRH A;  2LUP B;  4K0K E;  4O4K A;  1T4L B;  5KL4 A;  5A6B A;  3ADI A;  4F9C B;  1ZR9 A;  4TUI A;  2UXC E;  1PJQ A;  2N8X A;  2EL4 A;  4RH8 A;  2JWO A;  4JI0 E;  2GPI A;  2MKN A;  3C4B A;  3BBG A;  5IT9 C;  4ZYH A;  2WBU A;  2JOB A;  4MLV A;  1KJK A;  3DF6 A;  2MC6 A;  2DB2 A;  4DV7 E;  2KHX A;  2NUG A;  1G2D C;  4OOG C;  1F2I G;  2LRS A;  4DV1 E;  2UXD E;  1AAY A;  4R03 A;  4B3T E;  4LF8 E;  4LU9 A;  3ADG A;  2EPC A;  4ZYE A;  1RQ0 A;  2M7Q A;  4R2Q A;  4DR5 E;  2V86 A;  2FV4 B;  4DR2 E;  3MHH C;  2VF1 A;  2EOY A;  4YHH E;  3IWB A;  1A1G A;  1WXR A;  2ENA A;  1A1J A;  2ODR C;  4LF5 E;  1YYK A;  2A25 A;  2KON A;  4JI8 E;  2YPN A;  3T1Y E;  2F4V E;  4GEQ B;  3C4T A;  3HPS A;  4M30 A;  4DKK A;  1Z1B A;  3BF2 A;  2R1F A;  1EH6 A;  2EMX A;  2EM8 A;  2HC5 A;  2JYA A;  2LE2 A;  5F3W A;  1PJT A;  1T39 A;  1BB8 A;  2EJ4 A;  4B3R E;  4DV0 E;  2EMH A;  2EMA A;  2ENH A;  1KYQ A;  5AC4 A;  4WX9 A;  1RMD A;  1B69 A;  1WRJ A;  1EKZ A;  2YTJ A;  1WJP A;  2K7I A;  1WHQ A;  2V85 A;  5FLX C;  5AAS A;  2LJU A;  4X8W A;  4RHB B;  2EM4 A;  2EPA A;  4L8N A;  2B7V A;  2JY9 A;  3EPL A;  2EOF A;  1HNZ E;  3HTX A;  2JP9 A;  5LMN E;  1YFH A;  1EH7 A;  4LF9 E;  5A6B D;  5A6K A;  2LV2 A;  1PDA A;  2VRD A;  2EPK X;  4P78 A;  3LLH A;  4FK5 C;  5IV8 B;  2V83 A;  2RS7 A;  4WYQ B;  2YRK A;  1L4S A;  4KWY A;  1SFE A;  1N3G A;  4DV6 E;  2L92 A;  2EM0 A;  1EH8 A;  4N4R B;  2FGG A;  1YPN A;  2RSI A;  5AE3 A;  1N36 E;  2EOR A;  3MSW A;  5KL3 A;  4WSP A;  2UUC E;  1QNT A;  3QG5 C;  1PKP A;  4J8Z A;  5KL7 A;  2EN8 A;  2EN1 A;  1DGC A;  1A1L A;  2H36 X;  2LMZ A;  2NAB A;  2ADR A;  5A6A A;  2ELZ A;  4X64 E;  3L00 A;  5KL6 A;  1X6H A;  4DV4 E;  2I13 A;  3ADL A;  3KWR A;  2IHR 1;  4HTG A;  2EOS A;  3VHT B;  1X6F A;  2MC5 A;  5LL6 R;  2ENC A;  2YTI A;  4IJD A;  2YTD A;  2LUQ A;  1MEY C;  1N34 E;  4M2Z A;  2EL5 A;  3OTO E;  2LJH A;  2EOM A;  4I8O A;  2EOO A;  2BB8 A;  2EQ3 A;  4O43 A;  3C6M A;  2EM6 A;  4BMJ A;  2PRT A;  1T4O A;  4B3S E;  2EMB A;  2MDR A;  5LLQ A;  3OML A;  4DV5 E;  2DSY A;  4R8O A;  2YTP A;  5TSE A;  1UIL A;  4X9J A;  5T6J A;  4BCA A;  4F2J C;  5A6J A;  3THO B;  4BHC A;  2EOE A;  3JAM C;  4X65 E;  4ZYD A;  2EMY A;  3EQ1 A;  1JK1 A;  4LF4 E;  1YZ9 A;  2LTS A;  2EMK A;  3FIG A;  1A1H A;  2EOJ A;  5IWA E;  2LT7 A;  5KL2 A;  4X66 E;  3J7Y p;  2NUF A;  4NZV A;  2LBS B;  4JI4 E;  4GKJ E;  2YTQ A;  1J26 A;  2V87 A;  2EMC A;  1LLM C;  4BC7 A;  4WXC A;  2JVA A;  3ZOQ B;  4F6M A;  1G2F C;  2YSP A;  2UUB E;  2YTF A;  1HNW E;  2GLI A;  3ECR A;  3MHS C;  2YZT A;  4DR1 E;  2I9I A;  2CTD A;  1A1F A;  2M9A A;  5AE1 A;  4R2R A;  2RSM A;  2ZM6 E;  4X62 E;  1A1I A;  4R2A A;  2RQL A;  3TQM A;  2F8B A;  3UK3 C;  4NHR A;  1GTK A;  3JTZ A;  4LF6 E;  2EMZ A;  4JI5 E;  2VE7 C;  2RPC A;  2L2M A;  2V8Q B;  3HQ1 A;  4ZYG A;  3VK6 A;  3K6Q A;  2YRM A;  2DMI A;  1J5E E;  4R2E A; 
#chains in the Genus database with same CATH homology
 2ODR D;  2UUC E;  4DUZ E;  1PKP A;  4J8Z A;  3DF6 A;  4Q28 A;  2MC6 A;  1RC7 A;  2DB2 A;  2VQE E;  2L3C A;  4DV7 E;  1O0W A;  2KHX A;  1QU6 A;  2NUG A;  3DJW A;  2H36 X;  4NXM E;  4GKK E;  4OOG C;  2LMZ A;  1X49 A;  2L6M A;  1J5E E;  3J7A G;  4DR6 E;  4F54 A;  3HXL A;  1IBK E;  4LF7 E;  2LRS A;  4DV1 E;  4X64 E;  2L2K B;  1STU A;  4BC9 A;  4DV4 E;  4NXN E;  1XNQ E;  3ADL A;  2UXD E;  1DQ3 A;  3KWR A;  2IHR 1;  4JI6 E;  4R03 A;  1ZBQ A;  4B3T E;  2M4I A;  2YT4 A;  2MC5 A;  5LL6 R;  2L3J A;  4YY3 E;  4LU9 A;  3ADG A;  3IWD A;  4LF8 E;  1RQ0 A;  2M7Q A;  4DR5 E;  2CPN A;  2V86 A;  2FV4 B;  3H09 A;  4B3M E;  4JV5 E;  2LUQ A;  4DR2 E;  1N34 E;  2VF1 A;  4M2Z A;  2G7H A;  4JI2 E;  4YHH E;  4JYA E;  3VYY A;  3OTO E;  4DUY E;  2LJH A;  3IWB A;  1DI2 A;  1WXR A;  3J80 C;  4I8O A;  2L33 A;  3LML A;  2KOU A;  2ODR C;  4LF5 E;  1YYK A;  1HNX E;  2UU9 E;  2DMY A;  1X47 A;  2KON A;  2JR1 A;  2L2N A;  2N3H A;  4DV3 E;  4JI1 E;  1N32 E;  2NA2 A;  4JI8 E;  3AV0 A;  4BMJ A;  4LFC E;  1T4O A;  3T1Y E;  4B3S E;  2WZO A;  2F4V E;  4GEQ B;  3C4T A;  5LMU E;  2MDR A;  3OML A;  5AE2 A;  4DV5 E;  2DSY A;  3HPS A;  3P1X A;  4R8O A;  1GZ6 A;  3JU0 A;  1UIL A;  4M30 A;  4DKK A;  1XMO E;  4WFT A;  4TUG A;  5T6J A;  2V89 A;  4BCA A;  1HR0 E;  1XNR E;  4F9B B;  2LE2 A;  2NUE A;  2B9D A;  2DIX A;  5F3W A;  1YYW A;  3JAM C;  4X65 E;  4LFB E;  4B3R E;  3F6H A;  4DV0 E;  3ADJ A;  1T4N A;  4BS9 A;  4LFA E;  1WHN A;  5CFF E;  4LF4 E;  1YZ9 A;  4DR7 E;  2LTS A;  2E5L E;  3FIG A;  1N33 E;  5IWA E;  1FJG E;  4M0V A;  2N3G A;  4AQY E;  4P7D A;  4DV2 E;  2B3T B;  2RTX A;  4X66 E;  5BR8 E;  3T1H E;  2EWL A;  1I94 E;  1EKZ A;  4KHP E;  1X48 A;  2LTR A;  3J7Y p;  4DMI A;  1WHQ A;  2B7T A;  3IWC A;  2LBS B;  2V85 A;  2NUF A;  2UUA E;  5FLX C;  1FKA E;  4JI4 E;  4GKJ E;  2UXB E;  1SR9 A;  5AAS A;  2V88 A;  2V87 A;  1J26 A;  1UHZ A;  4X8W A;  2E1M A;  4JI3 E;  4L8N A;  2B7V A;  2JY9 A;  4BC7 A;  2EZ6 A;  2K4V A;  2JVA A;  1HNZ E;  3HTX A;  3ZOQ B;  5LMN E;  3RMP A;  1GQE A;  4LTY A;  2M1S A;  4WPY A;  2HHH E;  3F6G A;  2UUB E;  1HNW E;  4LF9 E;  1XMQ E;  2YZT A;  1ZBT A;  4DR1 E;  3AUZ A;  3VYX A;  4P78 A;  5AE1 A;  2JOX A;  2RSM A;  3LLH A;  2V83 A;  4F9A B;  2RS7 A;  2ZM6 E;  4WYQ B;  4X62 E;  4KZS A;  5A2Q C;  2VQF E;  5ADZ A;  3J81 C;  4JI7 E;  4OX9 E;  2LUP B;  2F8B A;  4K0K E;  1T4L B;  1IBL E;  4DV6 E;  3ADI A;  2L92 A;  3JTZ A;  4BBY A;  4F9C B;  4LF6 E;  2FTX B;  2L8T A;  3HPZ A;  4JI5 E;  4TUI A;  2UXC E;  2FGG A;  1IBM E;  4DR4 E;  2JWO A;  2VE7 C;  4DR3 E;  2L2M A;  2V8Q B;  5AE3 A;  5DNY A;  1YYO A;  3HQ1 A;  1N36 E;  4JI0 E;  4L5N C;  3MSW A;  3C4B A;  3VK6 A;  5IT9 C;  3K6Q A;  2JOB A;  4WSP A;  2RS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...