4BHBA

Crystal structure of mycobacterium tuberculosis o6-methylguanine methyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of the Mycobacterium Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
total genus 50
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhbA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhbA01
4U0WA 2EFPA 4G6QA 1T2KA 5D5VB 3K69A 5BS6A 2FF4A 4Q4ZF 2VOPA 1TQPA 1Z91A 3NQOA 4IF4A 1U8RA 2GZWA 3PFIA 3I0TA 5D8KB 3MQ0A 3ZQ7A 1SMYF 1SFEA 3C3WA 2HQRA 4UUVA 5H20A 2DTRA 1ZHFA 4KMUX 3F8MA 2VT3A 3BPXA 4HV6A 4I2OA 3MZYA 3ECOA 3V8JA 2XAHA 4L9TA 3J80K 5E1WA 4P96A 4L5IA 3D0SA 3E6BA 3DV8A 3I58A 4WXHA 5IT3A 1SFXA 1ZN2A 3KZZA 4RGSA 5ERIA 4AIKA 1IN8A 4L9VA 1BIAA 5BOXA 4I7HA 1D5VA 4CYDA 4BYYA 5LEJA 2HQNA 2GA1A 1HSTA 4HDVA 1HW5A 3BY6A 3ZP5A 2WWYA 3GVAA 2ETHA 5H6RA 1K79A 1W7PB 4CICA 3ZMSA 2R7FA 3R0JA 2OZUA 4YG2F 1ZAOA 4ZZDA 1TQMA 1SAXA 1F4KA 2EFQA 2NNNA 2AS5F 1TBXA 1U3EM 1Z6TA 1FC3A 2RKHA 2G7HA 1TW3A 3MEXA 1CGPA 1TQIA 4A5MA 1XMKA 3QU3A 4BHBA 3C7JA 2XKOA 1WRJA 2R7DA 3WTYC 2F5CA 2KIUA 1UCRA 1O3TA 3IRQA 2BGCA 1J59A 5CJ9A 5L3FA 1HKSA 3FF5A 1HXDA 2MLGA 2F2EA 3HRUA 3HRMA 4M6YA 2A6EF 4LG0A 4O5VA 1GVJA 3WGIA 1XSXA 2Z5UA 2P6TA 3WTVC 3C18A 4XLNF 1B59A 2ZKZA 2NYXA 1F5TA 2QBYB 1MJ9A 4IXAA 4FT8A 3KP4A 2QQBA 3DQVC 2JPCA 3GYHX 2DAOA 1HSJA 3KZYA 4AD9A 3T8TA 3F8NA 3V8KA 1EV7A 1MD0A 2A61A 5HOOA 3LA3A 4KT5C 1O7LA 3CUOA 5LHHA 4NHJA 2UWMA 1FBSA 3I59B 4EM0B 1QBJA 3JSOA 5DUKA 4RAYA 2Z99A 3KLNA 2BV6A 2O3FA 1KYWA 2FBHA 5DD8A 1YO5C 2VE8A 2YR2A 3EUHA 4QWQA 2J5OA 3M1EA 3TOBA 4IHTA 3HOTA 2K4JA 3T5XA 4MTDA 3AAFA 1IZ1A 2WTEA 3CO6C 5J8CA 2QM3A 1G3SA 3GW2A 1FYKA 4P5OA 1ODDA 1SD4A 2EFNA 2V1DA 4LB5A 4KFCA 5D8LB 2PJPA 5A2QK 3JTGA 2B0LA 2JPBA 3HYIA 3BDDA 1PP7U 2VE9A 3GFMA 1S29A 3DP7A 1WQ2A 4YFNF 3EYIA 1P6RA 1KA8A 1XGMA 3DPTA 5D4SA 4H0EA 3ZMTA 3GUDA 3Q5FA 2FNAA 1PUEE 2CW0F 4GXOA 2A68F 3KP7A 4RGUA 3F8BA 3RPUA 3QPHA 4M74A 1R1VA 2P5VA 3EDPA 3DFGA 3ZMVA 4WWCA 5CVIA 4TV7A 1TLHB 1RNLA 1G6NA 3I54A 1XGOA 1S7OA 1ZRCA 3V7RA 4U7BA 4YFXF 4ZYEA 1LQ1A 1QQIA 1Z9CA 1Z05A 2L02A 1KQ0A 3WTXC 2DK8A 3E6MA 3HHGA 2J5PA 3T0YA 1SFUA 3M7GA 2XRNA 5E1ZB 1BM9A 5F64A 2VC1A 4RS8A 3E6DA 2IP2A 1DDNA 2PQ8A 1XD7A 2L3DA 3OV8A 4PDKA 3ZMZA 5BPIA 2QVOA 1QZZA 4K2EA 2DQRA 2FBKA 1RIOH 2E1CA 5D4RA 3MCZA 1STZA 2F5EA 2GIVA 3JSPA 1XSVA 3R60A 5DCMA 1XGNA 2Z33A 3F23A 4MTEA 4ZH4F 3WODF 5HS8A 1YG2A 2DO7A 2CQKA 2ACJA 1BBYA 5EEHA 1J7KA 2GXBA 1HKQA 3F8FA 5TRDA 1G3YA 4EJVA 4HLYA 3WG9A 1YLFA 3O2PE 4A5NA 5K5OA 1MDMB 4A2UA 3CJNA 5CVJA 1Z1DA 4I02A 4BXUA 2NAZA 1IXRC 4ENJA 6PAXA 1DPRA 4S05A 3N97A 1FPQA 2BEOA 2IA0A 4UVBA 2KJBA 4MQVA 2LKPA 2FE3A 2RGVA 1YW8A 1B1BA 3B02A 4OU0A 1FT9A 1UB9A 2Z3YA 4EV0A 4P55A 2OD5A 3GFJA 2XV4S 2CYYA 2NNYA 4R1HA 2VC0A 1DUXC 4OIOF 5K5RA 3GX4X 1KU3A 2IW5A 4GYGA 2X0LA 3I5UA 1YW9A 4HQMA 5A2QZ 2XAFA 5JHUA 3Q9SA 5F6FA 1ZGAA 2KRFA 1FSHA 1MJBA 3BWGA 4BH9A 5LGUA 4WX9A 5EEGA 1JGSA 4JK1X 4LGWA 4LFUA 4OIRF 2RVCA 5FGMA 2VT2A 4HOBA 3TDZC 4KICA 1MZBA 4HYEA 5AIPA 4HX4A 3L2CA 2K27A 5JVTA 1I6XA 2QBYA 4HW0A 3L9FA 2XIGA 4KDPA 4CXFA 5E20A 1KU2A 1P4AA 3WU0A 1KQ8A 3KE2A 1J9IA 2D45A 2GQQA 4KN7X 1U5TC 4PGHA 2KIMA 4F7ZA 4OMZA 2EFOA 2RC4A 2L01A 5LBQA 3IWFA 4EM1A 4RB2C 2ZXJA 3DEUA 2VOOA 1FLIA 1K78A 3J81K 1I27A 2HFHA 2UZKA 2IA2A 1IN6A 4AIJA 1FBQA 5LHGA 4BHPA 5LLQA 4RB3C 5HLHA 1LVAA 3KP3A 4LLLA 2Q2EA 2VN2A 1SD6A 4Y17A 1KQ9A 4IPAA 4BQAA 5D6FA 1G4DA 1WWXA 3QP6A 3LAPA 3U9GA 5AIQA 3G3ZA 3RPQA 2IPQX 2ESHA 2O61A 1I1GA 4M9XA 3P9KA 5HLIA 3KEOA 1R1UA 4WCGA 4HF1A 4ASNA 2FNPA 5BMZA 1W5SA 3F6OA 3HSRA 4ENNA 5L3DA 2XAJA 4EGYA 4WK8F 4L0YB 5FD5A 2M5WA 3H3UA 1IN4A 1FYLA 2O8XA 2XKPA 1G3TA 4G9YA 4BHCA 1J0RA 3ABTA 2W25A 1V3FA 1X3UA 2M30A 1HQCA 2Y75A 2HKXA 2KIFA 4EJOA 3F72A 2H6BA 5HDNA 3DF8A 3LQRA 1T0FA 1LJ9A 2EJRA 3LA7A 2CO5A 4B09A 2ADUA 2MD5A 2PEXA 3HIFA 2ZMEB 5HS7A 3P7NA 4ZYGA 1USTA 3LWFA 4RB1A 3IRRA 3WTTC 4MQ9F 3WTUC 5FLXK 1B6AA 1ZRFA 5HVQC 3K2ZA 4OMYA 1ZH5A 4DQ2A 5ICGA 2HOEA 2JT1A 1TW2A 3ML6A 3FXQA 5L3BA 1GHCA 4N0BA 5FLXZ 1LNWA 2RV8A 1U2WA 2JTVA 4FX4A 1O3QA 2VODA 4YIFA 5L3EA 2YPRA 1ZARA 1D3YA 4R79A 1C0WA 4XLPF 4L9NA 2LSOA 3TO6A 4WXDA 4U0YA 4UV8A 3ZN1A 4E70A 4HQEA 2DT5A 1ON2A 1T6SA 1ULYA 3HSFA 3MAJA 1D8KA 3PQJA 2FBIA 3EQLF 3U2RA 1UHWA 4JQFA 3RTRA 4B8XA 2V1UA 1UHMA 3G73A 1NHAA 2W24A 5ICFA 2EV0A 3TGNA 3SHFA 2IT0A 1O3SA 5CVVA 1USSA 3M9AA 3BJOA 1XN7A 2DK5A 3E5QA 4YFKF 1IN7A 2ZFWA 1XCBA 2RDPA 2Y48A 1W5TA 1ZG5A 2FSWA 5HDGA 1MDMA 4DNCA 2MA3A 3W6JB 1YYVA 3KETA 3H3ZA 1R23A 3D5LA 3BJAA 2DW4A 2OU2A 4A6EA 4P9FA 4A12A 3MZHA 1SD5A 4ON0A 4KNYA 3FMRA 2HWVA 2V6CA 5JI6A 5HLGA 5DV5A 2P6SA 2DLLA 3NRVA 3WTSC 1OKRA 2CFXA 4S04A 3IKVA 3ZMDA 2Q0OA 2L4AA 5DD4A 2HYFA 2BBYA 1R5HA 4XBFA 5LGNA 3F6VA 2V1XA 4I98B 3BZ6A 5L3GA 4BNCA 2FU4A 1EH7A 5BQTA 3ULQB 2ESNA 1AOYA 5ILSA 5JFRA 1K6OA 3IKTA 1U5TB 3RKYA 4FHTA 5DYMA 3SXYA 3QRFF 4LB6B 4UHTA 2YX7A 1K7AA 2K02A 5FO5A 4Y15A 3REOA 4JBAA 2G9WA 1YS7A 3O3KA 5DDGA 2CSOA 2PI0A 2UXNA 4A0XA 1R1TA 2IA1A 4XRFA 3GXOA 4KIFA 3I71A 2MH9A 1HW2A 5TJJA 4MEXF 3HSEA 1G3WA 3KP6A 2JSCA 4Q48A 5CLSA 4OIPF 3CUQB 1T38A 2MH2A 3HTSB 2V79A 3QAHA 1Z7UA 3KP2A 1BOAA 2FA5A 1GXQA 1KU9A 5J6XA 5FFZA 3RYRA 2FMYA 3E3VA 4WXCA 2BYVE 4KUMA 5J8FA 2VBZA 4BAYA 2L4MA 3RYPA 4G8XA 2P7VB 3HOSA 2P5KA 1E17A 2KKOA 2PN6A 3ISPA 4KA4A 2D2WA 1ZGJA 1IUYA 4I0AA 3LFKA 3WGHA 1F9NA 5ICCA 2FQ3A 1YFHA 1LDKB 4EVIA 1QPMA 3K0LA 3I4PA 4UVCA 1WI9A 2DFIA 3SZTA 1EH6A 4ZYDA 3DKWA 2H09A 4PCQA 4UXNA 2PMHA 2PLYA 1S7AA 1RI7A 4KIBA 3GZ5A 4EMSA 2QYOA 2XUBA 2GA2A 4XSZF 5KVRA 1BC8C 4WF2A 2QLZA 2DBBA 1RUOA 1ZG1A 2IRFG 2HKOA 3WU1B 3B73A 4CGZA 4GYIA 2DU9A 2RQPA 1BI2A 3L09A 2LDUA 1Y0UA 5D5UB 1OYIA 4Q5SF 3K9TA 4LLNA 5CYVA 2JRTA 3TO7A 4L9JA 4ENKA 3VEPA 3P9CA 3E6CC 3CO7C 2MC3A 4GGGA 1XDUA 2VBYA 3V7SA 3K1PA 4CO8A 5ICEA 2MLKA 4GCVA 2A3SA 1GXPA 1U6GA 1IRFA 2OAZA 3N4MA 1IF1A 3RKXA 4IRHA 4EQQA 2ZBKA 1S8NA 2YX4A 4LLGF 2LNBA 3J80Z 4HZFA 2CGPA 2IVMA 3ABUA 3FXUA 3NEUA 4UNOA 3V8LA 4N9HA 4OIQF 1FNNA 1VTNC 4U88A 4UVAA 1V4RA 3L7WA 3GWZA 2HS5A 1O3RA 4IRGA 2OA4A 4YIIA 3BJ6A 3RIRA 5E8IA 1B9MA 1R00A 3WTWC 2K86A 3F8CA 4I01A 5ILVA 4MGRA 4CZZA 3TKYA 3J81Z 2RN7A 1H9TA 1PP8F 1YTYA 4QLCU 1XB4A 2CWEA 2K7LA 2NS0A 2C6YA 3QOPA 1B9NA 1W4MA 4N9IA 4EJWA 1FY7A 3QU6A 5ILUA 3R4KA 3E5XA 1KU7A 2PBIA 1QZYA 4Q47A 3CLOA 3R0AA 3SFZA 1QGPA 1W7PA 1L0OC 1XDSA 3K1MA 5HS9A 1OMIA 3KP5A 2FMLA 3VODA 2RNJA 3K1NA 3QP5A 3HUGA 1OYYA 3WE3A 2IJLA 2P4WA 2ZJ2A 4IJAA 4HAMA 1O7FA 4ESBA 1SMTA 2E7WA 4ENMA 1B4AA 1HBXG 4U0VA 2COMA 3LQQA 1J5YA 3FM3A 1JE8A 1S3JA 2A07F 5L3CA 1FWZA 1U5TA 4Y13A 2EWNA 4HBLA 2XVCA 3CUQC 4IHSA 3GZ6A 1IRGA 2EB7A 1JXSA 3CTAA 3O6BB 1KYZA 4LG0B 1LB2A 1YS6A 2DPUA 1ZG3A 3RDIA 1XSDA 1JHFA 5IT9Z 2LF7A 4A6DA 1OPCA 5LHIA 4LK1F 3FM5A 3GFLA 2OQRA 2A5YB 3JAMZ 3RI4A 4RGRA 4M73A 3LSTA 3V4GA 2GXGA 5IT9K 1BI1A 3TOAA 1I1SA 5E18F 5LRSA 1R7JA 1IN5A 2VXZA 1TNSA 3I59A 2ELHA 3FX3A 5CVRA 2EK5A 5DUIA 4G94A 2M1BA 1W7PD 4A0YA 2YSRA 2HEOA 2DQLA 4EJTA 2OZ6A 4RGXA 3ECHA 1LEBA 3ZMUA 3FXRA 4XSXF 1REPC 2ZNZA 2FRHA 1BI0A 1L3LA 3KCCA 1CF7A 1XCVA 5HDKA 4KIGA 1BI3A 2ISZA 4HF0A 2LF8A 5K5QA 1LEAA 5E8GA 1J75A 1ON1A 3HRSA 1J2XA 3ZPLA 2DI3A 1ZYRF 4KYWA 2PG4A 2EFWA 4NB5A 3CDHA 3BPVA 2JZYA 3VFZA 3GO5A 3JAMK 4CDGA 4G7ZF 3V7CA 3VOEA 4EGZA 3I53A 4LJZF 2HTJA 4ETSA 2PMUA 2TDXA 1XGSA 3T8RA 3BP8A 4ESFA 4EJUA 1I5ZA 4UV9A 1ZLJA 5FB2A 1D8JA 3E97A 5JR3A 4I0BA 1FZPB 1PDNC 3ERED 1UFMA 2WC2A 2ISYA 3R6SA 3GLXA 4M6XA 1IXCA 5FD6A 3DXJF 5ED4A 4MNUA 1QO0D 1TTYA 3TQNA 1H0MA 1EH8A 4NQWA 3IL2A 5LEKA 2XAGA 1BC7C 4O6JA 3SZPA 2M8EA 2E1NA 2QWWA 2G7UA 1RUNA 3LAJA 2L54A 1Q1HA 4HV5A 5D5XB 2STWA 2R3SA 1WSUA 3T1BA 2D1VA 2XGXA 3WGGA 3WTZA 1T39A 2QZ8A 5DCMB 2ZMEA 1JHHA 4MHGA 1YIOA 3KFWX 1S6LA 1R22A 4GO1A 4PGGA 4I09A 3U1DA 5FFXA 1FYMA 3IHUA 4CHUA 1A04A 3H92A 3HTUA 1ZRDA 3L00A 4G7OF 1IW7F 4IVNA 2H94A 3TO9A 2A6HF 2X4HA 3WE2A 1P2FA 1QNTA 2VBXA 2H6CA 2HGCA 3FWEA 4R8HA 3KEQA 2QENA 4HX8A 1FP2A 2E7XA 4RB0A 2HR3A 3MFKA 4AIHA 1XMAA 1FSEA 4EM2A 1P4WA 5AONA 3GEZA 1DP7P 4M9SA 2OQGA 3FMSA 4L18B 5E17F 4Z2YA 2FEZA 2P8TA 3W6KB 2D1HA 5DCFA 1F1ZA 4KMFA 3FZVA 2Y0MA 2W85A 1YW7A 4LMYA 3FHZA 1TNTA 2EV6A 2QUFA 1BIBA 1MJAA 2QQAA 1BJAA 4FX0A 3C1DA 4HLXA 4D0PA 2O6GE 1DPUA 2FXAA 3IWZA 1YQAA 4M72A 1T98A 5D6EA 2XHKA 4LD5A 2YU3A 2HZTA 1OYWA 2EV5A 3TDUC 1HKTA 4AWXB 1R5GA 3P9IA 4L0ZB 2WV0A 3FMQA 1E2XA 4U7DA 3MWMA 3RJPA 2MBFA 1IAWA 3I64A 3RKWA 3ROUA 2P5LC 1FOKA 2HYGD 3KLOA 4AVPA 2A69F 2XAQA 3OOPA 1WKMA 2GAUA 2F5FA 2W84A 4HA8A 1HW1A 2OBPA 5DEQA 1K78B 4OOIA 5F1RA 3HHHA 2VBWA 4MEYF 1SD7A 3GFIA 2O03A 4ESJA 2W57A 4HF2A 3J7AO 2M87A 5LRRA 3F3XA 2CG4A 2M45A 2HTSA 2K4BA 5H6QA 1U78A 1P92A 3PQKA 1FBUA 2ZCWA 3COAC 1CF7B 1FX7A 4PZJA 4LK0F 3CUQA 2HDCA 3HRTA 4G6DA 2XROA 1O57A 3IC7A 3ELKA 2ZNYA 3QPTA 2UXXA 4P9UA 3SQNA 1ZLKA 3JW4A 1MGTA 1R58A 1OR7A 3DPLC 5BPDA 1Z6RA 1LDJA 4L5JA 4M9ZA 1H9GA 2V9VA 4G7HF 1KGSA 3F22A 2EA2A 3S2WA 1BN5A 2GWRA 2O0YA 1AWCA 5K1YA 2QQ9A 1IXSB 3LA2A 4RAZA 2NRAC 2PFBA 5D5WB 4M71A 3GF2A 2EA4A 1ZREA 3EETA 2DPDA 4IRIA 2BE5F 2XASA 2P7CB 1ONVA 1R36A 5E1XA 5KK1A 4HDUA 2KJCA 4ZZLA 3F21A 2Q8KA 3BOQA 2STTA 3JTHA 4ZYHA 2Z9OA 3BROA 3ZN0A 1FP1D 2FOKA 3R61A 1MKMA 4KN4X 5LGTA 3Q9VA 3E5UA 3VB2A 2AXLA 1RZ4A 2VONA 4O3MA 3M8FA 4A0ZA 5CVUA 3M8EA 1P4XA 1LDDA 2H27A 4HX7A 2F5DA 4OINF 2ZO4A 3EYYA
chains in the Genus database with same CATH superfamily
4U0WA 2EFPA 3BR3A 2BBGA 2D9HA 3CC7I 2LCEA 3GCMA 3HOZJ 1OJLA 4XLAA 4G6QA 1T2KA 2EOIA 2L9SA 1YJNI 2O5RA 3ABMH 5D5VB 4OOGC 3K69A 4D1QA 2F4OB 5BS6A 1JUSA 2FF4A 4Q4ZF 2VOPA 2Y0SA 2QSFX 1TQPA 1Z91A 3LNQA 3IWDA 3NQOA 4R2DA 4C3JJ 4IF4A 1U8RA 2GZWA 4BU2A 5C44J 1U0JA 3F6GA 3PFIA 1MMDA 2RPCA 3K70D 3I0TA 5D8KB 3MQ0A 4BEHA 2DOAA 3ZQ7A 1SMYF 1X3ZB 1SFEA 3D1NI 2UUBE 3C3WA 1FKAE 2HQRA 2CT1A 4X1EA 4DR6E 1X3WB 4UUVA 5H20A 4XRMA 3OYJA 5LFAA 1OCTC 2DTRA 1D5YA 2HNHA 5ADZA 1Z1BA 1ZHFA 2M7BA 4KMUX 5JVGF 4DV5E 3F8MA 2VT3A 4GKJE 1FTZA 4JP0A 3VYXA 3JU0A 4R8OA 3BPXA 2HPIA 2FUG2 4HV6A 4E7ZA 5EGOB 4FK5C 4IKFA 4XKBA 4QTRA 3J7AY 2Y9ZA 2Z2SB 4XOPA 2VJIA 2D5VA 4YHHE 2WY7Q 4BQQA 3IH4A 4S0HB 4AYBA 4I2OA 3MZYA 2HOSA 3FXOA 2OJED 2EPUA 1ACIA 3ECOA 3V8JA 4NC8A 2XAHA 3CP8A 1YJWI 2EMAA 3AKZA 2KRCA 4DYCA 3D5RC 2VQLA 4L9TA 3J80K 3OS2A 1T56A 4WSGA 5E1WA 2OCCH 1L4SA 4P96A 4L5IA 1DU0A 1J26A 3D0SA 5LMNE 2NOJB 3E6BA 3DV8A 4JI7E 3I58A 2W1OA 4WXHA 5IT3A 5J1RA 5B1AH 5DM6F 1SFXA 1ZN2A 3KZZA 4RGSA 2EOSA 5ERIA 4AIKA 1IN8A 2LFBA 4HEIA 5IWAE 4UUSB 2LBFA 4L9VA 1QPIA 1MH3A 1BIAA 3U1KA 5EG0B 5BOXA 1PDAA 1I50J 3KYDB 4HEA2 4I7HA 3M1CA 2P0WA 4X66E 1D5VA 4F9BB 4CYDA 4DYQA 2L9NA 3H9GA 2HQNA 4BYYA 3LSHA 5LEJA 2GA1A 1HSTA 2KLOA 4HDVA 4I8OA 3IAS2 2VJ4A 1APLC 1A6QA 2QSGX 2M0MA 2WAEA 1HW5A 1LFBA 5FROA 3BY6A 2L92A 2Y30A 3ZP5A 1O4XA 3JRFA 3GTJJ 2EPLX 2BB8A 2WWYA 3E0JB 3GVAA 1GQEA 1A5JA 2YTPA 3S8PA 4BE1A 2ETHA 3AFHA 2VKHA 5H6RA 4KHPE 1K79A 1W36C 1W7PB 1W1WE 4CICA 3ZMSA 4DZPA 2R7FA 3HOXJ 3R0JA 3VSLA 2OZUA 2EINH 2EM9A 3SDBA 3GTGJ 2M7QA 4YG2F 3FKJA 1A1LA 3DKYA 5GADJ 3BC8A 1ZAOA 1XS9A 2KZVA 3I4MJ 5EEAA 2EZHA 4ZZDA 1TQMA 2DGCA 1SAXA 1F4KA 4E7HA 4F9CB 2WBSA 2EFQA 2QQ8A 2NNNA 3HUGB 1JTXA 2EIJH 2AS5F 1TBXA 1U3EM 3CD6I 1FIAA 3OTOE 5IY5H 3IUOA 4FETA 3H5RA 1Z6TA 4ZDOA 1FC3A 2EMCA 2RKHA 4E7IA 2EM5A 1XMQE 2G7HA 3QG5C 3A0BC 1TW3A 4ZDLA 3MEXA 1CGPA 1TQIA 4A5MA 1XMKA 3CMYA 3QU3A 4BHBA 4KITB 4DV4E 2XRLA 3C7JA 2XKOA 3CZ6A 1UJ8A 2E2IJ 4Y52J 1DQ3A 1WRJA 2EMFA 2R7DA 3WTYC 2F5CA 2KIUA 1UCRA 2EM7A 1O3TA 3IRQA 2MKDA 2BGCA 1J59A 5CJ9A 1JGGA 2UXDE 4D5CA 5L3FA 3RZOJ 2R76A 2JOBA 3SFIA 1JJ6C 1HKSA 1UZCA 1STUA 3FF5A 4XK4A 2BHZA 4DV3E 1HXDA 1XPXA 2MLGA 4BC9A 2F2EA 3HRUA 1IUFA 4BQNA 5A6JA 1VQ8I 3HRMA 4A3BJ 4LTYA 1XNRE 4M6YA 3H9QA 2A6EF 5CQEA 4DR5E 2DJNA 3JREA 3K2AA 4LG0A 4O5VA 3EPLA 1GVJA 3WGIA 1EJ9A 5A6KA 1XSXA 2Z5UA 2P6TA 1IJWC 3WTVC 1MBJA 4CCMA 3C18A 4XLNF 2WCC3 1HDDC 4DUZE 2ADRA 3ZOBA 1Y8QB 1B59A 2ZKZA 2NYXA 1W0TA 1F5TA 1LE8A 2QBYB 1MJ9A 3JCUC 5LD2C 4IXAA 3BR6A 1HNXE 2M9HA 4FT8A 3KP4A 2QQBA 3DQVC 5KHDA 2JPCA 3GYHX 2DAOA 4RM2A 1HSJA 5DM7F 3J7YJ 2OTLI 2EOYA 3KZYA 4II2A 4AD9A 2IS2A 3T8TA 5KL2A 3F8NA 2GPIA 3V8KA 1EV7A 1MD0A 2A61A 2AHQA 4Y7NJ 4OX9E 4PFPA 5HOOA 3C4TA 3LA3A 4KT5C 1OQYA 2VRDA 4XL9A 3I55I 1O7LA 3CUOA 5LHHA 2OPTA 2M8GX 4NHJA 1RETA 4A3DJ 4MIMA 1HA8A 2L2OA 4N4OB 2UWMA 1FBSA 3I59B 1SC7A 4EM0B 1QBJA 2WBUA 3JSOA 1VZ0A 5DUKA 1F43A 4RAYA 2Z99A 3KLNA 1LPQA 2GIZA 2BV6A 4XLEA 2O3FA 1KYWA 2FBHA 3K4NA 5DD8A 5FKNA 3QYBA 3AV0A 5A6BD 2I13A 3RMPA 1YO5C 2VE8A 2YR2A 3EUHA 1AA7A 4QWQA 1TWHJ 2J5OA 2XF5A 4HNTA 3MKZA 3MKWB 3M1EA 4FQGA 4PK4A 3TOBA 4IHTA 2EOJA 3HOTA 5IT9C 2K4JA 2Y31A 1N32E 1QU6A 2JXPA 3RQ4A 2M1SA 1GV5A 4E6KG 3T5XA 4XN3A 3MKYB 4MTDA 3AAFA 4F54A 2N8GA 1IZ1A 3LMMA 2WTEA 3CO6C 2CSHA 5J8CA 2QM3A 1X6HA 2B7VA 3G4SI 1IDZA 4FTHA 1G3SA 2EIKH 2EQ0A 3GW2A 1WH5A 4BS9A 3OOUA 4AVZA 2NVTJ 2EL6A 4M6VA 2JMWA 1FYKA 3B6CA 5J3LA 4P5OA 3VPRA 2EMKA 1GVDA 2KOUA 3DTIA 4D5FA 3C2BA 1ODDA 1SD4A 2PJRB 2EFNA 2V1DA 4P78A 3THOB 2M34A 4LB5A 4KFCA 1Y8RB 2EMXA 5D8LB 2PJPA 5A2QK 1K61A 2EOHA 4X64E 3JTGA 2KHXA 2B0LA 4L5NC 3BZKA 2JPBA 3HYIA 1MMAA 3BDDA 1PP7U 2VE9A 3GFMA 1S29A 2VB6A 3DP7A 2A25A 1WQ2A 4YFNF 5F27A 2KONA 2KPMA 2X1EA 3EYIA 2JY9A 1P6RA 1KA8A 3OL3A 1FMWA 3GTPJ 1XGMA 2AQEA 1W36D 1A1JA 3DPTA 5D4SA 4H0EA 3ZMTA 4C2TA 3GUDA 3BCBA 3Q5FA 3N05A 3BR1A 2FNAA 4PJLA 3HBLA 2BY1A 3FXMA 4B3AA 2XB0X 1PUEE 1PJSA 2CW0F 4GXOA 2A68F 3KP7A 2EOFA 1K4SA 4IQ4A 2XDVA 4XKCA 4IJDA 3A02A 4RGUA 2LK2A 3OYCA 3CCUI 1OCPA 3F8BA 1EKZA 1JUMA 1F2IG 3E7LA 3RPUA 2BHYA 1ERDA 2DFHA 3QPHA 4M74A 1R1VA 2P5VA 2H36X 3EDPA 3DFGA 3BG5A 1GLNA 4CYCB 4XICA 3ZMVA 4WWCA 2EPPA 4JI5E 5CVIA 4TV7A 1TLHB 1RNLA 2XF7A 4C9YA 1JKRC 4JI6E 1G6NA 3D5SC 3I54A 1XGOA 2E60A 4RBOA 1S7OA 3DEEA 4LITA 1ZRCA 3V7RA 2EMHA 5IXMB 2LUQA 1WCMJ 5J4YA 4BMJA 2LVHA 4U7BA 4YFXF 4ZYEA 1LQ1A 3SZGA 3BQYA 4U87A 2V89A 1ZKGA 1QQIA 1Z9CA 1Z21A 1Z05A 2L02A 3JRDA 4F55A 1KQ0A 2ZSIB 3WTXC 3JRHA 5AC5A 1XTAA 4JI1E 2DYSH 2XAUA 1WVRA 2DK8A 3PM1A 3E6MA 3PIOF 3HHGA 5T6JA 3J7Yp 2B9DA 5M3MJ 2J5PA 2KZGA 3T0YA 5J1YA 1IBLE 1SFUA 2HDDA 3UR3C 2F4IA 2Y0SN 3M7GA 2XRNA 3W2VA 5E1ZB 1BM9A 5F64A 2VC1A 4RS8A 3PIPF 3E6DA 3HDDA 2IP2A 5LL6R 1N78A 1DDNA 4BBYA 2PQ8A 1XD7A 2JK3A 3UNGC 4XLCA 2L3DA 3OV8A 4PDKA 3ZMZA 3CDIA 2ZXHA 4E7JA 5BPIA 2QEXI 2L6MA 2QVOA 3ZQGA 1QZZA 4K2EA 2DQRA 2FBKA 4XMYA 2WAQN 2XGEA 2R5ZA 2NUGA 1I3QJ 2LTPA 3PSIA 4DR1E 2LBSB 1RIOH 2E1CA 1VQPI 5D4RA 3MCZA 1STZA 3QOEA 2ODRD 4X9JA 2F5EA 2GIVA 3JSPA 1XSVA 3R60A 3LSRA 3VYRB 2LP0A 4R2PA 5IPAA 2HQ5A 1NG6A 5DCMA 2I10A 2F4MB 1XGNA 3LFUA 2EN7A 2HGHA 4ABZA 2LYCA 4RMNA 2K9QA 2Z33A 2YRKA 3F23A 3GZNB 4MTEA 4ZH4F 1D0ZA 3WODF 5HS8A 2LRDA 3IV5A 1YG2A 2RTXA 2DO7A 2F4VE 2CQKA 2UU9E 1TWAJ 1PYVA 2IGKA 2ACJA 2L3CA 4FCYA 1BBYA 5EEHA 4NC7A 1J7KA 4NUBA 3OYAA 2YT4A 4BXXJ 3ZOQB 1HLVA 5KL5A 2GXBA 1HKQA 2EPOA 2L7KA 5FKKA 2YRHA 1W5CC 3F8FA 1SVMA 4Q35B 3HPGA 4DV7E 4XKVA 2WBTA 4DIQA 5TRDA 5TGTA 1G3YA 4C30A 2CJJA 2ZXWH 4EJVA 4HLYA 4UUSA 2LBFB 3WG9A 1YLFA 4F3QA 1WJCA 2ME6A 1B72B 2EPXA 3TQMA 3GTOJ 3O2PE 4A5NA 5K5OA 1ZBQA 2ECBA 4A3CJ 3OMLA 3RSNA 1MDMB 4A2UA 4BE0A 3CJNA 1AH5A 2BY3A 2R7OA 5CVJA 2XGCA 1DGRM 3SDGA 3Q0UA 4XRSA 1Z1DA 3HOWJ 4I02A 4X6AJ 5C4XJ 1E0EA 4BXUA 2HC5A 4DGWB 2DODA 2NAZA 2EN3A 3RPUD 1IXRC 2KFDA 4ENJA 6PAXA 1DPRA 4S05A 3N97A 3CLQA 1FPQA 2BEOA 3H1CA 3ADGA 2IA0A 4UVBA 2MC4A 2M4KA 5A6AA 2KJBA 3DWLE 4MQVA 3X2QH 2LKPA 2FE3A 2RGVA 1YW8A 3H36A 2HPMA 3BLYA 1X47A 1B1BA 2CUEA 4IQJA 2FV4B 3VDXA 2E2JJ 1VQ7I 3B02A 4OU0A 1FT9A 4DV6E 2EPMX 2FGGA 1UB9A 5HLTA 2HVSA 2Z3YA 4EV0A 1BBOA 2X1DA 4P55A 2CV2A 3FISA 2ID6A 2JPAA 2MGQA 5GTIC 1RPWA 2OD5A 1QZEA 3GFJA 2XV4S 2CYYA 1I94E 1BR1A 2NNYA 3MZ8A 2VC0A 4R1HA 4AC0A 1DUXC 1IRZA 3O8HA 4BACA 4OIOF 2LKXA 1E3HA 3PUBA 5K5RA 3GX4X 1KU3A 2DA1A 3EPZA 5B1BH 3SEQA 5IOZA 2M4GA 2IW5A 4LIVA 3H0GJ 4F6NA 4DUYE 2JWOA 3RQIA 2L3JA 4KWYA 4LFAE 4BJTA 4GYGA 2CMPA 2RSIA 1MNDA 3HPHA 1H88C 2LMZA 2W4SA 1FIPA 5F04A 3ZR8X 4X8WA 2R7RA 2X0LA 3T1HE 2E2HJ 2KRHA 3I5UA 2YTQA 1YW9A 1QA6A 4PFOA 2LG4A 2VQGA 4HQMA 4E4HA 5A2QZ 2XAFA 4D7NA 1NK2P 5JHUA 4R2RA 3Q9SA 1N25A 2F8BA 5F6FA 1ZGAA 2KRFA 1FSHA 2HZDA 2YPNA 1SR9A 1MJBA 3BWGA 2R7TA 4BH9A 2VIXA 2DCEA 1QVUA 5LGUA 4WX9A 2V88A 5EEGA 2QKLB 3S1MJ 4PJJA 1WJPA 1JGSA 4JK1X 3TP3A 1YOVB 2DA2A 4LGWA 4LFUA 4OIRF 3GTMJ 4DR4E 2RVCA 5FGMA 2VT2A 3PNTA 3HM5A 4HOBA 5IP9J 3TDZC 4ANJA 1MMGA 4KICA 1MZBA 4HYEA 5AIPA 4HX4A 3L2CA 2K27A 2VL8A 2V9PA 5JVTA 1I6XA 1SVOA 2QBYA 3BR5A 4EEFG 4HW0A 3JRCA 3CMEI 3L9FA 2EM2A 4DV2E 1S7EA 2XIGA 2V26A 2E5NA 4KDPA 4CXFA 2R92J 5E20A 2B7TA 1KU2A 2XB5A 4C3IJ 4BBSJ 4O4KA 1P4AA 3WU0A 1KQ8A 3KE2A 4M3EA 1J9IA 2D45A 2GQQA 4KN7X 1U5TC 3CCVI 4PGHA 2EMWA 2KIMA 4F7ZA 5GPCA 4YRVA 5EYRA 4PSXA 3DTKA 2O7OA 1MBHA 4OMZA 3W3CA 2EFOA 2RC4A 2L01A 5LBQA 3IWFA 2Y69H 5KAFC 2LTRA 3NARA 3S3MA 4B3RE 3JTZA 4EM1A 4RB2C 3BZCA 2ZXJA 3DEUA 1ETYA 2VOOA 4QIWN 4BY7J 3S1RJ 4AUXA 1FLIA 2R1FA 4XIDA 4LF9E 1K78A 3J81K 1I27A 4ITVA 5M5WJ 2K9LA 2HFHA 2UZKA 5F0FA 3VSKA 2EM0A 1XX5A 2IA2A 1SVLA 1IN6A 4AIJA 2DA5A 4LFBE 5EZGA 2CV1A 1FBQA 1HDPA 4ZJZA 5LHGA 1B8IA 4BHPA 2EH3A 5LLQA 1X1PA 4RB3C 5HLHA 3PL8A 1R6RA 2J7JA 1IC8A 4JI4E 2R0QC 1LVAA 2G0EA 3KP3A 5FRNA 1X6EA 4LLLA 2Q2EA 3CC4I 2EN2A 2EOOA 2VN2A 3FKIJ 2XC7A 2LTSA 3OY9A 4I6ZA 1SD6A 4Y17A 1KQ9A 1YRNA 3C2GA 4IPAA 1RR8C 1DP3A 4O24A 4BQAA 1UBDC 2GLIA 5D6FA 1G4DA 1WWXA 1IMUA 3QP6A 2ZJQF 1TZLA 2KT0A 3ABLH 3LAPA 3U9GA 1ZR4A 5AIQA 1MBGA 2K9SA 5HNFA 2PJRA 1P47A 4HSRA 3G3ZA 2IGOA 5J4VA 2HVRA 3RPQA 4BCAA 4R2AA 3JRAA 2IPQX 1FOWA 2ESHA 2O61A 1I1GA 4M9XA 3RKQA 4UUTA 2BVMA 3S3OA 2R7XA 3P9KA 4XNFA 5EF6A 5HLIA 3OYGA 2LY1A 2W82A 2QCOA 1R1UA 3KEOA 4WCGA 4IX7A 4ASNA 4E7LA 4HF1A 4F2JC 4B44A 3OYBA 3OSFA 2FNPA 5BMZA 1W5SA 1YX3A 3F6OA 4UB6C 3HSRA 3HQ1A 4ENNA 5L3DA 2XAJA 1N33E 3FXLA 4EGYA 4L5EA 2KMUA 4WK8F 3DLAA 4L0YB 4KJZA 5FKLA 2DA4A 4E7KA 3NWTA 4FISA 2EQ1A 2YTNA 1WHQA 3A01B 5FD5A 3DPUA 4F91B 2M5WA 1WJFA 2EQRA 2DT6A 3K7AJ 2DLKA 3H3UA 1IN4A 3OIQA 1ZBTA 1ETXA 1FYLA 4DYRA 5K7HA 2O8XA 2XKPA 1G3TA 4G9YA 5FKOA 3OYNA 4CUGA 1AKHB 4BHCA 1J0RA 3ABTA 2W25A 1V3FA 1X3UA 2M30A 1HQCA 3Q3SA 4LU9A 2Y75A 4RAFA 2HKXA 2KIFA 3WU2C 2HHHE 3I56I 4EJOA 3OMYA 3F72A 1A1HA 2H6BA 5HDNA 3DF8A 3LQRA 1T0FA 2PX9A 2ENHA 1LJ9A 1R5ID 2EJRA 2CO5A 3G1LA 3LA7A 4B09A 2LT7A 4XORA 2ADUA 2MD5A 2PEXA 2X6XA 2ZMEB 3HIFA 2WB1N 4DZJA 5HS7A 3P7NA 4ZYGA 1USTA 1MW7A 2K9MA 3LWFA 4RB1A 3IRRA 1YYWA 2KP6A 4JV5E 3BG7A 2EBIA 4W97A 2LVSA 4MQ9F 3WTTC 3WTUC 1VQ4I 1VQ5I 5FLXK 3PSFA 1BA5A 4G12A 1B6AA 2B3TB 1JT0A 1XMOE 1ZRFA 4A69C 5HVQC 1Z3XA 1IDYA 3K2ZA 4K0KE 4OMYA 1ZH5A 4DQ2A 2E5ZA 2HOEA 2JT1A 5ICGA 4N4RB 1TW2A 2FD5A 3ML6A 2DMYA 3FXQA 1YE9A 2EZKA 3HC7A 5L3BA 1GHCA 3NAUA 3L2VA 1U8BA 1OISA 4N0BA 5FLXZ 4O5GA 1LNWA 3ZCOA 2RV8A 4R2EA 2DA3A 3H3VK 5H2FC 1U2WA 2DSYA 2JTVA 4LF6E 4FX4A 1T95A 1O3QA 2VODA 4YIFA 5L3EA 3ADIA 2YPRA 1A1IA 1ZARA 1D3YA 4R79A 1C0WA 4XLPF 1RC9A 2ECCA 4L9NA 2LSOA 3TO6A 4WXDA 4U0YA 4UV8A 4R2QA 3ZN1A 4E70A 4HQEA 3TP0A 3ADJA 4A93J 4RLFA 2ELYA 2DT5A 1VFCA 3ZQIA 2R5ZB 2YZTA 1ON2A 1T6SA 5GAGJ 1ULYA 3K6GA 4BQOA 3HSFA 2EMIA 3MAJA 1LFUP 1D8KA 2E1OA 3S14J 2DA6A 3PQJA 2FBIA 2JWTA 2EE8A 1A36A 2DMNA 2MSYA 2WZOA 5M5YJ 3EQLF 3U2RA 1N75A 1UHWA 4JQFA 3RTRA 4B8XA 2MFZA 3DU5A 2HXOA 3RCOA 1UELB 3ZQLA 2V1UA 1TWGJ 3CF2A 2NUFA 1UHMA 1V5FA 3G73A 1NHAA 1JUPA 2W24A 2EV0A 5ICFA 4D9JA 3TGNA 3HTXA 2EILH 2L9VA 4ZYAA 4CSWA 3SHFA 2IT0A 1O3SA 2IS6A 2EMBA 5CVVA 1USSA 2NXNB 3M9AA 2YU5A 3BJOA 1YHQI 4DV1E 1XN7A 2DK5A 3E5QA 4BEHB 4YFKF 2NVQJ 1KYQA 2DMQA 4H4KC 2TCTA 1VQKI 1IN7A 2YS9A 2ZFWA 3KYLA 2BY2A 4XQFA 1XCBA 2RDPA 2Y48A 1W5TA 1ZG5A 1GDTA 2DMPA 5CQGA 2FSWA 1R9TJ 2VUMJ 1PJQA 5HDGA 2YTEA 1I39A 2E19A 4DNCA 5EZHA 1MDMA 2MA3A 1NEIA 5IP6A 2YTIA 3W6JB 1YYVA 4X0GA 1IV6A 2ID3A 2EZ6A 2VJJA 1T0FC 2F5VA 3KETA 2VQEE 3H3ZA 3FIWA 1R23A 2JSPA 3C6MA 3D5LA 3BJAA 3BIDA 2E5LE 2DW4A 4P1WA 4V2FA 2OU2A 5FKMA 3OL4A 4NNJA 4A6EA 4P9FA 4A3FJ 4A12A 3MZHA 1PUFB 1SD5A 2ZJRF 1JJ8C 3GTKJ 4ON0A 2GHFA 5LMUE 4KNYA 3FMRA 1XMXA 1A1KA 4TUIA 2HWVA 2EIMH 2DA7A 2V6CA 3K4BA 5JI6A 5HLGA 5DV5A 1YI2I 3MHHC 2P6SA 1Z3YA 2L2NA 2GBYA 1KJKA 2DLLA 3NRVA 3I3LA 3WTSC 3OWTA 1OKRA 2CFXA 4S04A 2ODRC 3IKVA 3ZMDA 2Q0OA 2L4AA 2GM4A 5DD4A 1YX5A 4WFTA 2HYFA 2BBYA 3J7AG 1R5HA 4XBFA 1MIJA 3K4CA 4BJ5C 5LGNA 3F6VA 4M3FA 1A1FA 1YUJA 3TEDA 2DT7B 2V1XA 4I98B 2R7QA 3BZ6A 3Q0VA 5L3GA 3L2QA 3W2AA 1ZAAC 2CW8A 3IH3A 3ECRA 4BNCA 2K3FA 2DFEA 4AU7A 1N3GA 2FU4A 5IYBJ 1EH7A 5BQTA 3ULQB 3S1QJ 2ESNA 3BTLA 2ZJPF 2VI6A 2E72A 4D7MA 5ILSA 1AOYA 5JFRA 1K6OA 3IKTA 5FJ8J 1U5TB 3RKYA 4HNVA 4FHTA 2UUAE 5DYMA 3CCLI 2P81A 3SXYA 2VASA 3W2WA 3QRFF 4LB6B 1ZTRA 4UHTA 3U21A 1H8AC 2L9RA 4IS1C 2YX7A 1FEXA 1K7AA 4B3TE 3HPZA 3ZGKA 2K02A 5FO5A 4Y15A 4HSTA 1HOMA 3REOA 1T4LB 2H8RA 1MBFA 5GTHC 2YSOA 4JBAA 2G9WA 5FLXC 1DI2A 1YS7A 3O3KA 1R71A 3S15J 2LV2A 4KZSA 2RS7A 5DDGA 2ZB9A 1ZGWA 1IG7A 4JOMA 2CSOA 1JI8A 2PI0A 4DOZA 3FXKA 4M9VC 2UXNA 4A0XA 1X58A 2QF7A 3KEYA 1YITI 1R1TA 2IA1A 3MN2A 4XRFA 3GXOA 4JX5A 2DN0A 2MH9A 3I71A 4KIFA 5TJJA 1HW2A 2EPAA 4MEXF 5E3OA 2ENCA 2F48A 1G8XA 3HSEA 4F9AB 5FLVA 1G3WA 3KP6A 1R4NB 3QODA 3BBGA 2JSCA 3E1SA 1WJAA 4Q48A 5CLSA 4WYQB 1UN6B 4OIPF 3CUQB 1T38A 5F0HA 1K4TA 3NWSA 2CFOA 2MH2A 3HTSB 2V79A 3QAHA 3W6VA 3K4MA 1QRYA 1Z7UA 3HGYA 3M07A 4UB8C 1WFXA 3M3YJ 4HPQA 2YSPA 3KP2A 2LR8A 1BOAA 2FA5A 1GXQA 2IEKA 2JQ7A 2WV1A 1IV8A 1KU9A 5HODA 5J6XA 4RH8A 5FFZA 2W7NA 1SFKA 1LLMC 3RYRA 1ORKA 2FMYA 1Z7LA 2M0CA 3E3VA 4WXCA 2BYVE 2FJ1A 4KUMA 5J8FA 2VBZA 4BAYA 1RR7A 2VE7C 2LREA 4IO9F 2BVLA 4Y33A 2L4MA 3RYPA 2GLOA 4L8NA 2BXZA 4G8XA 2XPWA 1JT6A 2P7VB 3HOSA 3S2HJ 2P5KA 1E17A 3BG3A 2KKOA 1VQLI 2PN6A 3ISPA 4KA4A 2VJ5A 2QGUA 1NH3A 3S2DJ 4NZVA 2D2WA 1ZGJA 2JUGA 5KCMA 1IUYA 3BQZA 4I0AA 3VYSB 4PJ0C 4NBQA 3ASNH 2DJIA 4ZTFA 3LFKA 1ITYA 1YRNB 2EP3A 3DJWA 4QPOA 3WGHA 1F9NA 5ICCA 3A4CA 2FQ3A 1YFHA 2WAFA 3MVPA 4BC7A 1LDKB 3F9KA 2LMDA 4EVIA 1QPMA 4JI8E 3K0LA 2BY0A 1X2NA 3I4PA 3CMMA 3CJTB 4UVCA 3SYTA 1N77A 1WI9A 2CQ7A 2DFIA 3SZTA 1EH6A 3HL2A 3J80C 1B69A 3VK6A 3BTJA 4ZYDA 2EM4A 2DOFA 1FMVA 1Y39A 5E3LA 4IHXA 5FLMJ 2EN1A 2E1MA 3DKWA 2H09A 1D1CA 4PCQA 3A1YA 1KONA 3EUAA 4UXNA 3OYIA 3KYCB 2PMHA 2PLYA 1S7AA 1RI7A 4KIBA 3GZ5A 4EMSA 2QYOA 2HYJA 3ESWB 2XUBA 5JHFA 2R7UA 1X5WA 1WGXA 2GA2A 4XSZF 5KVRA 3H0DA 1SANA 1BC8C 1GUUA 3UK3C 4WF2A 2CQXA 4GFBA 2QLZA 1Y6IA 2DBBA 2R93J 1RUOA 1ZG1A 2IRFG 2HKOA 3S1NJ 2DFFA 4YEJA 3WU1B 3B73A 4CGZA 2COBA 3LSJA 4GYIA 1ETKA 2DU9A 2KDZA 4A3GJ 2WBMA 2CTDA 3PFYA 1LKXA 2RQPA 1BI2A 1J5EE 1V55H 2MG4A 1P9QC 2XPUA 3A2KA 2L33A 5KAIC 3L09A 2EN8A 4W1UA 2LDUA 1YJ9I 1Y0UA 5D5UB 2R5YB 1OYIA 4Q5SF 3K9TA 2OTJI 1ZR2A 1AKHA 4LLNA 4DR7E 2ELZA 5CYVA 2MDRA 2E36A 2JRTA 1X4PA 3TO7A 3AG4H 3TL4X 3M4OJ 1FJGE 4BXFA 2IGNA 5B3SH 4L9JA 2MDGA 2EOXA 1UAAA 1Z77A 4ENKA 2ZSHB 3VEPA 3EPJA 2EQ3A 1QVTA 1OFCX 2HJJA 3S16J 2JR1A 3P9CA 3E6CC 3CO7C 3EQ1A 3C2HA 3I4NJ 4E7SA 1WHUA 1D1BA 1DGWY 2MW8A 2MC3A 2XSDC 4GGGA 3BR2A 1XDUA 2HOAA 2VBYA 3V7SA 4A3JJ 1E3OC 4FE7A 3K1PA 1X1CA 4CO8A 5IYCJ 5ICEA 2MLKA 2WA0A 4GCVA 4NQWB 2LLKA 2EPNA 2A3SA 1GXPA 1U6GA 2ELKA 1IRFA 5J47A 2OAZA 3N4MA 1IF1A 3RKXA 4IRHA 4EQQA 1MSEC 1SAUA 2ZBKA 4FE4A 1RQ0A 1GTKA 3HKZN 5C3EJ 1WZ2A 2V8QB 1S8NA 1ENHA 2YX4A 5KNLA 2YTGA 1LUJB 1VQNI 4LLGF 2LNBA 1T8IA 2NVXJ 2OC6A 4HTGA 1VF9A 5E3MA 4LOCA 3J80Z 1LVKA 3H5AA 4HZFA 3OYLA 2CGPA 2IVMA 2L2KB 3ABUA 3FXUA 2NOGA 3NEUA 1Y1WJ 4UNOA 4JX6A 1Z0XA 3V8LA 4J19A 4F93B 1SFOJ 4O43A 4N9HA 4CYCA 2EN4A 4OIQF 3VYTB 1FNNA 3FDYA 1VTNC 1T4OA 4GDFA 4U88A 4CCKA 1VNDA 4DJAA 4UVAA 1TWFJ 2MD0A 1V4RA 3L7WA 2R7ZJ 2X6WA 3GWZA 4CH7A 2HS5A 1O3RA 2V83A 4NXME 1TT5B 1V5GA 2M2EA 4IRGA 2OA4A 3CJRB 4XONA 4YIIA 5B66C 2GXAA 3BJ6A 3OYKA 4KISA 3RIRA 5E8IA 1B9MA 1R00A 4RM3A 2YU8A 3TMOA 2K86A 2V4JC 3WTWC 2BOLA 4IHYA 1BR4A 3F8CA 2H8WA 4I01A 5ILVA 4MGRA 2V6EA 5GAEJ 2CW7A 3PUFA 4CZZA 2V1NA 4Y4RA 3TKYA 3SJMA 1UILA 3J81Z 2RN7A 1H9TA 3HKZA 4JYAE 2VPLA 1DU6A 1PP8F 1TF3A 1YTYA 4QLCU 1S5LC 1WJ5A 1XB4A 3CC2I 3HOUJ 1MEYC 4OAZA 2EM3A 4YY3E 2CWEA 2MC6A 3FHNA 2EZLA 1WJDA 1BBGA 4RHBB 1G2HA 2K7LA 1ZK8A 2NS0A 2EPZA 4JI2E 2VLAA 3IAM2 3JRBA 2HVQA 2K7IA 2C6YA 3QOPA 2CUJA 1G2DC 4G6TB 2LJHA 3PO2J 2ZMEC 1NCSA 3L1PA 2UV1A 4B3SE 1B9NA 2N8XA 5GP9A 1W4MA 2K85A 4N9IA 5DS9A 4EJWA 4FASD 3OS0A 3RZDJ 1FY7A 3QU6A 1BB8A 3R4KA 5ILUA 3C6KA 2ZXIA 3E5XA 1KU7A 2PBIA 5BR8E 2RNGA 1QZYA 2O9LA 4Q47A 4CCNA 3CLOA 2H1KA 3R0AA 3H5NA 3SFZA 2RQLA 4R2SA 2OUMA 1QGPA 1W7PA 4XN0A 1L0OC 1XDSA 3K1MA 1FTTA 3K10A 2W00A 2OCEA 1JKQC 1MMNA 3ZQFA 1P7JA 3OIOA 5HS9A 1OMIA 3KP5A 3OYEA 2FMLA 3VODA 2EM6A 2YTDA 1NTCA 2RNJA 3K1NA 4XLHA 1ZU1A 3QP5A 4DW6A 3HUGA 3THNA 1AU7A 1BW6A 2X51A 1J09A 1K83J 1OYYA 1E3PA 4R03A 9ANTA 5TISC 4LF5E 4NDLA 3WE3A 2IJLA 2P4WA 2ZJ2A 1HCRA 4IJAA 4HAMA 1RKWA 5B5EC 3IP4B 5J40A 3M8JA 2DRPA 4J00A 1O7FA 4ESBA 1SMTA 2E7WA 2K9NA 3HXLA 3WHBA 2EWLA 4ENMA 2KL4A 3HG9A 2EPCA 3ZXSA 3K4LA 1B4AA 1HBXG 4U0VA 1UHZA 3HZJA 2COMA 3LQQA 3HEFA 4C2MJ 3BF2A 1J5YA 3FM3A 1JE8A 1S3JA 2A07F 5L3CA 3HOVJ 4B3ME 1UG0A 1FWZA 1U5TA 4Y13A 2JYAA 2ZM6E 2R4GA 2EWNA 4HBLA 2EM8A 2XVCA 1JK2A 3CUQC 2PMZN 2LH9A 4IHSA 3GZ6A 1IRGA 4F52A 2LJUA 5K7FA 4BY1J 4PJNA 2EB7A 2EMLA 1JXSA 4N4NB 2NABA 3CTAA 3CCMI 3O6BB 2R7SA 1YPNA 2DMUA 1KYZA 2NVYJ 4LG0B 2NS7A 1LB2A 1YS6A 1OCRH 2EJ4A 4OAYA 5A6BA 2DPUA 2IHR1 5IYDJ 1K6YA 3K4KA 1ZG3A 1YYKA 3RDIA 3DTEA 2B7EA 1XSDA 1SEUA 1JHFA 2EL4A 5IT9Z 2LF7A 4DKKA 1MBKA 1YIJI 4A6DA 1OPCA 5LHIA 3AG1H 3BG6A 4F92B 5F3WA 4LK1F 3FM5A 3GFLA 1XG1A 2OQRA 3S93A 2A5YB 1LE8B 3JAMZ 4R2CA 4II3A 1H89C 3RI4A 2R7WA 4RGRA 3GTLJ 2XPVA 2IS1A 5A69A 2OV7A 4M73A 4UY8I 3LSTA 1A35A 3V4GA 2GXGA 2YTFA 2VXDA 4BDYA 5IOYA 5IT9K 2DIXA 1BI1A 4F6MA 3TOAA 1I1SA 5E18F 2RS6A 5DNYA 4ZC3A 2ICWG 4GKKE 3DEWA 4NC6A 5LRSA 3QWLA 4IL6C 2V86A 4M2ZA 2JRMA 3QYFA 1R7JA 1IN5A 2VXZA 1TNSA 1HNWE 1ETOA 1RC7A 2EPRA 3I59A 2ELHA 3FX3A 4IZZA 3FIGA 1FOYA 5CVRA 3OIPA 2EK5A 3KIOA 2LUPB 1XC5A 3WG7H 5DUIA 1WJEA 2DTZA 1WH7A 4G94A 1IQSA 4J01A 1Q1VA 2M1BA 4P7DA 4MFDA 1TN9A 2CQNA 1FOXA 3PNYA 5AC4A 3CCSI 3DBLB 1PVEA 1W7PD 1HF0A 4A0YA 2CH0A 2YSRA 3CQZJ 2HEOA 2DQLA 4EJTA 5KL7A 3FBNB 5E79C 4RAGA 2E1MC 2OZ6A 2LC2A 3GTQJ 4J8ZA 4RGXA 4I99C 4EATA 1VQOI 2VQHA 3ECHA 1UMQA 1LEBA 2FQ4A 2EOZA 1OCZH 2H1LA 2EZIA 3BR0A 3ZMUA 3FXRA 4BGDA 4JI3E 4XSXF 1I6HJ 3EUKL 2E71A 1REPC 2NUEA 2ZNZA 2IXSA 2FRHA 1BI0A 1L3LA 2EL5A 2FOWA 3KCCA 2BZTA 1VQMI 4AYBN 1WHNA 1CF7A 2CUZA 5M5XJ 1XCVA 1JTYA 5HDKA 3AG3H 4B3XA 1ETVA 4KIGA 1BI3A 2ISZA 3AUZA 4HF0A 1JKPC 2O8KA 2LF8A 5K5QA 1LEAA 5E8GA 1J75A 3P5JA 1ON1A 3GBGA 3HRSA 4CCJA 4IHWA 1J2XA 4LF4E 3OSGA 3ZPLA 1LFPA 2DI3A 1ZYRF 3JR9A 5AE1A 4KYWA 5CKTA 1V54H 2PG4A 2X1CA 2EFWA 3FK6A 2MYSA 4NB5A 4DV0E 1MH4A 3CDHA 1KZHA 2EOMA 3BPVA 4Q28A 4BE2A 4CCLA 2JZYA 2X6YA 4IOAF 1ZR9A 2CRGA 3VFZA 1BL0A 1X48A 3GO5A 2N3HA 3JAMK 2Q2EB 4CDGA 2XGDA 2YU9J 4G7ZF 2EOEA 3V7CA 5A2QC 3T1YE 1M1EB 1HNZE 2UXCE 1UHSA 3VOEA 3H09A 2EN6A 1JK1A 1HR0E 4EGZA 3I53A 4LJZF 2HTJA 4BKXA 4M3DA 4ETSA 2PMUA 2TDXA 4B47A 1XGSA 3Q0WA 2DMTA 1PKPA 1YSAC 3T8RA 3BP8A 4ESFA 4EJUA 1I5ZA 3L2WA 4UV9A 1A31A 2DYRH 2KIQA 3MHSC 3S3NA 1ZLJA 5FB2A 2F6CA 1D8JA 3E97A 3P1XA 3ASOH 1O0WA 2ZFUA 5JR3A 1I3AA 2RAEA 4I0BA 2RQQA 1FZPB 1PDNC 1BR2A 3LSKA 3ERED 1UFMA 2WC2A 1X3CA 2X6OA 3L2UA 2ISYA 4DMIA 3BTCA 3R6SA 3GLXA 3TBIA 3H35A 4M6XA 1IXCA 2JA8J 2M9AA 1VQ6I 2YTOA 5FD6A 3DXJF 4LG3A 2OF7A 5ED4A 2BW3A 4MNUA 1QO0D 1X2MA 1GT0C 1TTYA 2YUSA 1T4NA 2JUCA 2CV0A 3TQNA 2E34A 1H0MA 1EH8A 4NQWA 3IL2A 3CESA 5LEKA 1ETWA 1MBEA 3A03A 4RDUA 2Q8UA 2XAGA 3HPSA 1YUIA 1BC7C 4O6JA 3HB9A 3AG2H 1ZELA 3SZPA 1BW5A 2M8EA 2E1NA 2QWWA 2G7UA 1RUNA 3LAJA 2L54A 2QSHX 1Q1HA 2NS8A 4HV5A 4B4CA 3VYYA 3ADLA 1JKOC 2VKEA 4ZDPA 4QPQA 1S72I 4B43A 4GRIA 3CDLA 5D5XB 2STWA 2R3SA 3CCEI 1WSUA 2HDWA 2Z16A 1WJBA 1U9NA 1EKEA 1OR7C 3T1BA 2D1VA 4JYKA 3OYHA 3QPSA 2XGXA 3WGGA 3WTZA 1T39A 2EMYA 2X48A 3QYEA 4Z6YA 2QZ8A 5DCMB 2B9SA 2EOQA 2TRTA 2ZMEA 5EDNA 4ZTJA 3EUHC 1JHHA 4MLQA 2K5CA 2I8DA 3KPHA 4MHGA 1RRJA 3CP2A 1YIOA 3KFWX 1S6LA 1R22A 4GO1A 4XLFA 4WPYA 2ZC2A 4YIRX 4PGGA 2XSJC 1CQTA 2KDOA 5AE3A 4I09A 3KZIC 3U1DA 4LF8E 2L7FP 5E3NA 5FFXA 1RMDA 2ELJA 4TUGA 1ZQ3P 3CCQI 4CA0A 4MFEA 1UG2A 1FYMA 3IHUA 4CHUA 4IHVA 2JVAA 5IV8B 5CPRB 1A04A 3H92A 4A3EJ 2I9IA 1A1GA 3HTUA 5KL4A 2W48A 1B72A 1TC3C 1OCOH 4OWRB 3ONQA 1F36A 1ZRDA 2JA6J 3L00A 4WSPA 2IGMA 3KWRA 3AL0C 4G7OF 3OS1A 2L2MA 1IW7F 2NVUB 1W0UA 4XM3A 3I9V2 1N36E 3LL7A 4C3HJ 3ZQQA 4IVNA 2H94A 2EPFA 3TO9A 1RESA 2A6HF 2X4HA 3VWBA 5EGOA 3WE2A 1HC8A 1P2FA 4YELA 2UUCE 5FRMA 1QNTA 4PSWA 2VBXA 2CU7A 4BL0B 2LKSA 2WB1A 2UXBE 4CCOA 2Y9YA 2H6CA 4A3IJ 2HGCA 2HQAA 3FWEA 2K3PA 3BTIA 5TSEA 1A6IA 4R8HA 2JJ7A 3KEQA 3QPLA 3PNVA 4Y3OA 2QENA 4HX8A 1FP2A 2E7XA 4RB0A 3BGHA 2HR3A 4BJ6C 4RA2A 3MFKA 1X19A 4BBRJ 4AIHA 4NXNE 1G2FC 1XMAA 3IWCA 1FSEA 1TWCJ 3K6QA 4DBRA 4KT6A 1IQOA 4HNUA 4M30A 4V2GA 4EM2A 3EPKA 3MMYB 1P4WA 2V85A 5AONA 1Y0NA 5F08A 3VHTB 2MKNA 3GEZA 1DP7P 1OCCH 4M9SA 3IWBA 1QHGA 3M99B 2IBDA 4DR2E 5BNGA 2K40A 2PRTA 2OQGA 5EG0A 4IEJA 3FMSA 4X65E 4XR6A 2VKDA 4L18B 1X4OA 2M7AA 4AQYE 4LIUA 5E17F 4Z2YA 1EF4A 2FEZA 2P8TA 3GLLA 3W6KB 2D1HA 2IS4A 2LRSA 5DCFA 1F1ZA 2I5UA 4KMFA 3FZVA 1IBKE 3MKLA 5HNHA 2Y0MA 2W85A 3DKXA 3OYMA 3F6HA 1YW7A 3BCAA 2GOXB 3ABKH 4XOTA 4LMYA 1IGNA 3FHZA 1TNTA 2EV6A 2QUFA 1WI3A 1BIBA 1MJAA 2QQAA 1BJAA 1P7IA 2HU9A 1PUFA 4FX0A 3C1DA 4HLXA 2MABA 4D0PA 4BUPA 4DR3E 2QA4I 2O6GE 2IAIA 1Z67A 4HG2A 5F1JA 2K4VA 1DPUA 5KL3A 2FXAA 3L2RA 4NHRA 1TT0A 4RLQA 2M3AA 5AE2A 1EA3A 1YQAA 3IWZA 2JA7J 3G2BA 3EPHA 4M72A 5DTDA 2V9KA 1T98A 5D6EA 1PJRA 2XHKA 4LD5A 2Z1DA 3LLHA 3AL0B 2YU3A 2HZTA 2DDBA 1OYWA 4C2UA 4LFCE 5IP7J 2EV5A 2A05A 3TDUC 5JLWA 1HKTA 4AWXB 1R5GA 2KQRA 5J1UA 1TF6A 2FTXB 3P9IA 2DXIA 1XNQE 4L0ZB 2WV0A 2FX0A 2JA2A 3TW6A 3FMQA 5K7ZA 2X85A 1E2XA 2E35A 4U7DA 2HI3A 3MWMA 3RJPA 2JVGA 4M3BA 2MBFA 2VQCA 3DBRB 1IAWA 2DMIA 3I64A 2L7ZA 2LOOA 3LSGA 4XRSG 2EMZA 4JI0E 3RKWA 3HOYJ 4MO7A 3LOCA 4PJMA 4MLOA 3CF5F 1R4MB 3ROUA 3K70C 2P5LC 4BDZA 1FOKA 2HYGD 2EORA 4AIDA 2CS3A 2YTJA 3KLOA 4AVPA 2PMZA 2UUZA 3ERMA 1YZ9A 2A69F 2XAQA 3S17J 1PJTA 2L8TA 3IH2A 1QHHD 3OOPA 1WKMA 2GAUA 2F5FA 2W84A 4HA8A 1HW1A 2OBPA 1IBME 5DEQA 1K78B 2AXTC 2RREA 4OOIA 1POGA 5F1RA 3HHHA 5EJCA 3FK7A 2R7VA 2JVHA 3HJEA 1RKTA 3UKGA 2VBWA 2EMGA 4MEYF 4PUSA 3CCRI 1IO2A 1SD7A 3H9JA 3GFIA 2O03A 1WXRA 1IRXA 1X1DA 1TL8A 3WHCA 3MD2A 2AO9A 4JX4A 1R49A 5CFFE 4ESJA 3LSPA 2W57A 1MNEA 4HF2A 1B8IB 3J7AO 2LY9A 2CPNA 1BOBA 1X1BA 5JLXA 2YRMA 2M87A 1S9HA 5LRRA 4XKWA 3F3XA 2CUFA 4A3MJ 3OR2C 2CG4A 2M45A 3OYDA 2HTSA 2K4BA 3BG9A 3CCYA 3DCFA 3HGGA 4B48A 5H6QA 5KL6A 2WAQA 2YWQA 3C4BA 2L7MP 1U78A 3A0HC 3O8GA 1P92A 3G71I 1TP4A 1DGCA 4B1RA 2HOTA 3PQKA 2DDAA 1FBUA 5M3FJ 3DF6A 2RSMA 1OLTA 2ZCWA 3LSMA 3COAC 1CF7B 1FX7A 4PZJA 3K4JA 4LK0F 3CUQA 3JRIA 3HRTA 2HDCA 3LMLA 4IOCF 4HRIA 4QSHA 4X62E 1NG7A 4G6DA 2XROA 3OR1C 4I76A 1X49A 1O57A 3IC7A 2DLQA 3ELKA 2ZNYA 3QPTA 2EPKX 2UXXA 3J81C 3BT9A 2VKVA 4P9UA 3B6AA 3SQNA 2LE2A 1ZLKA 4GZNC 1D0XA 3JW4A 1MGTA 2LO3A 1R58A 3GMEA 3ZQCA 4CZCA 2VF1A 1OR7A 3DPLC 5BPDA 3DBHB 1YYOA 1Z6RA 3PJRA 4V19K 3JRGA 1X1AA 3CJQB 1QU3A 1BJZA 1LDJA 2L5QA 2WY8Q 4L5JA 4M9ZA 5AASA 1H9GA 2BXYA 2V9VA 2JP9A 4G7HF 1KGSA 3F22A 2N3GA 2EA2A 3S2WA 3A01A 2X9DA 2GOMA 2VPRA 2MC5A 1D0YA 3ZRGA 1BN5A 2GWRA 2O0YA 2XF6A 2WADA 3FXJA 1AWCA 1AAYA 4GEQB 3KX2A 3DLLF 3ZQHA 5K1YA 2QQ9A 1IXSB 3G1MA 3LA2A 4M0VA 4RAZA 1MSFC 2JA5J 5GPAA 3LSIA 2NRAC 5GAHJ 2A5WA 2PFBA 5D5WB 4M3GA 4M71A 2LY2A 3F0CA 3GF2A 2EA4A 3QQAA 2HXIA 1T33A 1ZREA 1DQUA 2A6TA 2NA2A 2CQQA 3EETA 2DPDA 2B63J 2QKMB 1GV2A 2E1MB 4IRIA 2BE5F 2XASA 3CCJI 1GZ6A 4AM3A 2P7CB 4A3KJ 2JN6A 1T08B 1ONVA 1R36A 2Y2ZA 5E1XA 3DU6A 3V42A 1X6FA 2VQFE 1MMSA 2M4IA 5KK1A 4HDUA 2KJCA 2LD5A 3JAMC 2V7FA 4ZZLA 3F21A 1N34E 2Q8KA 2BW3B 3BOQA 2Q1ZB 2DB2A 3SEZA 2STTA 3G6EI 3JTHA 1VI0A 4ZYHA 3G1OA 3J7ZI 2Z9OA 3BROA 3ZN0A 1G59A 1FP1D 2FOKA 2V87A 4MLVA 1V5EA 5C4JJ 4LF7E 3MSWA 1FJLA 3R61A 3OYFA 1MKMA 4KN4X 1AHDP 5LGTA 3Q9VA 2L0KA 3E5UA 3VB2A 2AXLA 1RZ4A 2AQFA 3VYUB 3CMAI 2R5YA 2VONA 4O3MA 2KISA 3M8FA 4A0ZA 1U9OA 2DOEA 5CVUA 4A3LJ 2JOXA 3M8EA 1ETQA 1WPKA 1NK3P 3PO3J 2ENAA 1P4XA 1Y1VJ 5F0CA 1LDDA 2KHMA 2ME0A 3TW7A 2H27A 4HX7A 2F5DA 3FBIB 4OINF 1MNMC 2ZO4A 3S32A 4DBQA 1Y56A 1VQ9I 1D1AA 3EYYA
chains in the Genus database with same CATH topology
4U0WA 2EFPA 4G6QA 1T2KA 5D5VB 3K69A 5BS6A 2FF4A 4Q4ZF 2VOPA 1TQPA 1Z91A 3NQOA 4IF4A 1U8RA 2GZWA 3PFIA 3I0TA 5D8KB 3MQ0A 3ZQ7A 1SMYF 1SFEA 3C3WA 2HQRA 4UUVA 5H20A 2DTRA 1ZHFA 4KMUX 3F8MA 2VT3A 3BPXA 4HV6A 4I2OA 3MZYA 3ECOA 3V8JA 2XAHA 4L9TA 3J80K 5E1WA 4P96A 4L5IA 3D0SA 3E6BA 3DV8A 3I58A 4WXHA 5IT3A 1SFXA 1ZN2A 3KZZA 4RGSA 5ERIA 4AIKA 1IN8A 4L9VA 1BIAA 5BOXA 4I7HA 1D5VA 4CYDA 4BYYA 5LEJA 2HQNA 2GA1A 1HSTA 4HDVA 1HW5A 3BY6A 3ZP5A 2WWYA 3GVAA 2ETHA 5H6RA 1K79A 1W7PB 4CICA 3ZMSA 2R7FA 3R0JA 2OZUA 4YG2F 1ZAOA 4ZZDA 1TQMA 1SAXA 1F4KA 2EFQA 2NNNA 2AS5F 1TBXA 1U3EM 1Z6TA 1FC3A 2RKHA 2G7HA 1TW3A 3MEXA 1CGPA 1TQIA 4A5MA 1XMKA 3QU3A 4BHBA 3C7JA 2XKOA 1WRJA 2R7DA 3WTYC 2F5CA 2KIUA 1UCRA 1O3TA 3IRQA 2BGCA 1J59A 5CJ9A 5L3FA 1HKSA 3FF5A 1HXDA 2MLGA 2F2EA 3HRUA 3HRMA 4M6YA 2A6EF 4LG0A 4O5VA 1GVJA 3WGIA 1XSXA 2Z5UA 2P6TA 3WTVC 3C18A 4XLNF 1B59A 2ZKZA 2NYXA 1F5TA 2QBYB 1MJ9A 4IXAA 4FT8A 3KP4A 2QQBA 3DQVC 2JPCA 3GYHX 2DAOA 1HSJA 3KZYA 4AD9A 3T8TA 3F8NA 3V8KA 1EV7A 1MD0A 2A61A 5HOOA 3LA3A 4KT5C 1O7LA 3CUOA 5LHHA 4NHJA 2UWMA 1FBSA 3I59B 4EM0B 1QBJA 3JSOA 5DUKA 4RAYA 2Z99A 3KLNA 2BV6A 2O3FA 1KYWA 2FBHA 5DD8A 1YO5C 2VE8A 2YR2A 3EUHA 4QWQA 2J5OA 3M1EA 3TOBA 4IHTA 3HOTA 2K4JA 3T5XA 4MTDA 3AAFA 1IZ1A 2WTEA 3CO6C 5J8CA 2QM3A 1G3SA 3GW2A 1FYKA 4P5OA 1ODDA 1SD4A 2EFNA 2V1DA 4LB5A 4KFCA 5D8LB 2PJPA 5A2QK 3JTGA 2B0LA 2JPBA 3HYIA 3BDDA 1PP7U 2VE9A 3GFMA 1S29A 3DP7A 1WQ2A 4YFNF 3EYIA 1P6RA 1KA8A 1XGMA 3DPTA 5D4SA 4H0EA 3ZMTA 3GUDA 3Q5FA 2FNAA 1PUEE 2CW0F 4GXOA 2A68F 3KP7A 4RGUA 3F8BA 3RPUA 3QPHA 4M74A 1R1VA 2P5VA 3EDPA 3DFGA 3ZMVA 4WWCA 5CVIA 4TV7A 1TLHB 1RNLA 1G6NA 3I54A 1XGOA 1S7OA 1ZRCA 3V7RA 4U7BA 4YFXF 4ZYEA 1LQ1A 1QQIA 1Z9CA 1Z05A 2L02A 1KQ0A 3WTXC 2DK8A 3E6MA 3HHGA 2J5PA 3T0YA 1SFUA 3M7GA 2XRNA 5E1ZB 1BM9A 5F64A 2VC1A 4RS8A 3E6DA 2IP2A 1DDNA 2PQ8A 1XD7A 2L3DA 3OV8A 4PDKA 3ZMZA 5BPIA 2QVOA 1QZZA 4K2EA 2DQRA 2FBKA 1RIOH 2E1CA 5D4RA 3MCZA 1STZA 2F5EA 2GIVA 3JSPA 1XSVA 3R60A 5DCMA 1XGNA 2Z33A 3F23A 4MTEA 4ZH4F 3WODF 5HS8A 1YG2A 2DO7A 2CQKA 2ACJA 1BBYA 5EEHA 1J7KA 2GXBA 1HKQA 3F8FA 5TRDA 1G3YA 4EJVA 4HLYA 3WG9A 1YLFA 3O2PE 4A5NA 5K5OA 1MDMB 4A2UA 3CJNA 5CVJA 1Z1DA 4I02A 4BXUA 2NAZA 1IXRC 4ENJA 6PAXA 1DPRA 4S05A 3N97A 1FPQA 2BEOA 2IA0A 4UVBA 2KJBA 4MQVA 2LKPA 2FE3A 2RGVA 1YW8A 1B1BA 3B02A 4OU0A 1FT9A 1UB9A 2Z3YA 4EV0A 4P55A 2OD5A 3GFJA 2XV4S 2CYYA 2NNYA 4R1HA 2VC0A 1DUXC 4OIOF 5K5RA 3GX4X 1KU3A 2IW5A 4GYGA 2X0LA 3I5UA 1YW9A 4HQMA 5A2QZ 2XAFA 5JHUA 3Q9SA 5F6FA 1ZGAA 2KRFA 1FSHA 1MJBA 3BWGA 4BH9A 5LGUA 4WX9A 5EEGA 1JGSA 4JK1X 4LGWA 4LFUA 4OIRF 2RVCA 5FGMA 2VT2A 4HOBA 3TDZC 4KICA 1MZBA 4HYEA 5AIPA 4HX4A 3L2CA 2K27A 5JVTA 1I6XA 2QBYA 4HW0A 3L9FA 2XIGA 4KDPA 4CXFA 5E20A 1KU2A 1P4AA 3WU0A 1KQ8A 3KE2A 1J9IA 2D45A 2GQQA 4KN7X 1U5TC 4PGHA 2KIMA 4F7ZA 4OMZA 2EFOA 2RC4A 2L01A 5LBQA 3IWFA 4EM1A 4RB2C 2ZXJA 3DEUA 2VOOA 1FLIA 1K78A 3J81K 1I27A 2HFHA 2UZKA 2IA2A 1IN6A 4AIJA 1FBQA 5LHGA 4BHPA 5LLQA 4RB3C 5HLHA 1LVAA 3KP3A 4LLLA 2Q2EA 2VN2A 1SD6A 4Y17A 1KQ9A 4IPAA 4BQAA 5D6FA 1G4DA 1WWXA 3QP6A 3LAPA 3U9GA 5AIQA 3G3ZA 3RPQA 2IPQX 2ESHA 2O61A 1I1GA 4M9XA 3P9KA 5HLIA 3KEOA 1R1UA 4WCGA 4HF1A 4ASNA 2FNPA 5BMZA 1W5SA 3F6OA 3HSRA 4ENNA 5L3DA 2XAJA 4EGYA 4WK8F 4L0YB 5FD5A 2M5WA 3H3UA 1IN4A 1FYLA 2O8XA 2XKPA 1G3TA 4G9YA 4BHCA 1J0RA 3ABTA 2W25A 1V3FA 1X3UA 2M30A 1HQCA 2Y75A 2HKXA 2KIFA 4EJOA 3F72A 2H6BA 5HDNA 3DF8A 3LQRA 1T0FA 1LJ9A 2EJRA 3LA7A 2CO5A 4B09A 2ADUA 2MD5A 2PEXA 3HIFA 2ZMEB 5HS7A 3P7NA 4ZYGA 1USTA 3LWFA 4RB1A 3IRRA 3WTTC 4MQ9F 3WTUC 5FLXK 1B6AA 1ZRFA 5HVQC 3K2ZA 4OMYA 1ZH5A 4DQ2A 5ICGA 2HOEA 2JT1A 1TW2A 3ML6A 3FXQA 5L3BA 1GHCA 4N0BA 5FLXZ 1LNWA 2RV8A 1U2WA 2JTVA 4FX4A 1O3QA 2VODA 4YIFA 5L3EA 2YPRA 1ZARA 1D3YA 4R79A 1C0WA 4XLPF 4L9NA 2LSOA 3TO6A 4WXDA 4U0YA 4UV8A 3ZN1A 4E70A 4HQEA 2DT5A 1ON2A 1T6SA 1ULYA 3HSFA 3MAJA 1D8KA 3PQJA 2FBIA 3EQLF 3U2RA 1UHWA 4JQFA 3RTRA 4B8XA 2V1UA 1UHMA 3G73A 1NHAA 2W24A 5ICFA 2EV0A 3TGNA 3SHFA 2IT0A 1O3SA 5CVVA 1USSA 3M9AA 3BJOA 1XN7A 2DK5A 3E5QA 4YFKF 1IN7A 2ZFWA 1XCBA 2RDPA 2Y48A 1W5TA 1ZG5A 2FSWA 5HDGA 1MDMA 4DNCA 2MA3A 3W6JB 1YYVA 3KETA 3H3ZA 1R23A 3D5LA 3BJAA 2DW4A 2OU2A 4A6EA 4P9FA 4A12A 3MZHA 1SD5A 4ON0A 4KNYA 3FMRA 2HWVA 2V6CA 5JI6A 5HLGA 5DV5A 2P6SA 2DLLA 3NRVA 3WTSC 1OKRA 2CFXA 4S04A 3IKVA 3ZMDA 2Q0OA 2L4AA 5DD4A 2HYFA 2BBYA 1R5HA 4XBFA 5LGNA 3F6VA 2V1XA 4I98B 3BZ6A 5L3GA 4BNCA 2FU4A 1EH7A 5BQTA 3ULQB 2ESNA 1AOYA 5ILSA 5JFRA 1K6OA 3IKTA 1U5TB 3RKYA 4FHTA 5DYMA 3SXYA 3QRFF 4LB6B 4UHTA 2YX7A 1K7AA 2K02A 5FO5A 4Y15A 3REOA 4JBAA 2G9WA 1YS7A 3O3KA 5DDGA 2CSOA 2PI0A 2UXNA 4A0XA 1R1TA 2IA1A 4XRFA 3GXOA 4KIFA 3I71A 2MH9A 1HW2A 5TJJA 4MEXF 3HSEA 1G3WA 3KP6A 2JSCA 4Q48A 5CLSA 4OIPF 3CUQB 1T38A 2MH2A 3HTSB 2V79A 3QAHA 1Z7UA 3KP2A 1BOAA 2FA5A 1GXQA 1KU9A 5J6XA 5FFZA 3RYRA 2FMYA 3E3VA 4WXCA 2BYVE 4KUMA 5J8FA 2VBZA 4BAYA 2L4MA 3RYPA 4G8XA 2P7VB 3HOSA 2P5KA 1E17A 2KKOA 2PN6A 3ISPA 4KA4A 2D2WA 1ZGJA 1IUYA 4I0AA 3LFKA 3WGHA 1F9NA 5ICCA 2FQ3A 1YFHA 1LDKB 4EVIA 1QPMA 3K0LA 3I4PA 4UVCA 1WI9A 2DFIA 3SZTA 1EH6A 4ZYDA 3DKWA 2H09A 4PCQA 4UXNA 2PMHA 2PLYA 1S7AA 1RI7A 4KIBA 3GZ5A 4EMSA 2QYOA 2XUBA 2GA2A 4XSZF 5KVRA 1BC8C 4WF2A 2QLZA 2DBBA 1RUOA 1ZG1A 2IRFG 2HKOA 3WU1B 3B73A 4CGZA 4GYIA 2DU9A 2RQPA 1BI2A 3L09A 2LDUA 1Y0UA 5D5UB 1OYIA 4Q5SF 3K9TA 4LLNA 5CYVA 2JRTA 3TO7A 4L9JA 4ENKA 3VEPA 3P9CA 3E6CC 3CO7C 2MC3A 4GGGA 1XDUA 2VBYA 3V7SA 3K1PA 4CO8A 5ICEA 2MLKA 4GCVA 2A3SA 1GXPA 1U6GA 1IRFA 2OAZA 3N4MA 1IF1A 3RKXA 4IRHA 4EQQA 2ZBKA 1S8NA 2YX4A 4LLGF 2LNBA 3J80Z 4HZFA 2CGPA 2IVMA 3ABUA 3FXUA 3NEUA 4UNOA 3V8LA 4N9HA 4OIQF 1FNNA 1VTNC 4U88A 4UVAA 1V4RA 3L7WA 3GWZA 2HS5A 1O3RA 4IRGA 2OA4A 4YIIA 3BJ6A 3RIRA 5E8IA 1B9MA 1R00A 3WTWC 2K86A 3F8CA 4I01A 5ILVA 4MGRA 4CZZA 3TKYA 3J81Z 2RN7A 1H9TA 1PP8F 1YTYA 4QLCU 1XB4A 2CWEA 2K7LA 2NS0A 2C6YA 3QOPA 1B9NA 1W4MA 4N9IA 4EJWA 1FY7A 3QU6A 5ILUA 3R4KA 3E5XA 1KU7A 2PBIA 1QZYA 4Q47A 3CLOA 3R0AA 3SFZA 1QGPA 1W7PA 1L0OC 1XDSA 3K1MA 5HS9A 1OMIA 3KP5A 2FMLA 3VODA 2RNJA 3K1NA 3QP5A 3HUGA 1OYYA 3WE3A 2IJLA 2P4WA 2ZJ2A 4IJAA 4HAMA 1O7FA 4ESBA 1SMTA 2E7WA 4ENMA 1B4AA 1HBXG 4U0VA 2COMA 3LQQA 1J5YA 3FM3A 1JE8A 1S3JA 2A07F 5L3CA 1FWZA 1U5TA 4Y13A 2EWNA 4HBLA 2XVCA 3CUQC 4IHSA 3GZ6A 1IRGA 2EB7A 1JXSA 3CTAA 3O6BB 1KYZA 4LG0B 1LB2A 1YS6A 2DPUA 1ZG3A 3RDIA 1XSDA 1JHFA 5IT9Z 2LF7A 4A6DA 1OPCA 5LHIA 4LK1F 3FM5A 3GFLA 2OQRA 2A5YB 3JAMZ 3RI4A 4RGRA 4M73A 3LSTA 3V4GA 2GXGA 5IT9K 1BI1A 3TOAA 1I1SA 5E18F 5LRSA 1R7JA 1IN5A 2VXZA 1TNSA 3I59A 2ELHA 3FX3A 5CVRA 2EK5A 5DUIA 4G94A 2M1BA 1W7PD 4A0YA 2YSRA 2HEOA 2DQLA 4EJTA 2OZ6A 4RGXA 3ECHA 1LEBA 3ZMUA 3FXRA 4XSXF 1REPC 2ZNZA 2FRHA 1BI0A 1L3LA 3KCCA 1CF7A 1XCVA 5HDKA 4KIGA 1BI3A 2ISZA 4HF0A 2LF8A 5K5QA 1LEAA 5E8GA 1J75A 1ON1A 3HRSA 1J2XA 3ZPLA 2DI3A 1ZYRF 4KYWA 2PG4A 2EFWA 4NB5A 3CDHA 3BPVA 2JZYA 3VFZA 3GO5A 3JAMK 4CDGA 4G7ZF 3V7CA 3VOEA 4EGZA 3I53A 4LJZF 2HTJA 4ETSA 2PMUA 2TDXA 1XGSA 3T8RA 3BP8A 4ESFA 4EJUA 1I5ZA 4UV9A 1ZLJA 5FB2A 1D8JA 3E97A 5JR3A 4I0BA 1FZPB 1PDNC 3ERED 1UFMA 2WC2A 2ISYA 3R6SA 3GLXA 4M6XA 1IXCA 5FD6A 3DXJF 5ED4A 4MNUA 1QO0D 1TTYA 3TQNA 1H0MA 1EH8A 4NQWA 3IL2A 5LEKA 2XAGA 1BC7C 4O6JA 3SZPA 2M8EA 2E1NA 2QWWA 2G7UA 1RUNA 3LAJA 2L54A 1Q1HA 4HV5A 5D5XB 2STWA 2R3SA 1WSUA 3T1BA 2D1VA 2XGXA 3WGGA 3WTZA 1T39A 2QZ8A 5DCMB 2ZMEA 1JHHA 4MHGA 1YIOA 3KFWX 1S6LA 1R22A 4GO1A 4PGGA 4I09A 3U1DA 5FFXA 1FYMA 3IHUA 4CHUA 1A04A 3H92A 3HTUA 1ZRDA 3L00A 4G7OF 1IW7F 4IVNA 2H94A 3TO9A 2A6HF 2X4HA 3WE2A 1P2FA 1QNTA 2VBXA 2H6CA 2HGCA 3FWEA 4R8HA 3KEQA 2QENA 4HX8A 1FP2A 2E7XA 4RB0A 2HR3A 3MFKA 4AIHA 1XMAA 1FSEA 4EM2A 1P4WA 5AONA 3GEZA 1DP7P 4M9SA 2OQGA 3FMSA 4L18B 5E17F 4Z2YA 2FEZA 2P8TA 3W6KB 2D1HA 5DCFA 1F1ZA 4KMFA 3FZVA 2Y0MA 2W85A 1YW7A 4LMYA 3FHZA 1TNTA 2EV6A 2QUFA 1BIBA 1MJAA 2QQAA 1BJAA 4FX0A 3C1DA 4HLXA 4D0PA 2O6GE 1DPUA 2FXAA 3IWZA 1YQAA 4M72A 1T98A 5D6EA 2XHKA 4LD5A 2YU3A 2HZTA 1OYWA 2EV5A 3TDUC 1HKTA 4AWXB 1R5GA 3P9IA 4L0ZB 2WV0A 3FMQA 1E2XA 4U7DA 3MWMA 3RJPA 2MBFA 1IAWA 3I64A 3RKWA 3ROUA 2P5LC 1FOKA 2HYGD 3KLOA 4AVPA 2A69F 2XAQA 3OOPA 1WKMA 2GAUA 2F5FA 2W84A 4HA8A 1HW1A 2OBPA 5DEQA 1K78B 4OOIA 5F1RA 3HHHA 2VBWA 4MEYF 1SD7A 3GFIA 2O03A 4ESJA 2W57A 4HF2A 3J7AO 2M87A 5LRRA 3F3XA 2CG4A 2M45A 2HTSA 2K4BA 5H6QA 1U78A 1P92A 3PQKA 1FBUA 2ZCWA 3COAC 1CF7B 1FX7A 4PZJA 4LK0F 3CUQA 2HDCA 3HRTA 4G6DA 2XROA 1O57A 3IC7A 3ELKA 2ZNYA 3QPTA 2UXXA 4P9UA 3SQNA 1ZLKA 3JW4A 1MGTA 1R58A 1OR7A 3DPLC 5BPDA 1Z6RA 1LDJA 4L5JA 4M9ZA 1H9GA 2V9VA 4G7HF 1KGSA 3F22A 2EA2A 3S2WA 1BN5A 2GWRA 2O0YA 1AWCA 5K1YA 2QQ9A 1IXSB 3LA2A 4RAZA 2NRAC 2PFBA 5D5WB 4M71A 3GF2A 2EA4A 1ZREA 3EETA 2DPDA 4IRIA