4BHBA

Crystal structure of mycobacterium tuberculosis o6-methylguanine methyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies of the Mycobacterium Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 50
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhbA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhbA01
1R5GA 2QQAA 1FBQA 1K79A 5CVJA 3BPXA 1J2XA 2EFOA 2CSOA 3MZHA 2OQRA 1W7PD 3TDUC 2FNAA 1ZRDA 4Q4ZF 3MZYA 1MZBA 1ODDA 2RC4A 4HQMA 2K7LA 2O0YA 3LA3A 1SMYF 1O7FA 2HGCA 1BIBA 5AONA 5L3DA 4ENNA 3Q9VA 1XCBA 3GFMA 5HLIA 3HTUA 2P7VB 5TJJA 1GXQA 3F22A 3LQQA 4L0YB 1W5TA 3GZ5A 2ZMEB 1ZGAA 1V4RA 3GFLA 2V1XA 2PMUA 4AIHA 3TOAA 1H0MA 3GLXA 1OR7A 3WTVC 3WU1B 3H92A 4BHCA 3ZPLA 1FT9A 5H20A 3TO9A 2FBIA 3DKWA 3GWZA 2ISZA 3T8TA 3ZMSA 1OYWA 2HKOA 2LNBA 2CG4A 2ZFWA 1CF7A 2LF7A 2MA3A 2HTJA 4UVAA 5D8KB 1O3QA 3GW2A 2RNJA 3I59B 1BI2A 5DCMA 3MAJA 1HW5A 3IL2A 1SFUA 1O3SA 2ETHA 1KYWA 3F6VA 2GA2A 3KP4A 5D8LB 4LG0B 3WGHA 1BC8C 1BC7C 4KDPA 1HKQA 2ACJA 1ZRFA 4MNUA 4E70A 3ZP5A 2VOPA 1FSEA 1G3WA 4IF4A 1REPC 4XBFA 1A04A 2A61A 3MEXA 4FX0A 2XAFA 4A0YA 2IA0A 3KFWX 1TW2A 5ILUA 2EJRA 2PMHA 1MJAA 4UV9A 5HLGA 1DP7P 4IJAA 4GYIA 2Y75A 2EV5A 1PUEE 2DBBA 1YW7A 4P9FA 2EV6A 4ESJA 2RKHA 2HQRA 1C0WA 2HEOA 3COAC 2PBIA 2HYGD 2FE3A 4ZH4F 2XKOA 2Z5UA 4OMZA 3R6SA 2EFWA 3G73A 2GXGA 1EH6A 4JK1X 4HF1A 3WE3A 4GCVA 3HYIA 1BM9A 1R5HA 3BJ6A 1R36A 3GYHX 2NNNA 3HSRA 5ED4A 3TQNA 4ON0A 1XD7A 1T6SA 5EEHA 2P5LC 4LB5A 1STZA 3QU6A 1HSTA 3BP8A 4G6DA 2F2EA 2E7WA 4L18B 2L3DA 3E97A 3BY6A 4BXUA 5LRRA 3RI4A 3LWFA 3RKXA 1FX7A 4RGRA 4QWQA 5ILSA 5J6XA 2MH9A 5D5WB 3JSOA 3RPUA 4Q48A 4GXOA 2XUBA 4BQAA 3DPTA 1Q1HA 3O6BB 4U7DA 1USTA 2CFXA 2QM3A 4WXDA 3EUHA 3ZMVA 2HR3A 4WF2A 1OYIA 5J8CA 2QQBA 1HSJA 1IRGA 4YFKF 1LJ9A 1S8NA 5BQTA 4I01A 5ICFA 3CUQB 4AVPA 5IT9Z 3WTWC 3HIFA 3G3ZA 1Z6RA 3SZTA 4MHGA 3O3KA 1BOAA 1XB4A 1RUNA 3QP5A 2XKPA 2H27A 2L4MA 2H94A 1FWZA 5J8FA 1YS6A 1T0FA 1FZPB 4KIGA 2HKXA 2EFNA 2KKOA 2NAZA 1I1GA 4U0YA 2JZYA 1FYKA 3R0JA 4MQ9F 4EJWA 4CHUA 1QZZA 1JGSA 2J5PA 3EQLF 3GUDA 3C1DA 4HOBA 2RDPA 3WE2A 2M45A 1YO5C 2PEXA 2JPBA 1KQ0A 2ZXJA 2XIGA 3BPVA 2VONA 4WXHA 3ULQB 5JI6A 3L09A 1XGNA 3HUGA 1TW3A 3P9CA 1D5VA 1F9NA 1XCVA 2HS5A 3VFZA 1MDMB 3ZN1A 1ON2A 2DO7A 2V6CA 3DFGA 4GO1A 2IA1A 4EGZA 1T39A 1DDNA 1F4KA 1H9GA 5CVIA 2Q0OA 5LLQA 1FPQA 3L7WA 4EJUA 4KIBA 4YFNF 2F5FA 1BI1A 2WTEA 1ON1A 1ZG1A 4UVBA 1LEBA 3I59A 4LB6B 2CQKA 3MFKA 1KQ9A 4LG0A 1OYYA 5IT3A 4I7HA 5HDGA 4UHTA 2EFPA 4KMUX 1XSVA 3KLOA 2YX7A 2FEZA 1LVAA 1SFEA 4I09A 1IAWA 5ERIA 2GQQA 3TO7A 5D6FA 2IT0A 1G3TA 4U7BA 1BJAA 3IWZA 1U78A 4I0BA 5JVTA 3WGIA 1UB9A 3VB2A 4XLPF 3IHUA 2IP2A 2J5OA 2Z33A 1Z6TA 1I27A 1HQCA 3ABUA 4I98B 4AWXB 3L2CA 1BI3A 5LRSA 3K1MA 2VODA 4UUVA 5K5RA 3BWGA 1IF1A 5DYMA 1YS7A 4M9SA 1HXDA 3LQRA 2M5WA 4LK0F 1P4XA 4CXFA 2XVCA 1S7OA 2OZ6A 1DUXC 2HQNA 2IW5A 1I1SA 2ESHA 2DK5A 4CDGA 4R1HA 5ICCA 3C7JA 2DAOA 4G8XA 1OKRA 2A6EF 4FX4A 1GXPA 1RZ4A 4L9VA 2HTSA 3MCZA 5E18F 1S7AA 1KU7A 2FBKA 1O57A 2XRNA 4YG2F 1B9NA 4HBLA 3HHGA 3O2PE 2LF8A 5F64A 2FQ3A 2F5CA 2R7FA 3DP7A 5HS7A 1B1BA 1QQIA 2PFBA 1SD7A 4M9ZA 5FO5A 5LHHA 2XAJA 4ENJA 3CUQA 4N0BA 3VEPA 2E1NA 3ECOA 1HW2A 1LDJA 1ZHFA 4M74A 1WI9A 1O3TA 2M87A 4MEYF 3WTZA 3VODA 3M8FA 1OPCA 1WRJA 3SQNA 3KLNA 3K0LA 4RGXA 4O6JA 3DV8A 4G9YA 5DCFA 2K4JA 2G9WA 4DQ2A 4EVIA 3BJAA 5L3BA 4RAZA 2RGVA 3HSEA 2JRTA 3KP6A 4D0PA 3JSPA 1WSUA 1FP1D 5FLXK 3HRUA 4OIQF 3WTXC 3HSFA 2Z3YA 2FOKA 1TQMA 1U5TB 1IN5A 2DFIA 2AXLA 3RDIA 1MDMA 3RKYA 5D5UB 2EA2A 1EV7A 3SFZA 3E6MA 5D5XB 1S29A 1SFXA 2PN6A 2HDCA 3ZMUA 2A6HF 1IXCA 1XDUA 4A6DA 1R22A 5CVUA 1FSHA 1UHWA 4UNOA 2HZTA 5CVVA 5E20A 5L3FA 5AIQA 2DPDA 1YLFA 5KK1A 3EETA 2M30A 2FF4A 4CZZA 6PAXA 4QLCU 2ZBKA 4BHBA 3IRQA 1XSDA 4N9IA 5DD4A 1IZ1A 1IW7F 3TDZC 4M6YA 4IPAA 3NEUA 1H9TA 1FC3A 3T0YA 4HDUA 4Z2YA 3DPLC 5F1RA 2O3FA 4KIFA 5BOXA 2V1DA 2P7CB 1B9MA 2JT1A 2LSOA 4HW0A 4GGGA 4BHPA 1TBXA 4A6EA 2OZUA 5HLHA 3M7GA 3FM3A 1K6OA 4P9UA 1IXRC 2PQ8A 4OOIA 5JHUA 2EV0A 5L3EA 2VC1A 1IN6A 4RB1A 3FMQA 4YIIA 3F8NA 1JE8A 4Y17A 3NQOA 4LK1F 3CJNA 3JAMK 2IA2A 4ESFA 2XAGA 2V1UA 4KYWA 5LHGA 4RB0A 1YQAA 2BBYA 3KETA 3F3XA 3ZMZA 1R7JA 5DEQA 1PDNC 1HKTA 3H3UA 1G3YA 2ESNA 3KE2A 5HDNA 1IXSB 2EA4A 4P5OA 3QPTA 4EM1A 2W84A 2KIUA 3FMRA 1J75A 2EB7A 4RB3C 4IVNA 2IJLA 3FXQA 1TQPA 3OV8A 3NRVA 2YSRA 2FU4A 3KCCA 5D4RA 3F21A 2ZO4A 1O3RA 1MKMA 1IN4A 3WG9A 1XGMA 2DTRA 2DT5A 2NNYA 1IRFA 3KP7A 4EMSA 3V7RA 1X3UA 3CUQC 4P96A 4HX4A 2QWWA 2MBFA 2PJPA 4EJVA 1MGTA 3LAJA 3HRMA 3GFIA 4PGHA 3F8FA 4A12A 2XGXA 4MTDA 4R8HA 4R79A 1TTYA 4ETSA 2FMYA 2QUFA 2M1BA 4A2UA 4M6XA 2UZKA 2H09A 4KA4A 1J0RA 2ADUA 2UXNA 5FD6A 4ZYEA 3K1PA 1U5TA 5CYVA 2JPCA 1U3EM 5JFRA 1KQ8A 3BDDA 2FA5A 3QOPA 3J80K 4H0EA 3LA7A 4YFXF 1KU3A 4KN4X 2OD5A 2MLGA 2DQLA 4WXCA 2QENA 2VC0A 2E1CA 1RUOA 1Z7UA 3TGNA 2P5KA 5HS9A 2MD5A 1ULYA 2K27A 1R1UA 1Z9CA 4ESBA 4I2OA 1FOKA 1UFMA 5E1WA 2KIMA 2O61A 1AWCA 1W7PB 3ISPA 2H6CA 3I58A 2GAUA 2PI0A 2ZMEA 3JTGA 4EQQA 2M8EA 2JSCA 5F6FA 3JTHA 3KP3A 2Q2EA 4UXNA 2KJCA 4ZYHA 2VT2A 5E17F 2CGPA 1XMKA 2L02A 3CO6C 4LLLA 2MH2A 2ZCWA 4L5IA 1HW1A 4MGRA 3ECHA 3D5LA 3ROUA 3V8LA 3KP2A 1VTNC 4BNCA 3HRTA 3I64A 1RNLA 3WTYC 3KZYA 4KN7X 1BIAA 3E6BA 4Q5SF 1U2WA 2XASA 1E2XA 4HV6A 3TKYA 3HOSA 2D2WA 3CTAA 4K2EA 3K2ZA 2QQ9A 4BAYA 4KNYA 3ZMDA 2GA1A 5A2QK 1J9IA 3ERED 2D1HA 2VBWA 1TLHB 1K7AA 4UV8A 3GX4X 2YX4A 1YW8A 1XN7A 3WODF 1ZYRF 4L9NA 1J59A 4MQVA 3WTSC 4L9JA 1XGOA 3V7SA 3GXOA 1HKSA 2Y0MA 3VOEA 4RB2C 2QBYB 4U88A 1ZLKA 3ABTA 3P7NA 1XDSA 2HYFA 4OIRF 1QO0D 1SAXA 5FLXZ 2BEOA 4S04A 4WK8F 4KUMA 3LA2A 2OQGA 2GZWA 5LBQA 2K4BA 5D5VB 2ELHA 1IUYA 4S05A 4PZJA 5LGUA 1FNNA 5DUIA 5LEKA 4IRHA 5ICEA 3W6JB 1FLIA 2RQPA 2ZNZA 1I5ZA 4HLYA 4UVCA 2BV6A 1L3LA 4ENMA 1IN8A 3PQKA 4U0WA 3TO6A 4HX8A 3C3WA 2JTVA 3BOQA 1U5TC 3E6CC 2BGCA 2XHKA 3W6KB 3F6OA 4A5NA 2XAQA 4KFCA 3RYRA 4CGZA 1KYZA 3FZVA 4IRGA 5LEJA 3SHFA 1UCRA 2FRHA 5CVRA 1GVJA 1RI7A 3CLOA 2CW0F 2IRFG 1EH8A 1YTYA 2K86A 2ZNYA 3QPHA 2LDUA 2W25A 4HYEA 1CGPA 3DF8A 2A69F 4DNCA 2PG4A 1ZAOA 1Z1DA 1ZH5A 1IN7A 1OMIA 2VBYA 5HDKA 2D1VA 2Z9OA 3GF2A 4B09A 3WU0A 1EH7A 1WQ2A 3QRFF 4FHTA 3ML6A 1FYMA 3N4MA 2RN7A 4FT8A 3JAMZ 2EK5A 1QZYA 4IHSA 2DW4A 4OMYA 4IXAA 2PLYA 2R3SA 4AIJA 3LAPA 2VN2A 1NHAA 2COMA 3GO5A 5H6RA 2UWMA 4M9XA 4MEXF 4L5JA 1KA8A 4PDKA 2VE8A 3J81Z 1WKMA 2XAHA 4G6QA 1R58A 3T5XA 2STTA 4JBAA 4AD9A 3K1NA 3FXRA 5TRDA 5DUKA 3IC7A 1B6AA 3DXJF 5D6EA 1FBSA 1TNSA 2K02A 4HAMA 5D4SA 3U9GA 4HLXA 3PFIA 1V3FA 2ZJ2A 1SD4A 2ISYA 3IKTA 1QPMA 3SZPA 1KGSA 2R7DA 1F1ZA 1FBUA 3C18A 1G4DA 3T1BA 1GHCA 1L0OC 2UXXA 1RIOH 5DV5A 4KT5C 3K69A 4L0ZB 2P8TA 2BYVE 2STWA 2MC3A 2OAZA 5DD8A 2P6TA 4ENKA 2V9VA 2QBYA 4CICA 4YIFA 3Q5FA 3S2WA 2WV0A 4EGYA 2YPRA 2O8XA 3GVAA 5K1YA 1D8KA 4GYGA 1K78B 3GZ6A 3F8CA 4WX9A 3L9FA 4A5MA 3DQVC 3FWEA 3J80Z 3REOA 2V79A 5BS6A 3V8JA 4HF2A 2L4AA 3EYIA 3WTTC 3MQ0A 2C6YA 2YR2A 3J81K 4ASNA 3KEOA 5CLSA 4WWCA 1DPRA 3MWMA 1I6XA 1YG2A 1P4WA 2NYXA 3M8EA 2CYYA 4G7OF 3J7AO 4OU0A 3QU3A 3K9TA 2DQRA 1USSA 1XSXA 2D45A 3PQJA 2DI3A 4RAYA 2FMLA 4IRIA 1W5SA 4XRFA 4G7ZF 3RTRA 4MTEA 4I02A 3AAFA 2Z99A 4L9TA 3B02A 3E5XA 3R60A 3U2RA 3ZMTA 1QGPA 3RKWA 3I0TA 4F7ZA 4XLNF 3HHHA 1PP7U 1FYLA 4PGGA 2E7XA 1MJBA 3FX3A 3ELKA 1LQ1A 3JW4A 5AIPA 1LEAA 4JQFA 2Y48A 3ZN0A 4NHJA 2A68F 3V7CA 4KMFA 1Z91A 4Q47A 3FHZA 2QLZA 3I4PA 3N97A 4ZYGA 3BZ6A 2P4WA 4ZZLA 3P9KA 4EM2A 1B4AA 5FFXA 5KVRA 4HA8A 3WTUC 2IPQX 2RV8A 3QP6A 2LKPA 5A2QZ 5K5OA 2NS0A 1LDKB 3P9IA 5E8IA 5L3CA 1T2KA 1ZRCA 2W85A 2CWEA 2KIFA 3U1DA 3RPQA 2KRFA 4N9HA 2GWRA 1MJ9A 4M72A 1Y0UA 5BMZA 1KU2A 1ZREA 2TDXA 2VBXA 5LHIA 2G7HA 3KP5A 2WC2A 4LLGF 3FXUA 4B8XA 1J5YA 3F8MA 5EEGA 1ZG3A 4HX7A 4OINF 4P55A 4A0XA 2W24A 3KEQA 3F23A 2DK8A 4RGUA 3ZQ7A 2F5DA 3QAHA 1SMTA 4TV7A 4I0AA 1O7LA 4EJOA 5HVQC 4M71A 1P6RA 4RS8A 3RJPA 3B73A 1QNTA 1R00A 5E1XA 3E3VA 3BROA 3FF5A 1YW9A 1DPUA 2OA4A 1G3SA 2AS5F 1FP2A 1E17A 2VXZA 1KU9A 4LD5A 3V4GA 4RGSA 2FNPA 2NRAC 5E1ZB 5LGNA 4PCQA 1BI0A 1K78A 4CYDA 2A3SA 3L00A 2GXBA 1J7KA 3GFJA 4LFUA 1BBYA 4CO8A 2XV4S 5FD5A 3GEZA 3IKVA 4BH9A 3F72A 3V8KA 2HWVA 1YIOA 4LMYA 2IVMA 2HFHA 3Q9SA 1TNTA 1U8RA 4Y13A 5E8GA 1AOYA 3IRRA 1P92A 4G7HF 2XROA 1R1VA 2EFQA 1MD0A 2P6SA 5CJ9A 3H3ZA 5LGTA 3OOPA 2F5EA 2A5YB 3HTSB 1JHFA 1HBXG 5FGMA 1SD5A 5HS8A 2OBPA 3I54A 1LB2A 1TQIA 4LLNA 1FY7A 4EV0A 2QVOA 3IWFA 1LNWA 5IT9K 1Z05A 1XGSA 3E5UA 4XSXF 2MLKA 3DEUA 3I5UA 3CUOA 3R4KA 5BPDA 4G94A 4NB5A 4HZFA 3CDHA 4WCGA 5FFZA 3RIRA 1BN5A 3KZZA 4M73A 3BJOA 3SXYA 2GIVA 2HOEA 1CF7B 4A0ZA 3FMSA 1G6NA 1YFHA 3R0AA 4HF0A 3D0SA 5ICGA 2QYOA 2P5VA 4NQWA 5DCMB 3M9AA 3M1EA 3WGGA 3F8BA 4EM0B 2VOOA 4IHTA 1D3YA 2X4HA 2WWYA 4BYYA 2B0LA 3TOBA 2L54A 1R23A 1ZLJA 3EYYA 2FSWA 3E6DA 2DU9A 1T98A 3HOTA 1U6GA 1ZN2A 2RVCA 2W57A 1F5TA 1SD6A 3CO7C 1W4MA 1ZARA 2DPUA 5BPIA 4OIPF 2FBHA 3HRSA 3R61A 1PP8F 1ZGJA 5HOOA 4Y15A 3RYPA 2EWNA 2FXAA 1B59A 4HV5A 4LGWA 4KICA 2A07F 2DLLA 2G7UA 4XSZF 1D8JA 1R1TA 1S3JA 2BE5F 2O03A 4O5VA 3FM5A 1JXSA 3LSTA 5K5QA 2VE9A 1ZG5A 1XMAA 3T8RA 4ZYDA 1YYVA 2H6BA 2VBZA 4O3MA 2KJBA 4U0VA 1W7PA 2L01A 3EDPA 5L3GA 4EJTA 2Q8KA 1JHHA 4LJZF 5DDGA 1P4AA 3I53A 5JR3A 2YU3A 3LFKA 2CO5A 2OU2A 4ZZDA 1ONVA 2X0LA 2QZ8A 1UHMA 5ILVA 2O6GE 2VT3A 5H6QA 1LDDA 1QBJA 4OIOF 3E5QA 1T38A 1S6LA 1WWXA 5FB2A 3I71A 4AIKA 1P2FA 4HQEA 4HDVA 2ZKZA
chains in the Genus database with same CATH superfamily
2V9PA 4FQGA 1E3OC 3IAM2 1R5GA 2QQAA 1FBQA 3H9GA 1K79A 4MO7A 1LUJB 4UUSB 2QSHX 3UNGC 5CVJA 4F3QA 2EMAA 3KYCB 3WHBA 1U9OA 3BPXA 1J2XA 3P5JA 1XMOE 2EFOA 2CSOA 4DJAA 3M3YJ 5B3SH 3MZHA 2OQRA 4A3DJ 3A01B 1W7PD 3TDUC 2ELKA 2FNAA 2YSOA 2EM3A 4LTYA 2BB8A 1ZRDA 2IS6A 4Q4ZF 3MZYA 1MZBA 1LVKA 4RM2A 2EMGA 1I39A 1ODDA 2ENHA 2RC4A 2V26A 2M9HA 4HQMA 3BR3A 5JLXA 3VYSB 5GAEJ 2R7WA 3BTLA 2K3PA 2K7LA 5AASA 2EM7A 1MMDA 2O0YA 4IJDA 3LA3A 3ONQA 2BY1A 4KJZA 1SMYF 3CMYA 3AG2H 1O7FA 3RCOA 2HGCA 1BIBA 1VF9A 5AONA 5L3DA 2DFHA 4ENNA 2MC6A 4AM3A 4IO9F 3PL8A 3Q9VA 3HKZN 1XCBA 2NUEA 2VKEA 4A3JJ 3GFMA 4DV2E 1T4NA 5HLIA 2LOOA 2MABA 3HTUA 2P7VB 3A4CA 4E7KA 1HA8A 2JRMA 5TJJA 1J5EE 1GXQA 3O8HA 3F22A 4IKFA 3LQQA 4L0YB 2UXDE 1B72A 1W5TA 3GZ5A 1VQ7I 1EKEA 3DF6A 2ZMEB 1ZGAA 1V4RA 4Y4RA 1PVEA 2J7JA 3GFLA 2V1XA 3HUGB 2PMUA 2VJ5A 2JYAA 2KPMA 2VJJA 4AIHA 1GT0C 4X64E 1TWCJ 1GV5A 2KOUA 3TOAA 1H0MA 2Q2EB 2ELZA 3GLXA 1YITI 1W36D 2EPKX 1OR7A 2DOAA 3WTVC 5CQEA 3WU1B 1BW6A 3H92A 2UXBE 1X3ZB 2R7UA 3FK7A 4BHCA 3ZPLA 1FT9A 5H20A 3TO9A 2WY7Q 2FBIA 5B1BH 3QG5C 3DKWA 2GPIA 3GWZA 1U0JA 2MC4A 2EPLX 2ISZA 2HVSA 3FBNB 5M5XJ 1BA5A 3T8TA 5B66C 3ZMSA 1OYWA 3QWLA 1SVMA 1YYKA 2HKOA 2LNBA 2CG4A 3TW7A 1J26A 3S2HJ 2ZFWA 4H4KC 3S93A 2KRHA 1CF7A 2LF7A 1ZAAC 3E0JB 1OFCX 2MA3A 1TWFJ 2HTJA 3RSNA 1LFBA 4UVAA 5EZHA 5D8KB 3OYMA 2K9QA 1O3QA 2EMLA 3GW2A 2R7ZJ 2R7RA 5EG0A 2RNJA 3I59B 2DJNA 2LUQA 1BI2A 5FKMA 5DCMA 3UKGA 3MAJA 2CV0A 1HW5A 3IL2A 1SFUA 1O3SA 2ETHA 1GLNA 1KYWA 3F6VA 2GA2A 2NVTJ 3KP4A 2NA2A 5D8LB 3OL3A 2EZKA 4M3FA 4LG0B 1UILA 4NBQA 3WGHA 3MN2A 1BC8C 1BC7C 4KDPA 1HKQA 4II2A 1WZ2A 2ACJA 1F2IG 1ZRFA 4MNUA 4E70A 3ZP5A 2VOPA 4RAFA 1FSEA 1G3WA 4IF4A 2K40A 2MFZA 1VI0A 1X2NA 1YYWA 1REPC 4XBFA 1A04A 2A61A 3ZQQA 3ZR8X 3HZJA 3MEXA 4FX0A 1W1WE 2XAFA 4A0YA 1Y1WJ 2RPCA 2IA0A 3KFWX 3ECRA 1TW2A 2YTOA 3LL7A 3OYLA 5ILUA 4FTHA 2V8QB 4QIWN 2EJRA 2PMHA 4R2AA 1MJAA 2P0WA 4UV9A 5HLGA 2EZLA 1DP7P 3ADJA 4BDYA 1YUIA 4IJAA 2R92J 2LTSA 2EQ3A 2L5QA 3U1KA 4GYIA 1YJNI 2Y75A 2EV5A 1PUEE 3OIPA 2DBBA 1YW7A 4P9FA 3DTKA 4JI5E 4DR7E 1VQNI 5IP6A 2RSMA 3S1NJ 3X2QH 2EV6A 4ESJA 3GLLA 3G71I 4RAGA 2JA7J 2KDOA 2IBDA 3IWCA 2RKHA 1K4SA 1JUPA 4NC8A 1WHQA 1UJ8A 2HQRA 3H09A 1C0WA 2HEOA 3COAC 1RRJA 1JJ8C 2PBIA 3E1SA 2HYGD 4M3DA 2FE3A 4ZH4F 3JTZA 3DEWA 2O7OA 2CQ7A 3IH2A 3C6KA 5E3NA 2EH3A 4LFBE 3S17J 2XKOA 1UMQA 2XF5A 3G6EI 4ZTJA 2Z5UA 4OMZA 3R6SA 1HR0E 4A3BJ 2ZFUA 2EFWA 1TWGJ 1FKAE 3G73A 1JGGA 2VKHA 4R2EA 3M1CA 3CP8A 1VZ0A 2GXGA 1E3PA 3PNVA 2E72A 1EH6A 4JK1X 4HF1A 3WE3A 1RQ0A 3MSWA 1EA3A 2QKLB 4GCVA 2LY9A 3BCAA 3KPHA 2E1OA 3HYIA 1BM9A 1R5HA 3BJ6A 4A3FJ 1R36A 3EPJA 3LSIA 4YRVA 1Z21A 2NNNA 3HSRA 3TQNA 5ED4A 3GYHX 4GEQB 1FOWA 4ON0A 5JLWA 1XD7A 2HQ5A 2JA5J 2V86A 1T6SA 5EEHA 4DV3E 4FE4A 2P5LC 4LB5A 1STZA 3QU6A 1HSTA 3BP8A 4G6DA 4KWYA 4R2RA 3GTLJ 1GVDA 2F2EA 4I8OA 1I50J 2E7WA 4L18B 2L3DA 3E97A 4F54A 3BY6A 4BXUA 5LRRA 3RI4A 2R7XA 1DGCA 2YRKA 3BF2A 3LWFA 4L5EA 4EATA 1DQUA 3RKXA 4CZCA 1FX7A 1XMXA 3MZ8A 4RGRA 1JTYA 4QWQA 5ILSA 5J6XA 2MH9A 2VQHA 5D5WB 3J7ZI 3VPRA 3JSOA 5EF6A 2O5RA 3RPUA 5IYDJ 4BDZA 4Q48A 4GXOA 2XUBA 1ZQ3P 3DPTA 4BQAA 1Q1HA 3O6BB 4U7DA 1USTA 3BTCA 2CFXA 2QM3A 2CMPA 4WXDA 3BZCA 5LMNE 3EUHA 1BR4A 2YTNA 3CC7I 3ZMVA 2HR3A 4XKWA 4WF2A 2W82A 4DKKA 1YPNA 1OYIA 3SFIA 5J8CA 3IAS2 3MD2A 2JK3A 1I6HJ 2QQBA 2D9HA 2YRHA 2EIMH 1HSJA 1IRGA 2CTDA 4YFKF 5A6BA 1LJ9A 3PUBA 1S8NA 2LTRA 4O43A 5BQTA 4I01A 4UUSA 1OISA 3DKYA 3SEZA 1SFOJ 4FE7A 5GTHC 1N25A 1EKZA 4GKJE 3OIOA 5ICFA 2FUG2 3CUQB 1W36C 4AVPA 3H0DA 2YU9J 2XSJC 4HNTA 3A01A 3WTWC 2KISA 1IGNA 4XNFA 5IT9Z 3HIFA 1V55H 1HOMA 4DIQA 3G3ZA 2LCEA 2EM9A 2HNHA 1RKTA 1YYOA 1Z6RA 3SZTA 3GTQJ 2Z2SB 4MHGA 3O3KA 1BOAA 1X4PA 2X1DA 3ZQCA 1XB4A 1RUNA 3QP5A 2CUJA 4GFBA 2GOXB 2ODRD 2N3HA 2XKPA 2VRDA 2H27A 1RC7A 2L4MA 3D5SC 2H94A 2HZDA 1FWZA 5J8FA 2L2KB 2G0EA 1YS6A 1T0FA 1FZPB 4KIGA 2HKXA 2VQCA 2EFNA 2KKOA 3CDIA 2NAZA 1I1GA 3KX2A 3Q3SA 3VYRB 4U0YA 1N75A 2JZYA 3K6GA 3OY9A 4C3HJ 1FYKA 3R0JA 4YHHE 4MQ9F 3EUAA 2OCEA 3RPUD 4EJWA 1YI2I 4IS1C 3T1YE 2N8XA 1TT5B 4CHUA 2E71A 4RHBB 1QZZA 1JGSA 2J5PA 2WA0A 3EQLF 2BY0A 3GUDA 3C1DA 4DV5E 1HNXE 5M3FJ 1JTXA 2FQ4A 4HOBA 3UR3C 1X1PA 2RDPA 3WE2A 5FRNA 2M45A 1YO5C 2PEXA 4PJLA 2M4IA 2LT7A 2JPBA 1KQ0A 2ZXJA 2XIGA 5IOZA 3BPVA 2B3TB 2EOEA 2VONA 5A6BD 4WXHA 3ULQB 2MD0A 4WFTA 5IWAE 3L09A 1XGNA 3HUGA 5JI6A 5KL6A 3CJTB 1TW3A 3P9CA 1D5VA 1F9NA 1XCVA 2HS5A 2CV2A 3JU0A 3VFZA 1FIPA 1MDMB 4X8WA 1XNRE 4BQOA 4B1RA 5FLXC 1IRXA 3ZN1A 1ON2A 2DO7A 2V6CA 1MBHA 1OR7C 1QRYA 1WPKA 2ZXIA 2WCC3 3SZGA 2LP0A 3NARA 3DFGA 3F9KA 4GO1A 2M1SA 1GTKA 5J3LA 2LC2A 2PX9A 3VWBA 4D7MA 3G1LA 2GIZA 2IA1A 4BJ5C 1D1CA 4EGZA 9ANTA 1T39A 1DDNA 3PSIA 1MSFC 1DQ3A 1F4KA 1H9GA 1Y0NA 2JVGA 4R2CA 4F2JC 5CVIA 3D1NI 2LLKA 2Q0OA 5LLQA 1FPQA 2BVLA 2VKVA 3L7WA 1OCRH 4KIBA 4EJUA 2F5FA 4YFNF 5KAFC 3ZQLA 1BI1A 2IGKA 2WTEA 1L4SA 2CU7A 2COBA 2F5VA 2DMQA 1ON1A 1WH7A 1ZG1A 4UVBA 2CQQA 3KZIC 3I59A 4PJ0C 4KISA 1LEBA 2V9KA 2EM2A 2K9SA 1UG0A 3I56I 2EPXA 1X4OA 4RA2A 1MBJA 2GBYA 4LB6B 4XRSA 2IHR1 4W97A 5KCMA 2X6YA 1R4MB 2CQKA 4CCOA 4RLQA 3RZDJ 2LO3A 3MFKA 1KQ9A 4LG0A 3HXLA 1TP4A 1T4LB 1OYYA 2XB5A 3M07A 3ABKH 4BEHB 3MHHC 5IT3A 4QPQA 3F0CA 4I7HA 1WVRA 1X1DA 4M3GA 5HDGA 2FOWA 1D0YA 4UHTA 2EFPA 4KMUX 1XSVA 1LLMC 3KLOA 2OUMA 2FEZA 2YX7A 1LVAA 1SFEA 4I09A 4XM3A 2YRMA 2LD5A 5T6JA 3CP2A 3S1RJ 1IAWA 5ERIA 5A6AA 2E1MC 2GQQA 1EJ9A 2H8WA 3TO7A 1BR2A 4IEJA 3CZ6A 5LL6R 5D6FA 2IT0A 1G3TA 1WJ5A 4U7BA 1H8AC 1SVOA 1BJAA 3IWZA 1Y56A 3FISA 1U78A 1VQKI 4I0BA 5JVTA 3WGIA 1UB9A 2KT0A 2LVSA 3VB2A 3CMEI 4FETA 4XLPF 4GDFA 3IHUA 2IP2A 4AYBN 1P47A 2E2IJ 2J5OA 2Z33A 4IQ4A 2M0MA 1Z6TA 1I27A 4PUSA 1XX5A 2JQ7A 1HQCA 2XRLA 4M9VC 1IQSA 3ABUA 2V85A 1WJBA 4I98B 4AWXB 3L2CA 1BI3A 4DYCA 1F36A 3I9V2 4UUTA 2V1NA 5LRSA 3K1MA 2VODA 1R71A 2JXPA 4UUVA 3PNYA 3QOEA 2HHHE 2HOAA 3HOZJ 3H36A 5K5RA 5C4XJ 3DEEA 2VB6A 3BWGA 1IF1A 1BOBA 2EOQA 1QPIA 4BY7J 5DM7F 4DUZE 2WAQN 5DYMA 2MC5A 1YS7A 2ICWG 4G12A 4M9SA 3BT9A 5FRMA 2YTPA 1HXDA 3BG9A 3BR6A 3LQRA 2EN8A 2M5WA 4LK0F 4C9YA 3S14J 1P4XA 2YTFA 4QPOA 3VSKA 4F9AB 1TWHJ 1FJLA 4CXFA 1ZR2A 2XVCA 3CLQA 2LE2A 1X1CA 1S7OA 4NXNE 4E7LA 2OZ6A 3JAMC 1FOYA 2HQNA 1DUXC 2IW5A 1I1SA 3W2VA 3TMOA 5CQGA 4DV1E 2L7MP 2X85A 1TN9A 2DK5A 2ESHA 4CDGA 2B9DA 1SAUA 2ODRC 2IEKA 2ZC2A 4YY3E 4R1HA 4CCLA 5ICCA 4CA0A 2WV1A 4OWRB 4JI4E 4XR6A 4F9CB 3C7JA 2DAOA 1IDZA 2A5WA 4G8XA 1OKRA 2QSGX 2A6EF 4FX4A 2PRTA 2LV2A 3HJEA 4AVZA 3IH4A 3J81C 4PJNA 2DJIA 3BLYA 3ZQFA 1YIJI 1GXPA 3S3MA 1RZ4A 4L9VA 2HTSA 3MCZA 2IGMA 2M7QA 5E18F 1S7AA 1KU7A 1TWAJ 1O57A 2FBKA 3CCSI 4BJTA 3OL4A 2XRNA 4DR1E 2L3CA 4NUBA 4YG2F 1B9NA 3FXMA 4CCMA 4XKVA 4HBLA 4L5NC 3HHGA 3O2PE 2JJ7A 2LF8A 3EUHC 5F64A 1IG7A 2UUBE 2FQ3A 4DUYE 2WBSA 2F5CA 3FIWA 2CT1A 1LE8B 2R7FA 3DP7A 1RR8C 1DP3A 1FJGE 5HS7A 2OV7A 2FGGA 1B1BA 4UY8I 1W5CC 4M30A 1QQIA 2PFBA 3RQIA 5GPAA 1JJ6C 4OOGC 1SD7A 2VI6A 3JRIA 4M9ZA 2EMKA 5FO5A 5FKNA 1X6EA 4JX6A 2E35A 5LHHA 5GAGJ 2XAJA 4XLCA 4B43A 1X1BA 1PJQA 4ENJA 3A0HC 3CUQA 4N0BA 3VEPA 2XGDA 1FTZA 1OCCH 4ANJA 2E1NA 3ECOA 1HW2A 2UUZA 4C2MJ 4PSWA 4ITVA 1LDJA 2DT6A 3LFUA 2EMHA 1KZHA 1ZHFA 1YRNB 4M74A 1WI9A 1Y6IA 4J8ZA 1JK1A 1O3TA 1T95A 2M87A 2NVUB 4MEYF 2VXDA 3WTZA 3J7AY 2EPUA 3VODA 2EN1A 3W2AA 2BBGA 2DGCA 3OYAA 3M8FA 4BBSJ 1IQOA 1OPCA 1WRJA 3SQNA 1JT0A 3KLNA 3ADIA 2EJ4A 1YJWI 1ETYA 1HLVA 1MEYC 3K0LA 1Z7LA 4RGXA 4O6JA 3DPUA 4WSGA 3DV8A 1T0FC 4G9YA 5DCFA 1QVTA 1J09A 3H5RA 2K4JA 3FKJA 2G9WA 3WG7H 4DQ2A 5CFFE 2VE7C 4EVIA 1HC8A 3BJAA 4XQFA 5F04A 4HSTA 2DA6A 5L3BA 3DTEA 5HLTA 4RAZA 4B3XA 2NS7A 2RGVA 5IPAA 2EPNA 3HSEA 3KYDB 2ZJPF 4A93J 3JRDA 2JRTA 3KP6A 4D0PA 2RSIA 2DB2A 4S0HB 3JSPA 1WSUA 1FP1D 5FLXK 1A5JA 3HRUA 4OIQF 4NDLA 2FX0A 1OCZH 4DV7E 3WTXC 2QCOA 2R7SA 3HSFA 1UZCA 3H5AA 2Z3YA 2FOKA 1TQMA 1U5TB 1IN5A 2DFIA 3MVPA 2E2JJ 2AXLA 1PYVA 2I5UA 3FXOA 3RDIA 1MDMA 3RKYA 5D5UB 4BU2A 4BC7A 2EA2A 1EV7A 3SFZA 4B3AA 5EDNA 2LYCA 4JI6E 3E6MA 3DTIA 1Q1VA 1S29A 1SFXA 5D5XB 3GTKJ 2EQ0A 2V88A 4HNVA 2RTXA 1VQMI 2H1LA 2P81A 3LMMA 2E19A 1SVLA 2PN6A 4CCNA 4XKCA 2VF1A 4GZNC 2ZB9A 1WJPA 4ZYAA 2HDCA 3ZMUA 3J80C 3GBGA 2A6HF 1IXCA 2QF7A 1XDUA 4A6DA 2EN4A 3G4SI 4NC7A 1R22A 5CVUA 1FSHA 1UHWA 4UNOA 2TRTA 2HZTA 3AUZA 2CRGA 1R49A 5CVVA 2GOMA 1AH5A 5E20A 5L3FA 4JI8E 5AIQA 2Z1DA 2DPDA 1YLFA 2X6OA 1ETVA 5KK1A 3EETA 2H8RA 4ZTFA 4LF7E 2DMPA 2FF4A 2M30A 3CJRB 3OYFA 4CZZA 3OYIA 2CPNA 4R8OA 2EN2A 4IQJA 4ZDPA 6PAXA 4QLCU 1XPXA 3JRCA 2EORA 2ZBKA 4BHBA 2CJJA 3LSJA 4XN3A 3IRQA 3HPGA 1XSDA 4N9IA 2MKNA 5DD4A 2BHYA 4BE2A 1T4OA 1IZ1A 2PMZA 1VQLI 3BR1A 1IW7F 3TDZC 2DDAA 1BJZA 4M6YA 1X5WA 2MSYA 4IPAA 3NEUA 2DYSH 1H9TA 2R7OA 4ZDOA 4LF9E 3HPZA 4A3EJ 5FKKA 1FC3A 2ID3A 4KITB 3T0YA 4RH8A 1O0WA 5IP7J 2BY3A 4Z2YA 4DBRA 4HDUA 3DPLC 3OS0A 1AHDP 2IXSA 1NCSA 3K7AJ 5F1RA 2O3FA 4KIFA 5BOXA 2V1DA 2P7CB 1B9MA 2JT1A 2LSOA 4HW0A 3ERMA 2BY2A 4GGGA 3AG3H 4FCYA 2H36X 4BHPA 1TBXA 4A6EA 2OZUA 1B8IB 4XONA 1NG7A 2Y31A 5HLHA 2JMWA 2JOXA 3M7GA 2WADA 3L1PA 2MKDA 2MYSA 3DCFA 3FM3A 1K6OA 1T33A 5BR8E 5GTIC 1OJLA 1H89C 4DGWB 3FXJA 1I3QJ 1ACIA 2OJED 3W6VA 4P9UA 1IXRC 2JA8J 3OMLA 2PQ8A 4OOIA 2L9SA 5JHUA 3JRAA 2EV0A 5JVGF 4D9JA 2VC1A 5L3EA 1R9TJ 4IHXA 4HSRA 4N4NB 1BL0A 1IN6A 1XTAA 5CPRB 1QHGA 4A3MJ 4RB1A 5GP9A 3FMQA 4YIIA 3F8NA 1JE8A 5HNHA 2HI3A 4Y17A 1P9QC 3NQOA 3S3OA 2B7VA 3CJQB 4LK1F 3CJNA 3JAMK 3A0BC 5AC5A 2Z16A 2ID6A 2M0CA 2IA2A 1ETOA 5IYBJ 4ESFA 1LPQA 2XAGA 1A36A 2V1UA 3GTOJ 4KYWA 5LHGA 2LY1A 3RMPA 1IMUA 4RB0A 2VIXA 1V54H 1YQAA 2BBYA 2L2NA 4XLEA 5DM6F 2KDZA 3KETA 5IP9J 5F0FA 1NG6A 3OWTA 3TBIA 1MMAA 3F3XA 2DFEA 5K7FA 2AO9A 3ZMZA 3W3CA 4BXXJ 1R7JA 4DV6E 2PJRB 2CUEA 5DEQA 1PDNC 1HKTA 2M34A 2XSDC 3FBIB 4BQNA 3H3UA 2EPPA 1T8IA 1G3YA 1NEIA 3PO2J 2ESNA 3KE2A 4JI2E 3KWRA 5A2QC 4XLFA 1OQYA 2MG4A 1A6QA 5HDNA 5FJ8J 1H88C 4ZJZA 4GKKE 3S1QJ 1IXSB 2EA4A 4P5OA 4K0KE 2MGQA 3QPTA 4HTGA 4EM1A 4LITA 2WB1N 2W84A 2EN3A 2KIUA 3Q0WA 3HQ1A 3NWSA 3CCUI 2VQEE 3FMRA 1FEXA 2EMYA 1NTCA 2LFBA 1J75A 2CUZA 2EMFA 2EOZA 2EB7A 5M3MJ 4RB3C 1HNZE 2DOFA 4IVNA 4KZSA 1MNEA 2IJLA 3FXQA 2ME6A 1TQPA 3OV8A 4JI3E 1OCTC 2YSRA 3NRVA 2FU4A 1LE8A 2K9LA 2F4OB 3KCCA 1X48A 5D4RA 3F21A 2L8TA 2ZO4A 1UN6B 1S5LC 4PJMA 5K7ZA 4JYKA 1O3RA 3IV5A 1MKMA 1IN4A 4X1EA 3WG9A 1XGMA 2DTRA 4IHVA 2E36A 3ZOQB 2DT5A 4B3TE 3PNTA 4BJ6C 2NNYA 2EINH 2V7FA 3DBRB 2DYRH 4X0GA 1IRFA 4X65E 3KP7A 4EMSA 2M4GA 3V7RA 2EOYA 1X3UA 3CUQC 2L7ZA 3JRFA 4P96A 3THNA 5IT9C 4HX4A 2QWWA 2MBFA 2PJPA 3HPSA 4EJVA 2QEXI 2DODA 1HCRA 2BXYA 4I76A 1MGTA 1WJEA 4PFOA 3JRHA 1V5EA 3HRMA 3LAJA 1FIAA 3GFIA 4WPYA 3J7AG 2N8GA 4PGHA 1XS9A 3F8FA 4A12A 2ZXWH 2LMZA 1VQ9I 3A2KA 2XGXA 4MTDA 1G59A 1A1GA 1G2FC 3K4JA 5C4JJ 4R8HA 5KNLA 4BQQA 4R79A 1A1HA 1TTYA 4ETSA 2ZXHA 2Y0SA 1SANA 2FMYA 3CESA 2QUFA 2M1BA 1I94E 4A2UA 2L0KA 4M6XA 2UZKA 2I8DA 3S15J 4R2DA 2JA6J 2H09A 3H0GJ 4KA4A 1JKRC 1WJCA 2HOTA 3ASNH 2CH0A 1J0RA 2ADUA 1NH3A 5KL2A 2UXNA 3SEQA 4JX4A 2LJHA 2YU5A 2EPRA 4JV5E 3IWBA 3OMYA 2A6TA 2OCCH 5FD6A 2EPFA 2ECCA 3OS1A 4C3IJ 1PUFB 1HF0A 5AE3A 2LG4A 4ZYEA 2E60A 4E7ZA 3OYCA 4C2TA 3K1PA 2DCEA 4DR5E 1N32E 2DA3A 4N4RB 1X6HA 1U5TA 5CYVA 2JPCA 1U3EM 5JFRA 1KQ8A 3OTOE 2DT7B 2EMBA 3FXLA 2R7TA 4DW6A 2MDRA 3BDDA 2FA5A 3QOPA 3U21A 1E0EA 1FOXA 3J80K 4H0EA 4KT6A 3LA7A 4YFXF 3EPZA 1KU3A 4KN4X 4IZZA 2NVXJ 1HDDC 3ASOH 2OD5A 2JOBA 2L6MA 3G2BA 2JR1A 3S1MJ 2MLGA 1FMVA 5HNFA 1XMQE 2EMZA 3OS2A 2M9AA 2DQLA 4WXCA 2QENA 2YPNA 1X19A 3K2AA 2VC0A 1NK3P 2E1CA 1YE9A 1EF4A 2EPZA 2KRCA 2AHQA 4D1QA 1RUOA 1Z7UA 4XOTA 4NXME 2I10A 4R2PA 3B6AA 2Q1ZB 3PUFA 5FLVA 1A1FA 2X6XA 3PM1A 4FISA 3TGNA 2P5KA 5HS9A 1K6YA 2MD5A 2YT4A 3QYBA 1ULYA 3J7Yp 2K27A 1X2MA 1R1UA 1ZKGA 1Z9CA 5IXMB 4ESBA 4BE1A 4I2OA 3VYXA 1A1KA 2FD5A 4XORA 2HQAA 1FOKA 1UFMA 1TC3C 5E1WA 4M6VA 1YZ9A 2YTJA 2KIMA 2X51A 2EP3A 2O61A 3BC8A 4CCJA 1AWCA 1W7PB 3Q0VA 2QKMB 3ISPA 2QQ8A 2H6CA 3I58A 3AFHA 3G1MA 1R5ID 1SC7A 1VQ4I 2GAUA 2KFDA 2QA4I 1CQTA 2PI0A 1U9NA 1G2DC 5GADJ 2ZMEA 3GTMJ 3JTGA 2IS2A 1IBME 5F3WA 4EQQA 5J1YA 4C2UA 2M8EA 2EILH 2JSCA 3GMEA 5F6FA 4HG2A 2EBIA 3JTHA 2EOMA 2EOJA 2V83A 3KP3A 4B44A 2EMIA 3IWDA 5KL3A 2Q2EA 4UXNA 2KJCA 4ZYHA 4AC0A 4E7HA 2VT2A 5E17F 3ADGA 1Z67A 3C2HA 3MKZA 1B8IA 2CGPA 1XMKA 4JI0E 2L02A 1ETKA 3CO6C 2HC5A 4LLLA 1WGXA 2MH2A 2JP9A 2W1OA 3TEDA 2ZCWA 2K3FA 4O4KA 4L5IA 1V5GA 2JSPA 2K5CA 1HW1A 4P7DA 4MGRA 4QTRA 3ECHA 1M1EB 2ZSIB 3D5LA 4A3KJ 3ROUA 3V8LA 1X47A 2EL5A 2DDBA 4E6KG 3QYEA 2LRSA 2B7EA 3KP2A 2VQLA 3HKZA 1VTNC 4BNCA 4FK5C 4RLFA 3ZOBA 3HRTA 1WI3A 3I64A 3BTJA 3H9QA 1RNLA 3WTYC 3KZYA 4KN7X 1P7IA 5IV8B 1BIAA 2ELYA 1YOVB 1K83J 3E6BA 2JVAA 3K4LA 5LD2C 4Q5SF 1U2WA 4B3ME 2XASA 1E2XA 2E5ZA 2EM0A 4BCAA 4HV6A 3TKYA 2EPMX 4A69C 1N36E 1IV8A 3HOSA 2D2WA 1T08B 3CTAA 3QPSA 1Z0XA 4XMYA 2RS7A 2HOSA 4K2EA 3K2ZA 3CCJI 2QQ9A 4BAYA 2FTXB 4KNYA 3ZMDA 2GA1A 5A2QK 1GQEA 5TGTA 2K9NA 3IH3A 2UUAE 1J9IA 3SJMA 2PJRA 2F6CA 3ERED 2D1HA 2EM4A 3VSLA 4F91B 2VBWA 1D1BA 3OYNA 3OYDA 4DYQA 2B7TA 3LLHA 1TLHB 1K7AA 4UV8A 3GX4X 1MBFA 4IOAF 2YX4A 1MH4A 1YW8A 1XN7A 2YSPA 3K4NA 1B72B 2OTJI 3WODF 1ZYRF 4L9NA 1J59A 5GAHJ 2HVQA 3LSHA 4MFDA 4MQVA 3WTSC 2AQFA 3AKZA 4L9JA 1XGOA 1JKPC 2CQXA 2VL8A 1ETWA 1AAYA 3V7SA 3GXOA 5FLMJ 3ADLA 1HKSA 2Y0MA 3VOEA 4RB2C 2QBYB 2EE8A 4U88A 1ZLKA 4LIVA 3ABTA 5IYCJ 4HEA2 5J4YA 3IUOA 4R2SA 3O8GA 2NVQJ 2EPCA 3P7NA 1JK2A 1OCPA 5KL5A 1JKQC 1XDSA 3KIOA 4LOCA 2HYFA 3BQZA 4OIRF 1QO0D 2O8KA 1SAXA 5FLXZ 2NS8A 2BEOA 3I3LA 4S04A 2LVHA 2DSYA 4BC9A 3K4CA 2MW8A 1HDPA 4WK8F 2B9SA 4KUMA 3LA2A 3FIGA 2OQGA 2GZWA 5LBQA 2K4BA 1KYQA 3I55I 2KLOA 4X62E 3S16J 1LFUP 2EOFA 1STUA 3AL0B 2YWQA 5D5VB 3L2QA 2ELHA 2GM4A 1IUYA 4S05A 4PZJA 3OIQA 2W00A 3CMAI 3IP4B 5LGUA 1IRZA 2AQEA 2R7VA 1FNNA 3K4BA 5DUIA 5LEKA 2EMXA 4IRHA 2X9DA 1UG2A 2M8GX 5ICEA 3CCVI 3W6JB 2WZOA 3LSMA 1FLIA 2M7AA 2RQPA 4G6TB 2ZNZA 1I5ZA 4I99C 4HLYA 4UVCA 3HOUJ 2HXOA 3L2WA 2BV6A 5F08A 4RDUA 1L3LA 1ENHA 4ENMA 2V4JC 1IN8A 2H1KA 3M8JA 3BR2A 3ZQGA 2XPWA 2LRDA 2AXTC 2E1MB 4N4OB 1WHNA 5J40A 2NOJB 5H2FC 2E34A 2JN6A 4A3IJ 4AQYE 3PQKA 4DR2E 1PUFA 4U0WA 3TO6A 1D1AA 4HX8A 2VQFE 3C3WA 2JTVA 5EEAA 2BOLA 3OYEA 1ZGWA 3UK3C 4BKXA 1IC8A 4B48A 3BOQA 2CFOA 2KP6A 4HPQA 1U5TC 2X48A 2BGCA 2XHKA 3G1OA 3W6KB 4DZJA 4UB6C 3NAUA 3E6CC 5KL4A 1SEUA 3F6OA 2W48A 4A5NA 1ZU1A 2XAQA 4KFCA 1KONA 2RAEA 3RYRA 1ZELA 4CGZA 2XC7A 1VQ6I 4D5FA 2EL6A 1RR7A 1KYZA 1VQ5I 2UV1A 3FZVA 3HC7A 2XF7A 4IRGA 5LEJA 3SHFA 3EUKL 1UCRA 1MMGA 3MKYB 4XIDA 1DGRM 2FRHA 3M99B 5CVRA 1GVJA 1RI7A 2VJ4A 4E7SA 3CLOA 1D5YA 2CW0F 2IRFG 1GDTA 1EH8A 2VJIA 3EPLA 1YTYA 3SDGA 2K86A 2ZNYA 3AV0A 2YTQA 3QPHA 2LDUA 3JREA 2W25A 2Y69H 4HYEA 2K9MA 4O5GA 1CGPA 3DF8A 2A69F 4DNCA 4DOZA 1N34E 2PG4A 5F0CA 3GTGJ 1ZAOA 3ZGKA 2EIKH 1Z1DA 1ZH5A 3H5NA 1IN7A 1OMIA 4BBYA 3GTJJ 2XGCA 2VBYA 5HDKA 1FMWA 3F6GA 2D1VA 4AUXA 2Z9OA 3GF2A 4IHYA 1TZLA 4B09A 2A05A 3BG5A 1ORKA 3WU0A 1EH7A 1WQ2A 3QRFF 4FHTA 2Y9YA 3ML6A 1FYMA 3N4MA 1DGWY 1DU6A 2RN7A 4FT8A 3C4TA 3JAMZ 2EK5A 1QZYA 3DBLB 1IJWC 1OLTA 2ZMEC 2GXAA 4IHSA 4HNUA 2DW4A 3OYBA 4OMYA 4IXAA 3ABMH 2PLYA 3H9JA 2BW3B 2R3SA 4AIJA 2BZTA 3LAPA 2VN2A 3LNQA 4PFPA 4LU9A 1NHAA 2COMA 1QA6A 3GO5A 2KZVA 5H6RA 2UWMA 4M9XA 2M7BA 4MEXF 4L5JA 1KA8A 4PDKA 2VE8A 3J81Z 1Z1BA 1WKMA 4Y7NJ 3Q0UA 2XAHA 2L92A 4G6QA 1R58A 3T5XA 1PKPA 2STTA 2X6WA 3S8PA 2EOXA 4JBAA 3HM5A 1NK2P 4AD9A 5FKLA 2LK2A 3PFYA 1WCMJ 2F48A 3K1NA 2HPMA 1UBDC 3L2VA 3FXRA 2OPTA 2NVYJ 5TRDA 5DUKA 3IC7A 1B6AA 3DXJF 5D6EA 4KHPE 2DA2A 1N3GA 2KONA 4Y3OA 4M2ZA 3LOCA 3K4MA 1FBSA 1TNSA 2WY8Q 4DR6E 2GLOA 2K02A 2ELJA 4HAMA 3VHTB 5D4SA 1W0TA 2LJUA 4BGDA 5FROA 1P7JA 3U9GA 3DWLE 4HLXA 3PFIA 3DBHB 2EN6A 1V3FA 4LF5E 2ZJ2A 2R93J 4BUPA 1SD4A 2ISYA 5J1UA 3S32A 4AIDA 3LSPA 3IKTA 1Y8QB 2JUGA 4XRMA 1K4TA 4BEHA 3CCQI 2M2EA 2L7KA 2VLAA 2DFFA 1QPMA 3SZPA 4BS9A 1YX3A 4IX7A 1ZBTA 3P1XA 1A6IA 1KGSA 3BCBA 4V2GA 2R7DA 1RC9A 1UELB 4UB8C 4BACA 3EPKA 2NABA 1F1ZA 4J00A 4RM3A 2XPVA 1FBUA 5FKOA 1JKOC 4A3GJ 3C18A 4AU7A 4B3RE 1G4DA 3QQAA 4XKBA 1SR9A 3CD6I 4JX5A 3T1BA 1GHCA 1L0OC 4FASD 2OC6A 2UXXA 3MMYB 1RIOH 3CCEI 5DV5A 1B69A 2VASA 1D0XA 4KT5C 5CKTA 3K69A 4L0ZB 2P8TA 2BYVE 2STWA 2XB0X 1MBKA 2M3AA 2MC3A 1MSEC 2OAZA 5DD8A 2P6TA 4OAZA 4ENKA 2V9VA 5IOYA 2TCTA 1X1AA 3OR1C 1ZR4A 1BW5A 2YTDA 4P78A 2HDWA 1ETXA 5E3OA 4CICA 2QBYA 4A3LJ 2DA4A 3ESWB 2NOGA 4YIFA 3Q5FA 2LH9A 2YTGA 3S2WA 1QVUA 3DJWA 2WV0A 4EGYA 1APLC 2CW7A 2YPRA 2O8XA 3GVAA 5K1YA 1YSAC 2EQRA 1D8KA 2R5ZB 2VPRA 4GYGA 1K78B 1VQ8I 2EWLA 5KHDA 3GZ6A 3F8CA 4BE0A 1VFCA 3DKXA 2BVMA 4CH7A 4WX9A 2FJ1A 1JUSA 3L9FA 2EPOA 4A5MA 3T1HE 2F8BA 2K4VA 5E3LA 3DQVC 3TP0A 1BBGA 3FWEA 3CC2I 2KHXA 3J80Z 3REOA 2V79A 1MIJA 4RMNA 4Y33A 3V8JA 5BS6A 4HF2A 2IGOA 2L33A 1IBKE 2UU9E 2L4AA 3VYUB 3LSKA 2HYJA 4C3JJ 3EYIA 3WTTC 3MQ0A 2C6YA 2YR2A 2L2MA 1Y39A 3J81K 4F52A 4M0VA 4ASNA 3KEOA 5CLSA 1MNMC 4WWCA 1DPRA 4F9BB 3MWMA 2ENAA 5A6KA 1I6XA 1YG2A 1P4WA 1WHUA 2KMUA 4WSPA 2YU8A 1QU3A 4X66E 1MW7A 5EYRA 2NYXA 2MDGA 4X6AJ 2DTZA 4AYBA 3OR2C 4O24A 3M8EA 2CYYA 1PJRA 1X58A 4G7OF 1AU7A 3J7AO 4OU0A 4TUGA 2HGHA 4MLQA 1VQPI 3SDBA 2OF7A 3HDDA 3C6MA 5KL7A 3QU3A 2E1MA 3BG6A 3K9TA 2DQRA 5F1JA 5E3MA 2LREA 3I4MJ 1USSA 2V6EA 5LMUE 1XSXA 2D45A 1TF6A 2XF6A 4R03A 3PQJA 1KJKA 4LF6E 2WAQA 2DI3A 4RAYA 4MIMA 2E2HJ 2FMLA 1XC5A 4IRIA 1W5SA 4U87A 1GUUA 3V42A 2B63J 2DA7A 4XRFA 4G7ZF 2ENCA 2EM8A 1X3WB 3RTRA 1BBOA 4MTEA 3CCYA 4I02A 4XRSG 4LIUA 1WFXA 3HEFA 4P1WA 3AAFA 5AC4A 3VK6A 2Z99A 2DMNA 2BHZA 3BZKA 4L9TA 3L2UA 3B02A 3E5XA 3R60A 1YRNA 3U2RA 2EQ1A 4E7IA 3ZMTA 2YS9A 1RMDA 1JT6A 4YELA 3S2DJ 1QGPA 2VKDA 1YX5A 3RKWA 2KHMA 3I0TA 4F7ZA 4XLNF 3HHHA 3TP3A 1PP7U 1FYLA 2R5YB 1Z3XA 1A1LA 1UHSA 4NQWB 3BBGA 4PGGA 2E7XA 2WBTA 2KIQA 1MJBA 4M3BA 4QSHA 3FX3A 1X6FA 3ELKA 1LQ1A 3JW4A 4B4CA 1MMSA 1A1IA 5AIPA 1LFPA 1POGA 4X9JA 1LEAA 3BTIA 4JQFA 2Y48A 3RQ4A 2CSHA 3ZN0A 4TUIA 3CCLI 4NHJA 2KQRA 3JCUC 3N05A 2A68F 3V7CA 1ITYA 2DMIA 1WJAA 5TSEA 5ADZA 1F43A 3ABLH 1BR1A 1Z91A 4KMFA 2EOIA 4NZVA 4LFAE 4Q47A 2UUCE 3ZXSA 4DYRA 2ADRA 1N77A 4BMJA 3FHZA 2I9IA 3M4OJ 3CCRI 1YUJA 2QLZA 4JOMA 1TL8A 4XOPA 1MBEA 4CUGA 4F92B 1VNDA 3I4PA 3N97A 2RREA 2ZSHB 3HOYJ 5C44J 1ZTRA 4ZYGA 3BZ6A 2RQLA 2P4WA 3K4KA 1A31A 1HNWE 4ZZLA 2GHFA 4EEFG 3RKQA 2BW3A 3P9KA 4EM2A 1B4AA 5FFXA 5KVRA 4HA8A 3WTUC 2IPQX 2RV8A 1UHZA 2L3JA 3FHNA 2DA5A 4J01A 2EOOA 3QP6A 2YTIA 2LKPA 1QU6A 5A2QZ 3PSFA 3TW6A 1R4NB 2NS0A 3H1CA 1LDKB 5K5OA 3P9IA 5E8IA 5L3CA 1T2KA 1ZRCA 2D5VA 2EOSA 5K7HA 3LMLA 2W85A 2CWEA 2JWTA 2W7NA 2HDDA 2KIFA 3U1DA 2EL4A 3RPQA 5F0HA 4F55A 2KRFA 4N9HA 1N78A 3E7LA 4I6ZA 2GWRA 1MJ9A 4M72A 1Y0UA 5BMZA 3LSGA 3H3VK 1KU2A 3L2RA 1OCOH 2F4VE 1ZREA 1W0UA 5EGOB 5DTDA 2TDXA 2VBXA 4F93B 2EM6A 5LHIA 2FV4B 2G7HA 3QPLA 2LTPA 3KP5A 2WC2A 3H35A 2O9LA 4LLGF 2F4MB 3C2BA 3FXUA 4B8XA 1J5YA 3QYFA 3F8MA 5EEGA 4ZC3A 4CYCB 1JUMA 1ZG3A 4HX7A 1GZ6A 4OINF 1IDYA 2JPAA 1S9HA 4P55A 4A0XA 1S72I 2EN7A 2W24A 3KEQA 3JRGA 1AKHB 1TT0A 4XN0A 3OYKA 2DK8A 4RGUA 3F23A 1K61A 4MLOA 4IHWA 3DU6A 2HVRA 3ZQ7A 1DI2A 2F5DA 2HU9A 3OSFA 2KL4A 3QAHA 2XGEA 2LUPB 1SMTA 1ERDA 2EPAA 3MHSC 3FDYA 4BXFA 4TV7A 4DR3E 2WAFA 2QGUA 4I0AA 2LBFB 1O7LA 1R6RA 4EJOA 2CS3A 3HPHA 5HVQC 2V87A 4M71A 1P6RA 4RS8A 3RJPA 3SYTA 3ZQIA 4XK4A 3ZQHA 3PIPF 3B73A 1QNTA 4DR4E 4JI1E 1R00A 4PK4A 2QSFX 5E1XA 3GZNB 1XNQE 2NUGA 2RS6A 3E3VA 2E5NA 3BROA 5B1AH 2LKXA 3FF5A 1YW9A 5GPCA 2OA4A 1G3SA 2AS5F 1DPUA 1FP2A 1E17A 4BL0B 2VXZA 1KU9A 2PMZN 3OYHA 3CDLA 4LD5A 4LG3A 1T56A 5F27A 3V4GA 4DMIA 4RGSA 1PJSA 2IS1A 2VPLA 3BIDA 2GLIA 2DMYA 2FNPA 4DZPA 5BNGA 2EMWA 2NRAC 1A1JA 4LF8E 3MKWB 2YTEA 3HOWJ 5E1ZB 2DXIA 5LGNA 3DLAA 4II3A 1E3HA 2EZHA 4PCQA 2R5ZA 4RBOA 3HTXA 1BI0A 1K78A 1A35A 4CYDA 2RNGA 2A3SA 4LFCE 1RKWA 2EZ6A 3L00A 2GXBA 5J4VA 4XLAA 1J7KA 3TL4X 3GFJA 4D7NA 4LFUA 1BBYA 4CO8A 2XV4S 3KEYA 5FD5A 2NUFA 1Y8RB 3GEZA 3IKVA 4BH9A 3VYYA 3F72A 2VQGA 3V8KA 2HWVA 2EMCA 4MLVA 4DV4E 1WH5A 1YIOA 2IS4A 3C4BA 4LMYA 2Y9ZA 3AL0C 2IVMA 2HFHA 5M5WJ 2YZTA 3Q9SA 1TNTA 1WXRA 1U8RA 1PJTA 2OTLI 3PO3J 3AG1H 4Y13A 4F6MA 3K70D 1IUFA 1VQOI 5C3EJ 5E8GA 3MKLA 1AOYA 3IRRA 1P92A 4GRIA 4G7HF 2XROA 1G2HA 5AE2A 4YIRX 1R1VA 2EFQA 1MD0A 2P6SA 1PDAA 5CJ9A 1ZBQA 4Q28A 2JA2A 3H3ZA 5LGTA 3OOPA 1IV6A 2F5EA 5HODA 2IGNA 2A5YB 3FKIJ 3FK6A 3HTSB 4M3EA 4IOCF 2E5LE 1N33E 1JHFA 1LKXA 5FGMA 1SD5A 1U8BA 2BXZA 5HS8A 2OBPA 3I54A 3JRBA 4A3CJ 3OYJA 5J47A 1LB2A 3F6HA 1RESA 3BQYA 1TQIA 1Y1VJ 4V19K 1ZR9A 5A6JA 4LLNA 1FY7A 3BG7A 2QVOA 3IWFA 4EV0A 1LNWA 1DU0A 5IT9K 5J1RA 1Z05A 1XGSA 3CF2A 5LFAA 3E5UA 3CQZJ 3AG4H 4XSXF 2MLKA 3DEUA 1SFKA 3I5UA 3CUOA 2LY2A 3R4KA 3CCMI 5BPDA 2IAIA 3NWTA 3S3NA 4G94A 4NB5A 3J7YJ 2CW8A 2DLKA 4HZFA 3CDHA 2W4SA 3K6QA 4WCGA 5FFZA 3VYTB 3K10A 3RIRA 5M5YJ 2WAEA 2JY9A 4D5CA 1QHHD 1BN5A 3BG3A 3KZZA 4M73A 5B5EC 3BJOA 4L8NA 4Q35B 4DV0E 3LSRA 2LKSA 3SXYA 1MBGA 2GIVA 5E79C 3VDXA 2HOEA 1CF7B 2JUCA 4A0ZA 3FMSA 1G6NA 4DBQA 4R2QA 1YFHA 2NXNB 1D0ZA 2A25A 3R0AA 1MH3A 4HF0A 3D0SA 4CSWA 3PIOF 5ICGA 2L9NA 2QYOA 2EOHA 5EZGA 5TISC 2R5YA 5EG0B 2DLQA 2WBUA 2P5VA 3ZRGA 3HGYA 4NQWA 5DCMB 2WBMA 3M9AA 1X49A 3M1EA 4OAYA 1MMNA 3HL2A 3HBLA 3WGGA 4OX9E 3F8BA 4ZDLA 4EM0B 4WYQB 2EZIA 3GCMA 2VOOA 4IHTA 1D3YA 3KYLA 4Y52J 2Q8UA 3THOB 2X4HA 2WB1A 1IBLE 2WWYA 3B6CA 2DIXA 4BYYA 4XICA 2B0LA 4E7JA 3EQ1A 2X1CA 1WJDA 2L54A 4W1UA 3TOBA 1O4XA 1R23A 1ZLJA 1WJFA 2CUFA 3EYYA 2K7IA 2L9RA 3A02A 5IY5H 3QODA 2FSWA 3E6DA 4B3SE 2DU9A 2JVHA 5JHFA 2R1FA 1HBXG 2I13A 2ZJRF 3I4NJ 2JWOA 4HRIA 1S7EA 1T98A 3HOTA 1IO2A 2XPUA 2DOEA 4YEJA 5DS9A 4JP0A 1U6GA 1ZN2A 2RVCA 3A1YA 2LMDA 2W57A 2DA1A 4NC6A 2R7QA 3OYGA 1F5TA 1SD6A 1GV2A 2EIJH 4PJJA 2Y0SN 3CO7C 1W4MA 1ZARA 3BR0A 2R0QC 2DPUA 3CC4I 3HOXJ 1G8XA 2N3GA 5BPIA 2F4IA 2RQQA 4BBRJ 4XLHA 2FBHA 3HRSA 4OIPF 2V89A 3R61A 3C2GA 4B47A 3FXKA 3HGGA 3JR9A 1RETA 3A03A 3OOUA 1PP8F 1V5FA 1ZGJA 5HOOA 4J19A 5A69A 4Y15A 3RYPA 2EWNA 2FXAA 2ZJQF 4JYAE 1B59A 4HV5A 3CF5F 1RPWA 5AE1A 1QZEA 1XG1A 4LGWA 4KICA 3WU2C 3RZOJ 2A07F 3EPHA 2DLLA 2G7UA 4XSZF 1D8JA 1R1TA 1X3CA 1ZK8A 1S3JA 3HG9A 4BY1J 1I3AA 2BE5F 2O03A 4O5VA 3FM5A 5KAIC 5EGOA 1JXSA 4E4HA 3LSTA 5K5QA 2ZM6E 2VE9A 3GTPJ 4XL9A 1MNDA 1XMAA 1ZG5A 3OSGA 4JI7E 2X1EA 4LF4E 3T8RA 4ZYDA 1YYVA 2H6BA 3BGHA 2VBZA 4O3MA 2XAUA 3BR5A 2DMUA 2KJBA 2HXIA 4F6NA 2ECBA 1YHQI 2DRPA 4U0VA 4CYCA 2L7FP 1W7PA 2L01A 2Y30A 3ZCOA 3EDPA 5L3GA 3W2WA 4PSXA 4EJTA 2EM5A 2KZGA 2HJJA 2LBSB 2VUMJ 4CCKA 3DU5A 4NHRA 1AKHA 2Q8KA 1JHHA 2XDVA 4LJZF 5DDGA 1YJ9I 1ETQA 1P4AA 3HOVJ 3I53A 2R76A 5JR3A 3TQMA 2YU3A 3LFKA 3DLLF 1TF3A 2CV1A 2CO5A 2M4KA 1Z77A 2DN0A 2LBFA 2LR8A 5DNYA 2OU2A 4ZZDA 1ONVA 3PJRA 2X0LA 2QZ8A 2CQNA 1UHMA 2DMTA 4ABZA 2HPIA 5ILVA 2VT3A 3K70C 1Z3YA 5H6QA 2O6GE 2YUSA 4NNJA 1LDDA 1JI8A 4MFEA 1QBJA 4OIOF 1AA7A 3E5QA 1T38A 2L9VA 1S6LA 1UAAA 3CMMA 4Z6YA 1WWXA 5FB2A 2ME0A 3WHCA 4IL6C 3I71A 4V2FA 4C30A 2UXCE 5EJCA 2R4GA 4HEIA 2Y2ZA 1P2FA 4HQEA 4AIKA 2K85A 4HDVA 3D5RC 2L2OA 1BB8A 3HB9A 2ZKZA 1FTTA
chains in the Genus database with same CATH topology
1R5GA 2QQAA 1FBQA 1K79A 5CVJA 3BPXA 1J2XA 2EFOA 2CSOA 3MZHA 2OQRA 1W7PD 3TDUC 2FNAA 1ZRDA 4Q4ZF 3MZYA 1MZBA 1ODDA 2RC4A 4HQMA 2K7LA 2O0YA 3LA3A 1SMYF 1O7FA 2HGCA 1BIBA 5AONA 5L3DA 4ENNA 3Q9VA 1XCBA 3GFMA 5HLIA 3HTUA 2P7VB 5TJJA 1GXQA 3F22A 3LQQA 4L0YB 1W5TA 3GZ5A 2ZMEB 1ZGAA 1V4RA 3GFLA 2V1XA 2PMUA 4AIHA 3TOAA 1H0MA 3GLXA 1OR7A 3WTVC 3WU1B 3H92A 4BHCA 3ZPLA 1FT9A 5H20A 3TO9A 2FBIA 3DKWA 3GWZA 2ISZA 3T8TA 3ZMSA 1OYWA 2HKOA 2LNBA 2CG4A 2ZFWA 1CF7A 2LF7A 2MA3A 2HTJA 4UVAA 5D8KB 1O3QA 3GW2A 2RNJA 3I59B 1BI2A 5DCMA 3MAJA 1HW5A 3IL2A 1SFUA 1O3SA 2ETHA 1KYWA 3F6VA 2GA2A 3KP4A 5D8LB 4LG0B 3WGHA 1BC8C 1BC7C 4KDPA 1HKQA 2ACJA 1ZRFA 4MNUA 4E70A 3ZP5A 2VOPA 1FSEA 1G3WA 4IF4A 1REPC 4XBFA 1A04A 2A61A 3MEXA 4FX0A 2XAFA 4A0YA 2IA0A 3KFWX 1TW2A 5ILUA 2EJRA 2PMHA 1MJAA 4UV9A 5HLGA 1DP7P 4IJAA 4GYIA 2Y75A 2EV5A 1PUEE 2DBBA 1YW7A 4P9FA 2EV6A 4ESJA 2RKHA 2HQRA 1C0WA 2HEOA 3COAC 2PBIA 2HYGD 2FE3A 4ZH4F 2XKOA 2Z5UA 4OMZA 3R6SA 2EFWA 3G73A 2GXGA 1EH6A 4JK1X 4HF1A 3WE3A 4GCVA 3HYIA 1BM9A 1R5HA 3BJ6A 1R36A 3GYHX 2NNNA 3HSRA 5ED4A 3TQNA 4ON0A 1XD7A 1T6SA 5EEHA 2P5LC 4LB5A 1STZA 3QU6A 1HSTA 3BP8A 4G6DA 2F2EA 2E7WA 4L18B 2L3DA 3E97A 3BY6A 4BXUA 5LRRA 3RI4A 3LWFA 3RKXA 1FX7A 4RGRA 4QWQA 5ILSA 5J6XA 2MH9A 5D5WB 3JSOA 3RPUA 4Q48A 4GXOA 2XUBA 4BQAA 3DPTA 1Q1HA 3O6BB 4U7DA 1USTA 2CFXA 2QM3A 4WXDA 3EUHA 3ZMVA 2HR3A 4WF2A 1OYIA 5J8CA 2QQBA 1HSJA 1IRGA 4YFKF 1LJ9A 1S8NA 5BQTA 4I01A 5ICFA 3CUQB 4AVPA 5IT9Z 3WTWC 3HIFA 3G3ZA 1Z6RA 3SZTA 4MHGA 3O3KA 1BOAA 1XB4A 1RUNA 3QP5A 2XKPA 2H27A 2L4MA 2H94A 1FWZA 5J8FA 1YS6A 1T0FA 1FZPB 4KIGA 2HKXA 2EFNA 2KKOA 2NAZA 1I1GA 4U0YA 2JZYA 1FYKA 3R0JA 4MQ9F 4EJWA 4CHUA 1QZZA 1JGSA 2J5PA 3EQLF 3GUDA 3C1DA 4HOBA 2RDPA 3WE2A 2M45A 1YO5C 2PEXA 2JPBA 1KQ0A 2ZXJA 2XIGA 3BPVA 2VONA 4WXHA 3ULQB 5JI6A 3L09A 1XGNA 3HUGA 1TW3A 3P9CA 1D5VA 1F9NA 1XCVA 2HS5A 3VFZA 1MDMB 3ZN1A 1ON2A 2DO7A 2V6CA 3DFGA 4GO1A 2IA1A 4EGZA 1T39A 1DDNA 1F4KA 1H9GA 5CVIA 2Q0OA 5LLQA 1FPQA 3L7WA 4EJUA 4KIBA 4YFNF 2F5FA 1BI1A 2WTEA 1ON1A 1ZG1A 4UVBA 1LEBA 3I59A 4LB6B 2CQKA 3MFKA 1KQ9A 4LG0A 1OYYA 5IT3A 4I7HA 5HDGA 4UHTA 2EFPA 4KMUX 1XSVA 3KLOA 2YX7A 2FEZA 1LVAA 1SFEA 4I09A 1IAWA 5ERIA 2GQQA 3TO7A 5D6FA 2IT0A 1G3TA 4U7BA 1BJAA 3IWZA 1U78A 4I0BA 5JVTA 3WGIA 1UB9A 3VB2A 4XLPF 3IHUA 2IP2A 2J5OA 2Z33A 1Z6TA 1I27A 1HQCA 3ABUA 4I98B 4AWXB 3L2CA 1BI3A 5LRSA 3K1MA 2VODA 4UUVA 5K5RA 3BWGA 1IF1A 5DYMA 1YS7A 4M9SA 1HXDA 3LQRA 2M5WA 4LK0F 1P4XA 4CXFA 2XVCA 1S7OA 2OZ6A 1DUXC 2HQNA 2IW5A 1I1SA 2ESHA 2DK5A 4CDGA 4R1HA 5ICCA 3C7JA 2DAOA 4G8XA 1OKRA 2A6EF 4FX4A 1GXPA 1RZ4A 4L9VA 2HTSA 3MCZA 5E18F 1S7AA 1KU7A 2FBKA 1O57A 2XRNA 4YG2F 1B9NA 4HBLA 3HHGA 3O2PE 2LF8A 5F64A 2FQ3A 2F5CA 2R7FA 3DP7A 5HS7A 1B1BA 1QQIA 2PFBA 1SD7A 4M9ZA 5FO5A 5LHHA 2XAJA 4ENJA 3CUQA 4N0BA 3VEPA 2E1NA 3ECOA 1HW2A 1LDJA 1ZHFA 4M74A 1WI9A 1O3TA 2M87A 4MEYF 3WTZA 3VODA 3M8FA 1OPCA 1WRJA 3SQNA 3KLNA 3K0LA 4RGXA 4O6JA 3DV8A 4G9YA 5DCFA 2K4JA 2G9WA 4DQ2A 4EVIA 3BJAA 5L3BA 4RAZA 2RGVA 3HSEA 2JRTA 3KP6A 4D0PA 3JSPA 1WSUA 1FP1D 5FLXK 3HRUA 4OIQF 3WTXC 3HSFA 2Z3YA 2FOKA 1TQMA 1U5TB 1IN5A 2DFIA 2AXLA 3RDIA 1MDMA 3RKYA 5D5UB 2EA2A 1EV7A 3SFZA 3E6MA 5D5XB 1S29A 1SFXA 2PN6A 2HDCA 3ZMUA 2A6HF 1IXCA 1XDUA 4A6DA 1R22A 5CVUA 1FSHA 1UHWA 4UNOA 2HZTA 5CVVA 5E20A 5L3FA 5AIQA 2DPDA 1YLFA 5KK1A 3EETA 2M30A 2FF4A 4CZZA 6PAXA 4QLCU 2ZBKA 4BHBA 3IRQA 1XSDA 4N9IA 5DD4A 1IZ1A 1IW7F 3TDZC 4M6YA 4IPAA 3NEUA 1H9TA 1FC3A 3T0YA 4HDUA 4Z2YA 3DPLC 5F1RA 2O3FA 4KIFA 5BOXA 2V1DA 2P7CB 1B9MA 2JT1A 2LSOA 4HW0A 4GGGA 4BHPA 1TBXA 4A6EA 2OZUA 5HLHA 3M7GA 3FM3A 1K6OA 4P9UA 1IXRC 2PQ8A 4OOIA 5JHUA 2EV0A 5L3EA 2VC1A 1IN6A 4RB1A 3FMQA 4YIIA 3F8NA 1JE8A 4Y17A 3NQOA 4LK1F 3CJNA 3JAMK 2IA2A 4ESFA 2XAGA 2V1UA 4KYWA 5LHGA 4RB0A 1YQAA 2BBYA 3KETA 3F3XA 3ZMZA 1R7JA 5DEQA 1PDNC 1HKTA 3H3UA 1G3YA 2ESNA 3KE2A 5HDNA 1IXSB 2EA4A 4P5OA 3QPTA 4EM1A 2W84A 2KIUA 3FMRA 1J75A 2EB7A 4RB3C 4IVNA 2IJLA 3FXQA 1TQPA 3OV8A 3NRVA 2YSRA 2FU4A 3KCCA 5D4RA 3F21A 2ZO4A 1O3RA 1MKMA 1IN4A 3WG9A 1XGMA 2DTRA 2DT5A 2NNYA 1IRFA 3KP7A 4EMSA 3V7RA 1X3UA 3CUQC 4P96A 4HX4A 2QWWA 2MBFA 2PJPA 4EJVA 1MGTA 3LAJA 3HRMA 3GFIA 4PGHA 3F8FA 4A12A 2XGXA 4MTDA 4R8HA 4R79A 1TTYA 4ETSA 2FMYA 2QUFA 2M1BA 4A2UA 4M6XA 2UZKA 2H09A 4KA4A 1J0RA 2ADUA 2UXNA 5FD6A 4ZYEA 3K1PA 1U5TA 5CYVA 2JPCA 1U3EM 5JFRA 1KQ8A 3BDDA 2FA5A 3QOPA 3J80K 4H0EA 3LA7A 4YFXF 1KU3A 4KN4X 2OD5A 2MLGA 2DQLA 4WXCA 2QENA 2VC0A 2E1CA 1RUOA 1Z7UA 3TGNA 2P5KA 5HS9A 2MD5A 1ULYA 2K27A 1R1UA 1Z9CA 4ESBA 4I2OA 1FOKA 1UFMA 5E1WA 2KIMA 2O61A 1AWCA 1W7PB 3ISPA 2H6CA 3I58A 2GAUA 2PI0A 2ZMEA 3JTGA 4EQQA 2M8EA 2JSCA 5F6FA 3JTHA 3KP3A 2Q2EA 4UXNA 2KJCA 4ZYHA 2VT2A 5E17F 2CGPA 1XMKA 2L02A 3CO6C 4LLLA 2MH2A 2ZCWA 4L5IA 1HW1A 4MGRA 3ECHA 3D5LA 3ROUA 3V8LA 3KP2A 1VTNC 4BNCA 3HRTA 3I64A 1RNLA 3WTYC 3KZYA 4KN7X 1BIAA 3E6BA 4Q5SF 1U2WA 2XASA 1E2XA 4HV6A 3TKYA 3HOSA 2D2WA 3CTAA 4K2EA 3K2ZA 2QQ9A 4BAYA 4KNYA 3ZMDA 2GA1A 5A2QK 1J9IA 3ERED 2D1HA 2VBWA 1TLHB 1K7AA 4UV8A 3GX4X 2YX4A 1YW8A 1XN7A 3WODF 1ZYRF 4L9NA 1J59A 4MQVA 3WTSC 4L9JA 1XGOA 3V7SA 3GXOA 1HKSA 2Y0MA 3VOEA 4RB2C 2QBYB 4U88A 1ZLKA 3ABTA 3P7NA 1XDSA 2HYFA 4OIRF 1QO0D 1SAXA 5FLXZ 2BEOA 4S04A 4WK8F 4KUMA 3LA2A 2OQGA 2GZWA 5LBQA 2K4BA 5D5VB 2ELHA 1IUYA 4S05A 4PZJA 5LGUA 1FNNA 5DUIA 5LEKA 4IRHA 5ICEA 3W6JB 1FLIA 2RQPA 2ZNZA 1I5ZA 4HLYA 4UVCA 2BV6A 1L3LA 4ENMA 1IN8A 3PQKA 4U0WA 3TO6A 4HX8A 3C3WA 2JTVA 3BOQA 1U5TC 3E6CC 2BGCA 2XHKA 3W6KB 3F6OA 4A5NA 2XAQA 4KFCA 3RYRA 4CGZA 1KYZA 3FZVA 4IRGA 5LEJA 3SHFA 1UCRA 2FRHA 5CVRA 1GVJA 1RI7A 3CLOA 2CW0F 2IRFG 1EH8A 1YTYA 2K86A 2ZNYA 3QPHA 2LDUA 2W25A 4HYEA 1CGPA 3DF8A 2A69F 4DNCA 2PG4A 1ZAOA 1Z1DA 1ZH5A 1IN7A 1OMIA 2VBYA 5HDKA 2D1VA 2Z9OA 3GF2A 4B09A 3WU0A 1EH7A 1WQ2A 3QRFF 4FHTA 3ML6A 1FYMA 3N4MA 2RN7A 4FT8A 3JAMZ 2EK5A 1QZYA 4IHSA 2DW4A 4OMYA 4IXAA 2PLYA 2R3SA 4AIJA 3LAPA 2VN2A 1NHAA 2COMA 3GO5A 5H6RA 2UWMA 4M9XA 4MEXF 4L5JA 1KA8A 4PDKA 2VE8A 3J81Z 1WKMA 2XAHA 4G6QA 1R58A 3T5XA 2STTA 4JBAA 4AD9A 3K1NA 3FXRA 5TRDA 5DUKA 3IC7A 1B6AA 3DXJF 5D6EA 1FBSA 1TNSA 2K02A 4HAMA 5D4SA 3U9GA 4HLXA 3PFIA 1V3FA 2ZJ2A 1SD4A 2ISYA 3IKTA 1QPMA 3SZPA 1KGSA 2R7DA 1F1ZA 1FBUA 3C18A 1G4DA 3T1BA 1GHCA 1L0OC 2UXXA 1RIOH 5DV5A 4KT5C 3K69A 4L0ZB 2P8TA 2BYVE 2STWA 2MC3A 2OAZA 5DD8A 2P6TA 4ENKA 2V9VA 2QBYA 4CICA 4YIFA 3Q5FA 3S2WA 2WV0A 4EGYA 2YPRA 2O8XA 3GVAA 5K1YA 1D8KA 4GYGA 1K78B 3GZ6A 3F8CA 4WX9A 3L9FA 4A5MA 3DQVC 3FWEA 3J80Z 3REOA 2V79A 5BS6A 3V8JA 4HF2A 2L4AA 3EYIA 3WTTC 3MQ0A 2C6YA 2YR2A 3J81K 4ASNA 3KEOA 5CLSA 4WWCA 1DPRA 3MWMA 1I6XA 1YG2A 1P4WA 2NYXA 3M8EA 2CYYA 4G7OF 3J7AO 4OU0A 3QU3A 3K9TA 2DQRA 1USSA 1XSXA 2D45A 3PQJA 2DI3A 4RAYA 2FMLA 4IRIA 1W5SA 4XRFA 4G7ZF 3RTRA 4MTEA 4I02A 3AAFA 2Z99A 4L9TA 3B02A 3E5XA 3R60A 3U2RA 3ZMTA 1QGPA 3RKWA 3I0TA 4F7ZA 4XLNF 3HHHA 1PP7U 1FYLA 4PGGA 2E7XA 1MJBA 3FX3A 3ELKA 1LQ1A 3JW4A 5AIPA 1LEAA 4JQFA 2Y48A 3ZN0A 4NHJA 2A68F 3V7CA 4KMFA 1Z91A 4Q47A 3FHZA 2QLZA 3I4PA 3N97A 4ZYGA 3BZ6A 2P4WA 4ZZLA 3P9KA 4EM2A 1B4AA 5FFXA 5KVRA 4HA8A 3WTUC 2IPQX 2RV8A 3QP6A 2LKPA 5A2QZ 5K5OA 2NS0A 1LDKB 3P9IA 5E8IA 5L3CA 1T2KA 1ZRCA 2W85A 2CWEA 2KIFA 3U1DA 3RPQA 2KRFA 4N9HA 2GWRA 1MJ9A 4M72A 1Y0UA 5BMZA 1KU2A 1ZREA 2TDXA 2VBXA 5LHIA 2G7HA 3KP5A 2WC2A 4LLGF 3FXUA 4B8XA 1J5YA 3F8MA 5EEGA 1ZG3A 4HX7A 4OINF 4P55A 4A0XA 2W24A 3KEQA 3F23A 2DK8A 4RGUA 3ZQ7A 2F5DA 3QAHA 1SMTA 4TV7A 4I0AA 1O7LA 4EJOA 5HVQC 4M71A 1P6RA 4RS8A 3RJPA 3B73A 1QNTA 1R00A 5E1XA 3E3VA 3BROA 3FF5A 1YW9A 1DPUA 2OA4A 1G3SA 2AS5F 1FP2A 1E17A 2VXZA 1KU9A 4LD5A 3V4GA 4RGSA 2FNPA 2NRAC 5E1ZB 5LGNA 4PCQA 1BI0A 1K78A 4CYDA 2A3SA 3L00A 2GXBA 1J7KA 3GFJA 4LFUA 1BBYA 4CO8A 2XV4S 5FD5A 3GEZA 3IKVA 4BH9A 3F72A 3V8KA 2HWVA 1YIOA 4LMYA 2IVMA 2HFHA 3Q9SA 1TNTA 1U8RA 4Y13A 5E8GA 1AOYA 3IRRA 1P92A 4G7HF 2XROA 1R1VA 2EFQA 1MD0A 2P6SA 5CJ9A 3H3ZA 5LGTA 3OOPA 2F5EA 2A5YB 3HTSB 1JHFA 1HBXG 5FGMA 1SD5A 5HS8A 2OBPA 3I54A 1LB2A 1TQIA 4LLNA 1FY7A 4EV0A 2QVOA 3IWFA 1LNWA 5IT9K 1Z05A 1XGSA 3E5UA 4XSXF 2MLKA 3DEUA 3I5UA 3CUOA 3R4KA 5BPDA 4G94A 4NB5A 4HZFA 3CDHA 4WCGA 5FFZA 3RIRA 1BN5A 3KZZA 4M73A 3BJOA 3SXYA 2GIVA 2HOEA 1CF7B 4A0ZA 3FMSA 1G6NA 1YFHA 3R0AA 4HF0A 3D0SA 5ICGA 2QYOA 2P5VA 4NQWA 5DCMB 3M9AA 3M1EA 3WGGA 3F8BA 4EM0B 2VOOA 4IHTA 1D3YA 2X4HA 2WWYA 4BYYA 2B0LA 3TOBA 2L54A 1R23A 1ZLJA 3EYYA 2FSWA 3E6DA 2DU9A 1T98A 3HOTA 1U6GA 1ZN2A 2RVCA 2W57A 1F5TA 1SD6A 3CO7C 1W4MA 1ZARA 2DPUA 5BPIA 4OIPF 2FBHA 3HRSA 3R61A 1PP8F 1ZGJA 5HOOA 4Y15A 3RYPA 2EWNA 2FXAA 1B59A 4HV5A 4LGWA 4KICA 2A07F 2DLLA 2G7UA 4XSZF 1D8JA 1R1TA 1S3JA 2BE5F 2O03A 4O5VA 3FM5A 1JXSA 3LSTA 5K5QA 2VE9A 1ZG5A 1XMAA 3T8RA 4ZYDA 1YYV