4BHBA

Crystal structure of mycobacterium tuberculosis o6-methylguanine methyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
165
structure length
165
Chain Sequence
b'MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies of the Mycobacterium Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 50
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhbA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhbA01
2FNPA 1JE8A 1BI1A 5E8IA 4I0AA 1BI0A 1ZARA 1YW7A 4XSXF 4PGGA 3J80Z 4Q47A 4MQVA 3GX4X 1Z9CA 1E17A 1R36A 4ZYHA 4BHPA 1QZZA 3L9FA 5IT3A 4A5NA 1X3UA 2OQGA 5CVUA 2CSOA 2IP2A 2ZO4A 3EETA 3VFZA 2XASA 2HTJA 3F6VA 4TV7A 1DPUA 5E1XA 4YFXF 4RAYA 3M8FA 3LQRA 2FXAA 5DCFA 2G7UA 2QQBA 1P92A 4CHUA 3DP7A 4HOBA 2EJRA 2M87A 1RIOH 3MCZA 4U0WA 1O3RA 1KQ8A 4YIIA 4UVCA 5EEGA 3HRUA 2UZKA 2R7DA 3C1DA 4O6JA 2KRFA 3GZ6A 3E3VA 4LK0F 3COAC 4RAZA 1FP2A 3FF5A 4WF2A 3L09A 5ILUA 3Q9SA 3M1EA 2YX7A 1TBXA 1LNWA 1W5SA 1ZG5A 1T2KA 2B0LA 3KLOA 1IRFA 4U0YA 2OZUA 3ABTA 5E20A 3U2RA 1SFXA 2Z5UA 1S3JA 1K79A 4I0BA 1D3YA 2YX4A 4RB3C 3BP8A 1RUOA 1K78A 1RI7A 4L0YB 1W5TA 1YFHA 3BZ6A 2OAZA 2QQ9A 1ODDA 3ZPLA 3FMQA 2DT5A 2EWNA 4KMUX 1FSHA 2WWYA 1LDKB 2XGXA 1F4KA 2XV4S 4AIHA 1RUNA 2L54A 3TO6A 2QBYA 2XAHA 3HRTA 3PQJA 2GWRA 5L3DA 1ZYRF 5HLHA 1R58A 2HGCA 3DPLC 4L5JA 1Z6RA 1FYKA 5A2QZ 1C0WA 4WX9A 2EB7A 2D45A 1O3QA 3FWEA 4BH9A 1BJAA 3GFJA 3KETA 2BE5F 2KKOA 4L9NA 2NAZA 4HX4A 1TW2A 3WODF 5D8KB 2ISZA 5DCMA 2DK8A 2FMLA 3F23A 3O2PE 3DKWA 3KP2A 4EGYA 3AAFA 4N9HA 3ECHA 1FPQA 1Z1DA 5FB2A 1I5ZA 2VBYA 2JZYA 3J80K 3WGGA 2F5DA 4M6XA 4RB0A 3EUHA 3LA2A 2ZFWA 5FD6A 4LMYA 3F8NA 1ZLKA 3P7NA 3SQNA 2P6TA 1HKQA 1IXRC 1S8NA 5D8LB 4MEXF 4LLNA 2HQNA 1IN7A 1P4XA 5LRRA 2XVCA 2X0LA 2NNYA 1MGTA 4QWQA 4CDGA 1ZAOA 3QP5A 4EM2A 1AOYA 1QQIA 3IRQA 2L4MA 1FYLA 5E18F 3P9KA 3WGHA 1L3LA 3HIFA 2KJBA 3IWFA 2CWEA 2IT0A 1LDDA 4I01A 2FF4A 2AXLA 4DQ2A 2KIMA 1PP7U 1BIAA 5FFXA 4LGWA 4HA8A 2VT3A 3CUQA 3JAMZ 1YS6A 2XKOA 3Q5FA 1R5HA 3I54A 4GYIA 1LJ9A 2LKPA 3RPQA 1YS7A 1H9TA 4HF2A 1SD6A 2MH2A 2EV5A 3BY6A 5HLGA 6PAXA 1G4DA 3SZPA 2QLZA 2XKPA 3FHZA 4MHGA 4HLXA 4ESBA 4A0ZA 1J7KA 3ZN1A 3BROA 2W85A 2G7HA 3H3ZA 5TJJA 1YW8A 2A68F 3R61A 1FNNA 2IA0A 3Q9VA 2HDCA 3RDIA 3HSFA 2GA1A 3TGNA 2F2EA 2M5WA 1A04A 1GXQA 5D4RA 1U5TB 4EJUA 4ETSA 3U9GA 1SFEA 3CTAA 3LSTA 4KT5C 3QP6A 4LFUA 5A2QK 2ELHA 4KIFA 1SMTA 2VOPA 3T0YA 4ENJA 4ENKA 3K0LA 3LWFA 1KYZA 3TKYA 1HKTA 2H6BA 4JQFA 4S04A 1SD5A 1YYVA 4OIRF 2D2WA 3QRFF 1K6OA 2VXZA 4EMSA 1G3YA 2L3DA 2EFNA 3TQNA 1DP7P 4ESJA 4R1HA 1OR7A 4G6QA 3P9CA 3WTZA 5BS6A 3GF2A 4EGZA 4XLPF 5K5QA 1F5TA 4WWCA 1B59A 5E1WA 5H20A 1SD7A 5ERIA 1G3SA 3SFZA 1O7LA 4R79A 4FX0A 3C7JA 1QPMA 1EV7A 5LHGA 3ECOA 1QO0D 3G3ZA 4IHTA 2GZWA 1ON2A 1U8RA 1W7PD 4UHTA 1YO5C 4PGHA 2ZBKA 1XSDA 5LEJA 3IKTA 5D6FA 3V4GA 4FHTA 5FFZA 5AONA 1S7AA 1KU2A 4LJZF 1BC8C 1XDSA 4PCQA 3CUOA 2J5OA 2K86A 3TDUC 1W7PA 1DUXC 3WGIA 3HSRA 5L3EA 3B02A 3MZYA 1LB2A 2VOOA 3F21A 2P7CB 2RQPA 4M9XA 2OU2A 4G7OF 1WKMA 1S6LA 3GFIA 2GAUA 3JAMK 1KGSA 2RVCA 4YFKF 1IW7F 4Z2YA 1U78A 1QBJA 2FE3A 2OZ6A 3BJOA 4G8XA 3E5UA 3R0AA 4L9TA 1HBXG 5E17F 3DQVC 3LFKA 1MZBA 1R5GA 4QLCU 4HDVA 5JI6A 1HQCA 1GXPA 5K5OA 2JT1A 2DW4A 5KVRA 1IN4A 1I1GA 4EJWA 4D0PA 2HYFA 3KFWX 3FM3A 1BBYA 3ZMDA 2VT2A 4XRFA 4G9YA 2FA5A 1YTYA 1O57A 4CGZA 1MJ9A 1USSA 3TDZC 4ASNA 3CLOA 1J2XA 2P7VB 1ZGAA 3FXUA 2YSRA 2FBIA 4RGXA 2V1DA 3HUGA 1RZ4A 4XLNF 5JFRA 2Q8KA 4BXUA 2L4AA 2XHKA 2D1HA 3ZMZA 3GUDA 3HOSA 2HKOA 2STWA 4UVBA 3TOAA 2DQLA 4HV6A 2FBHA 4M74A 2NRAC 4U7DA 1JHFA 3KEQA 1KQ9A 1IN6A 5LHHA 5JVTA 5J8FA 1YLFA 2M45A 1P4WA 4KDPA 3BPVA 3V7RA 3T5XA 2LNBA 3KP4A 1SMYF 2IVMA 2EK5A 3VEPA 2IA2A 2RN7A 1IAWA 3RYPA 2IA1A 1B1BA 2ZXJA 1R23A 2YR2A 3E5QA 4HF1A 3SXYA 1GVJA 1U5TA 4ZZLA 3KP3A 2Q0OA 3H92A 1NHAA 4MQ9F 3DV8A 2E7WA 2R7FA 2LSOA 3REOA 2PMUA 2M1BA 2K27A 5AIPA 1EH8A 1JXSA 1UHMA 1U5TC 5LBQA 2F5CA 4M73A 2BV6A 2ETHA 1HKSA 4HBLA 3SHFA 2BGCA 1U3EM 1ZG3A 2W25A 4HAMA 3ZMSA 3ZN0A 2DK5A 3K1MA 1VTNC 4IHSA 1RNLA 3GFMA 4BYYA 5BOXA 3VODA 1LEBA 3F8BA 4RS8A 1ZG1A 1PP8F 1OKRA 4L9JA 4UXNA 2OQRA 4HDUA 3D5LA 2PJPA 1XCBA 3K69A 2YU3A 5DUKA 3G73A 3RKWA 3RJPA 3BWGA 4G94A 3IWZA 2ZMEB 4L18B 4KMFA 2UXNA 1WRJA 3WTYC 4RGSA 3F8MA 2C6YA 3I4PA 1LQ1A 1ONVA 4P9UA 1SD4A 4IF4A 1DPRA 4EJOA 3KEOA 3KZYA 2Y75A 1YG2A 3K2ZA 4YFNF 3E6MA 2FEZA 3ZP5A 3HTUA 2MLKA 3HHHA 1XCVA 2WTEA 2FNAA 2JRTA 1H0MA 4M9SA 4OU0A 5CVVA 2A3SA 4KN7X 1MDMB 1O7FA 4L5IA 4H0EA 3WG9A 4GYGA 2OBPA 4YIFA 2STTA 1UFMA 3RI4A 4AWXB 5CYVA 1OYWA 3KE2A 3GWZA 2V1XA 5L3GA 4O5VA 3F3XA 3MWMA 2PLYA 1TQMA 4P55A 2KIUA 3EDPA 5HVQC 1Z6TA 3RIRA 1J9IA 4BHCA 5HS7A 4MTDA 1XGOA 2CG4A 1T6SA 4Y15A 3KLNA 2A69F 2QZ8A 3CDHA 2CFXA 2V6CA 1FWZA 1J59A 4CZZA 1T38A 3RKYA 1B9MA 4LG0B 5E8GA 2Q2EA 4A0XA 3EYYA 3FZVA 3TO9A 3MQ0A 1XD7A 1O3SA 1T39A 4ESFA 4HQEA 5HLIA 2HR3A 2W57A 3H3UA 2Z3YA 4Q48A 4XBFA 3GEZA 5DDGA 3E6BA 3F22A 1B9NA 1TNTA 1D5VA 2NS0A 2DLLA 3GYHX 1YW9A 1GHCA 5H6QA 1YQAA 2QVOA 4UUVA 3GO5A 4UV9A 2Z9OA 3HTSB 3V8LA 4F7ZA 4M72A 2J5PA 1ZH5A 2JTVA 2M30A 4OINF 4E70A 4GO1A 1BIBA 3V7SA 4HX8A 3V7CA 2QQAA 3R60A 3J7AO 4A0YA 3BOQA 5CVJA 2ZKZA 1J5YA 2HKXA 2GXBA 3ZMTA 3JSPA 5HS9A 2V1UA 2GIVA 1OPCA 2P6SA 5ICCA 1MKMA 3HRMA 2BBYA 5LEKA 2VE9A 4L9VA 3I5UA 3FMRA 2UXXA 3ML6A 2K02A 3MFKA 2EFQA 3ISPA 2PFBA 1OYYA 2V9VA 4ZYGA 1IXCA 1P2FA 1HW2A 4L0ZB 1LVAA 3FXRA 1U2WA 1BI2A 1MJAA 4LLGF 4NQWA 2H6CA 4Q5SF 4HLYA 1KU3A 1BOAA 2A5YB 4CXFA 1IF1A 2FMYA 2EV0A 1BI3A 2RC4A 3T1BA 3ROUA 1FC3A 2QUFA 2ESHA 4IJAA 1K78B 3CO7C 3MEXA 2E1NA 1Z05A 4U0VA 2EFWA 3GW2A 3LA7A 2LF8A 2VC0A 5J6XA 2HOEA 2VBWA 2IRFG 5D5UB 3RPUA 5H6RA 5BPDA 2QBYB 1KA8A 2DAOA 1PUEE 1TW3A 3JW4A 3WU1B 1DDNA 4IRGA 5D5XB 5DYMA 2IPQX 1IXSB 1ZREA 1SFUA 1XGSA 3TO7A 2CYYA 3ULQB 5ICFA 1D8KA 1ZN2A 2RDPA 3E6DA 1K7AA 1REPC 5ED4A 1G6NA 4A2UA 1P6RA 2RNJA 3R0JA 1ON1A 3WE2A 5DCMB 4YG2F 2PQ8A 3I71A 4Q4ZF 3HOTA 1ZRCA 3KCCA 2CO5A 4Y13A 5D5VB 2MD5A 4NB5A 1MDMA 2VODA 5FGMA 1XDUA 1Z91A 2FU4A 4KIGA 3WTUC 1PDNC 4CYDA 2HTSA 4M9ZA 2MH9A 2MA3A 5D5WB 1ZHFA 3KZZA 3L00A 2RGVA 2WV0A 1XMAA 1YIOA 1IN8A 4KA4A 5IT9Z 2DBBA 3LA3A 3VOEA 1I27A 1CF7B 5KK1A 4B09A 4BNCA 2Y48A 1U6GA 3QU6A 3L7WA 1O3TA 2O6GE 4BAYA 2XROA 3JTGA 3VB2A 4RB1A 2AS5F 1FBQA 2FBKA 2DPUA 5ICGA 3DF8A 2ESNA 2NNNA 5ILVA 3F8CA 4N0BA 1P4AA 1STZA 3I64A 4I7HA 4KICA 4ON0A 3QPHA 1OMIA 1S29A 4LD5A 2F5FA 4G7ZF 2CW0F 3CUQB 3ZQ7A 4GGGA 2FOKA 4MGRA 4KNYA 2Y0MA 1Q1HA 1XGNA 1HSJA 1R00A 5L3FA 2CQKA 4LLLA 3M7GA 3R6SA 1UCRA 4Y17A 3WTXC 4DNCA 2VBZA 2FQ3A 2VE8A 2W24A 2HWVA 3J81Z 3GZ5A 4PZJA 4EJVA 4JK1X 4HF0A 3KP6A 5BMZA 1FLIA 3KP7A 3MAJA 2JPCA 3FMSA 2Z33A 2MC3A 1FZPB 1G3TA 2GXGA 3HYIA 4U7BA 3RKXA 3E6CC 1FBUA 2BEOA 4ZYEA 5LGNA 1ZLJA 3C18A 1S7OA 2PMHA 4AIJA 1HXDA 3P9IA 4M71A 5DD8A 4B8XA 2ISYA 1TNSA 2K4BA 3JTHA 3KP5A 3O3KA 4OMZA 4HX7A 4AIKA 3WU0A 2P5KA 4EVIA 1J0RA 1SAXA 3BPXA 2XUBA 4A6DA 2HQRA 2FRHA 3QOPA 5EEHA 1I1SA 1B4AA 1HW1A 3EYIA 2HZTA 3IC7A 1T0FA 5HS8A 5HDKA 4HYEA 1FBSA 5LGUA 4EM1A 3I0TA 5FO5A 5DEQA 3V8KA 2LDUA 1MD0A 2O3FA 4EQQA 3S2WA 1F1ZA 2DFIA 3W6JB 2O8XA 4R8HA 2H09A 4OIOF 1CGPA 2EFPA 3C3WA 5CVRA 3DXJF 2HFHA 2DO7A 1KU7A 4HZFA 1MJBA 3E97A 1BM9A 3I53A 1WSUA 1V3FA 4ENNA 3K9TA 4A12A 3WTVC 3OV8A 4CO8A 2QYOA 3NEUA 4IVNA 3I59B 2D1VA 5JHUA 4P9FA 2A6EF 2PEXA 4WXDA 5IT9K 2EA2A 2QWWA 1V4RA 1R1UA 3IRRA 2M8EA 2PG4A 3ERED 3RYRA 2H94A 2O61A 3FXQA 3QAHA 1TQPA 5LRSA 2XRNA 4KFCA 3ELKA 4IXAA 1R1TA 1W7PB 3WTWC 4G7HF 2P4WA 2DU9A 4U88A 3O6BB 2XIGA 1F9NA 2P8TA 2PBIA 2VONA 2A61A 2BYVE 4M6YA 3F8FA 3NQOA 1LDJA 3ZMUA 2COMA 3BJ6A 2JSCA 2ZCWA 5BQTA 5TRDA 2ACJA 1WQ2A 3D0SA 2OA4A 1IRGA 2HS5A 4O3MA 2V79A 3QU3A 4I09A 1B6AA 4AD9A 3J81K 2ZNYA 1JGSA 4ZZDA 1L0OC 5JR3A 1KU9A 5DV5A 2HEOA 1KYWA 4CICA 4EV0A 1QGPA 3BJAA 5K1YA 2QM3A 1CF7A 3LQQA 4NHJA 4MNUA 3N97A 1ULYA 4K2EA 2ADUA 3PFIA 1H9GA 2R3SA 3CJNA 2IJLA 1R7JA 5CJ9A 4RGUA 3GVAA 2GA2A 4LB5A 1FT9A 5D6EA 5FLXZ 3R4KA 4HV5A 4P5OA 3M9AA 2DPDA 1IUYA 3DPTA 4WK8F 2L01A 2CGPA 1E2XA 2ZJ2A 4IRHA 3MZHA 4OOIA 3NRVA 2H27A 4A6EA 3K1NA 3GXOA 5J8CA 2DI3A 1USTA 2E1CA 1J75A 1AWCA 4ENMA 2DQRA 1EH6A 2F5EA 2K4JA 3IHUA 4RB2C 1R1VA 4RGRA 3CUQC 2RKHA 2E7XA 4MEYF 4LB6B 2X4HA 3ABUA 1FSEA 4I98B 4KYWA 2VN2A 5L3BA 1EH7A 4S05A 2TDXA 1IZ1A 3PQKA 4GXOA 5AIQA 5D4SA 4JBAA 1QNTA 2XAGA 2K7LA 5FD5A 3JSOA 2VC1A 5E1ZB 3M8EA 2UWMA 3WTSC 2A07F 1FYMA 2DTRA 1FY7A 5HDGA 4WXCA 2O03A 3HSEA 3T8RA 3W6KB 3GFLA 4IRIA 2L02A 1XMKA 4IPAA 1D8JA 3OOPA 5BPIA 4A5MA 1HSTA 2O0YA 3SZTA 2JPBA 5HDNA 2PN6A 1TTYA 1KQ0A 4KIBA 4FT8A 1BN5A 2EV6A 4FX4A 3FM5A 1Y0UA 2QENA 1XB4A 1WI9A 4ZYDA 3IL2A 3WTTC 4UNOA 3RTRA 4OIPF 1TLHB 4EM0B 2EA4A 4KN4X 3V8JA 2XAQA 1FX7A 1G3WA 3B73A 5CLSA 3EQLF 5F6FA 1FP1D 2OD5A 4OMYA 4I02A 5DD4A 4BQAA 2ZMEA 4HW0A 5ICEA 4EJTA 3LAPA 2G9WA 2MLGA 3T8TA 1XSXA 1IN5A 2W84A 3I59A 1I6XA 3ZMVA 3K1PA 1OYIA 5LHIA 2HYGD 1WWXA 1XN7A 3U1DA 3DEUA 5LLQA 2ZNZA 4N9IA 4LK1F 1LEAA 4AVPA 1R22A 1XGMA 4GCVA 2XAFA 2EFOA 1UB9A 1ZRDA 2WC2A 4UV8A 1TQIA 3BDDA 5L3CA 1BC7C 4XSZF 3CO6C 5FLXK 2KIFA 3F72A 4BHBA 5F64A 3N4MA 3E5XA 2YPRA 4KUMA 3GLXA 4P96A 3I58A 4I2OA 3TOBA 3FX3A 2VBXA 2FSWA 1W4MA 2A6HF 1JHHA 1ZGJA 5ILSA 3DFGA 2LF7A 1Z7UA 5LGTA 3L2CA 2GQQA 3HRSA 5DUIA 3HHGA 1ZRFA 3QPTA 4MTEA 5K5RA 2MBFA 1FOKA 2PI0A 1T98A 3WE3A 5F1RA 4G6DA 1QZYA 3LAJA 2RV8A 4LG0A 2XAJA 2Z99A 4HQMA 5CVIA 5HOOA 2P5LC 4PDKA 1UHWA 4OIQF 2NYXA 2P5VA 3F6OA 4WCGA 4UVAA 4WXHA 2IW5A 2KJCA 4ZH4F 1HW5A 3IKVA 1XSVA
chains in the Genus database with same CATH superfamily
2FNPA 1K4TA 2EOQA 1G2HA 3T1HE 1JE8A 3S1RJ 1BI1A 2ID6A 4DW6A 3CC4I 5E8IA 4J19A 2EMFA 4PJMA 3C4BA 4I0AA 1BI0A 1ZARA 3GBGA 1YW7A 4XSXF 4PGGA 2E34A 4BGDA 3HDDA 5IP6A 3J80Z 2ZB9A 4Q47A 2W00A 4MQVA 4PJNA 3GX4X 1NK3P 1Z9CA 2JA7J 1E17A 3KEYA 1R36A 3C6MA 4KJZA 2EMYA 2YTFA 4ZYHA 4DUYE 2GOXB 4BHPA 1OCTC 3ZQHA 1QZZA 3W2WA 3L9FA 3EQ1A 5IT3A 4A5NA 1X3UA 2LKXA 2OQGA 2B63J 5CVUA 3IH2A 2CSOA 2EQ3A 2IP2A 2ZO4A 2E19A 2LG4A 3EETA 3VFZA 3BR2A 2XASA 3M4OJ 1M1EB 2QKMB 3FDYA 2HTJA 3F6VA 4RH8A 2X1DA 4TV7A 1LE8B 1DPUA 5E1XA 2CTDA 2OPTA 1E3PA 4YFXF 3LNQA 3HOXJ 2B7VA 4RAYA 3CF5F 1G59A 1GUUA 3FBNB 1UJ8A 5H2FC 4JI5E 3M8FA 2ZXIA 3LQRA 2FXAA 2X1EA 4WSPA 5DCFA 1N34E 2G7UA 3MKLA 3LMLA 2QQBA 1P92A 1XC5A 5LMUE 4CHUA 4BC9A 1JJ8C 3DP7A 1HLVA 4HOBA 2EJRA 4RLQA 2M87A 4BJ6C 3MCZA 4J01A 1RIOH 2VUMJ 3GTPJ 4CA0A 4U0WA 1O3RA 2K9NA 2VKHA 3Q0VA 3PM1A 4LITA 4UVCA 4YIIA 5KAFC 1KQ8A 2YWQA 2IGMA 1FMWA 5EEGA 4ZDLA 1XS9A 1D1AA 3H5AA 2V87A 1MIJA 3HRUA 2B7TA 2UZKA 4PK4A 2R7DA 3KYDB 3C1DA 4O6JA 1Z3YA 2KRFA 4M3FA 3Q0WA 3GZ6A 3E3VA 1VQOI 4DKKA 2EN8A 2OV7A 4Y3OA 4LK0F 2E60A 1VQ8I 2EL4A 3COAC 4RAZA 1G2DC 2CUFA 2YRHA 2L8TA 1FP2A 3ZOQB 2DT7B 2LBFB 3FF5A 3OS2A 4WF2A 3L09A 5ILUA 2DMNA 3Q9SA 3GCMA 3M1EA 2YX7A 1TBXA 1X1AA 2L9NA 4IO9F 1LNWA 1W5SA 2YUSA 1ZG5A 1ZR9A 1T2KA 1JKOC 2LUPB 3P1XA 2B0LA 3H5NA 3KLOA 5A6KA 4LFCE 4G12A 1IRFA 4U0YA 2OZUA 4NQWB 5TGTA 3BTJA 3ABTA 4UB6C 5E20A 3S3NA 2H1KA 4GZNC 3U2RA 1Y1WJ 1WJBA 1SFXA 2R7ZJ 1PJQA 3PNTA 4RAGA 4DZJA 2OJED 4IJDA 1ZQ3P 2Z5UA 2EMGA 5GTIC 2WA0A 1S3JA 1K79A 4I0BA 4R2QA 1RPWA 2CFOA 2LTSA 1ETQA 1D3YA 5A6JA 2ELJA 2HXIA 2YX4A 4RB3C 5KL5A 1E0EA 3BP8A 1BBGA 1RUOA 1K78A 2VIXA 3BTIA 1RI7A 2EZKA 2L7MP 4AYBN 4F6NA 4L0YB 1U9OA 1FIAA 2CSHA 2RS7A 1W5TA 3QYBA 1YFHA 5CPRB 1UILA 3BZ6A 2OAZA 2QQ9A 2R7UA 1ODDA 3ZPLA 3FMQA 2EH3A 2DT5A 2EWNA 2WAFA 2MKNA 1ITYA 4KMUX 1FSHA 1X4OA 2WWYA 4BEHB 1LDKB 2XGXA 1F4KA 2XV4S 4AIHA 1RUNA 1HF0A 2HNHA 2L54A 1GZ6A 4X8WA 2I9IA 3TO6A 2QBYA 2EPKX 2ME0A 2XAHA 2CRGA 3HRTA 3EPJA 1AH5A 3CD6I 2BVMA 3PQJA 2XB0X 2GWRA 3NWSA 5L3DA 1N3GA 4A3KJ 3BR3A 1ZYRF 5HLHA 3UNGC 3HPSA 4IOAF 2OTLI 1R58A 2HGCA 3DPLC 4ZC3A 2X85A 4L5JA 1Z6RA 1FYKA 5A2QZ 1C0WA 4WX9A 1OCRH 2EB7A 2D45A 5CKTA 1XTAA 1O3QA 2IHR1 3FWEA 2VPLA 5DS9A 4E7ZA 4BH9A 1BJAA 3GFJA 3KETA 2BE5F 2KKOA 4L9NA 2JUGA 2NAZA 4HX4A 4A3MJ 2BY1A 1TW2A 3WODF 2MDGA 4B1RA 5D8KB 3DKXA 1JKPC 1VNDA 5J1RA 2EMLA 2ISZA 5GPCA 2TRTA 5DCMA 5GP9A 2DK8A 1F2IG 2LO3A 2FMLA 2HJJA 3F23A 4GFBA 2WY7Q 4KT6A 3O2PE 4JYKA 2NS8A 4JI7E 3DKWA 3KP2A 4DR5E 2KDZA 2CV0A 4EGYA 2LV2A 4DR4E 3AAFA 3HOUJ 4N9HA 1LKXA 2JRMA 2L7ZA 1TT5B 2GBYA 3ECHA 1AU7A 1FPQA 1Z1DA 5FB2A 3RKQA 1I5ZA 2VBYA 2JZYA 3J80K 1X3ZB 2CT1A 3WGGA 2F5DA 4M6XA 4RB0A 3RCOA 1TWCJ 3EUHA 1I50J 2Y9YA 3LA2A 2ZFWA 2M3AA 4AU7A 5FD6A 2Z1DA 1OCZH 4LMYA 2CUZA 3OMYA 3PNVA 2XF6A 2VKDA 3F8NA 1ZLKA 3P7NA 1OLTA 2UUAE 5J3LA 3SQNA 2P6TA 2ME6A 1HKQA 2EM7A 3L2UA 2LD5A 3CJTB 1DGCA 3ZOBA 1IXRC 3I4NJ 5C3EJ 1HCRA 1PYVA 2VQEE 1S8NA 2DFHA 5D8LB 3LMMA 4MEXF 4LLNA 2YTQA 4R2RA 4OOGC 2HQNA 1IN7A 1P4XA 5LRRA 1A1GA 2XVCA 4JI1E 2X0LA 4EEFG 3AKZA 2NNYA 4BXXJ 1MGTA 4CCKA 4F9BB 4QWQA 3BGHA 1Z21A 2E2JJ 4CDGA 1ZAOA 1BR1A 3QP5A 2BBGA 5AE1A 4EM2A 1AOYA 1QQIA 3IRQA 2L4MA 4NDLA 1FYLA 2O5RA 3M1CA 2KMUA 3RZOJ 5E18F 1SFKA 3P9KA 4V2FA 3WGHA 1IBME 1L3LA 3HIFA 2KJBA 1WXRA 2XAUA 3AL0B 3IWFA 2CWEA 4UB8C 3OYNA 3EPHA 3HUGB 3G71I 3TW7A 3GTJJ 2QSFX 2IT0A 2Z2SB 1WJCA 2NVQJ 4PSWA 1LDDA 3OIPA 4I01A 4X1EA 2FF4A 3ZQFA 4JI3E 2AXLA 3DTIA 4DQ2A 2KIMA 2QSHX 5AE3A 4X9JA 2GM4A 4HPQA 3E7LA 2MSYA 1PP7U 1T08B 3I3LA 1AKHA 1BIAA 4DV3E 2VXDA 5FFXA 1F36A 3PO3J 1QHHD 2UUZA 4RM3A 1JUSA 1ERDA 1R6RA 4LGWA 4IS1C 4AIDA 4BACA 4HA8A 2CV1A 2RQLA 3LSPA 3CCUI 3AG3H 2VT3A 3OOUA 1Z3XA 5E3MA 3CUQA 3JAMZ 1YS6A 2IS1A 4WSGA 1T56A 2XKOA 2LY1A 1A35A 2EMWA 3Q5FA 1R5HA 3I54A 3OYEA 4IHWA 2L92A 2NA2A 4GYIA 3CMEI 1LJ9A 1RR7A 2LKPA 3RPQA 3O8HA 4ANJA 1YS7A 1QA6A 2YU8A 2MW8A 1WGXA 2XF7A 1H9TA 3K4CA 4HF2A 1SD6A 3FXKA 4LF7E 3M07A 1MMAA 3ONQA 2MH2A 4PUSA 4BQNA 1AHDP 4U87A 2WB1A 2EMIA 2ECCA 2EV5A 2CJJA 2DDBA 3BY6A 5HLGA 6PAXA 5C4XJ 1G4DA 3SZPA 5GADJ 2JJ7A 4XNFA 2QLZA 2XKPA 3FHZA 2WBMA 4DR2E 4MHGA 4HEIA 1YJNI 1X1BA 4XKBA 2AHQA 4HLXA 4DGWB 1NCSA 3IAS2 1SVLA 2YSPA 5IT9C 3CCJI 4RLFA 3ADJA 4ESBA 2F4IA 4A0ZA 3SFIA 3IWBA 2K3PA 1J7KA 1LE8A 1MBGA 3ZN1A 3FXJA 4JI0E 2EPXA 3BROA 2W85A 3S93A 3OYGA 4D9JA 4E7SA 2EOZA 2G7HA 4D7MA 1VQKI 3H3ZA 4Z6YA 5TJJA 1A31A 3ERMA 1YW8A 2A68F 3R61A 2HOSA 1FNNA 2IA0A 3Q9VA 2HDCA 2L2KB 3RDIA 4A3GJ 3HSFA 2GA1A 3TGNA 3KZIC 2F2EA 2M5WA 2LFBA 3L1PA 4IHVA 1A04A 1GXQA 1X2MA 4IEJA 4NC6A 1X5WA 3K4MA 5D4RA 3CC7I 3I56I 1Z7LA 3QPSA 1KJKA 1U5TB 4EJUA 3ECRA 4ETSA 3U9GA 5IOZA 3LLHA 1SFEA 3CTAA 3LSTA 4KT5C 1B8IB 2ENCA 2R7WA 1D0XA 1POGA 1YE9A 3QP6A 2VJJA 2M7QA 2YTEA 4LFUA 2UXCE 2NXNB 2KT0A 2I10A 5A2QK 2DA4A 3PO2J 2MABA 2ELHA 4KIFA 1SMTA 2CQQA 2VOPA 5CFFE 4JX5A 3S17J 2LBFA 3T0YA 4ENJA 4ENKA 3IP4B 4LIVA 4HEA2 2EMZA 2L9RA 3K0LA 3LWFA 1E3OC 1KYZA 3TKYA 3LSRA 3I9V2 1HKTA 3THNA 2BXZA 2MFZA 2VQCA 2H6BA 2VJ4A 4JQFA 4S04A 1SD5A 1YYVA 3ABLH 4M6VA 4M2ZA 3M8JA 4OIRF 3JRBA 1ZAAC 3IH3A 2D2WA 3QRFF 1K6OA 4XMYA 2HPIA 9ANTA 5JHFA 5EGOA 1NH3A 3EPZA 4JYAE 2VXZA 4EMSA 1G3YA 1RC9A 3S15J 3IH4A 2L3DA 3L2WA 2EFNA 2AQEA 2R93J 1FTZA 3J81C 3AUZA 3TQNA 1DP7P 2D5VA 4ESJA 3P5JA 3K4KA 1N36E 3BR0A 4WFTA 4R1HA 1OR7A 4L5NC 1P9QC 3BF2A 3JRIA 3FK6A 4G6QA 1Y6IA 4CCJA 3P9CA 4I76A 1S7EA 4OAYA 3CQZJ 3WTZA 5BS6A 3GF2A 4EGZA 1WHNA 2VJIA 4XR6A 3BTLA 1X19A 5C44J 2DJNA 4XLPF 5K5QA 1F5TA 1YYOA 4WWCA 3MHHC 1B59A 5E1WA 2EOYA 1JK2A 2GOMA 4M30A 1A6QA 5H20A 1SD7A 4XRMA 5F1JA 1ENHA 4PJ0C 3FIGA 1MMNA 4NXME 5ERIA 1G3SA 4BCAA 1EKZA 5AC4A 3SFZA 1O7LA 4R79A 2FTXB 2W1OA 1YZ9A 3H36A 4M3BA 4FX0A 3C7JA 4BEHA 5T6JA 5AC5A 5KL6A 1QPMA 1EV7A 1DU6A 5LHGA 2E1OA 1Y39A 5A6BA 3ECOA 3DJWA 1QO0D 3G3ZA 3CDLA 2GZWA 4IHTA 2Q1ZB 1ON2A 1OFCX 1U8RA 3S1MJ 1W7PD 4UHTA 1WHQA 4LF6E 2LCEA 3ADLA 4F9AB 5B1BH 3OR2C 1YO5C 4PGHA 2EZLA 2ZBKA 2M34A 1ETKA 2JMWA 1VI0A 1XSDA 1X1PA 1WHUA 1TF6A 2ZJRF 3A4CA 5LEJA 3IKTA 1JGGA 5D6FA 4A93J 5IV8B 2EM8A 3V4GA 2M9HA 5GAEJ 4FHTA 5FFZA 1FKAE 5AONA 1S7AA 2EIJH 2EQ1A 2EMBA 1KU2A 2EZ6A 4LJZF 5J1YA 2EOFA 2VKEA 3J7AG 1BC8C 4LFBE 3SDBA 1XDSA 4FISA 4MO7A 1WJ5A 4PCQA 3CUOA 2J5OA 2DOEA 2K86A 3TDUC 5EDNA 1W7PA 1DUXC 3WGIA 2IEKA 3HOWJ 1MSEC 3HSRA 4F54A 5L3EA 3HC7A 3B02A 4DYRA 3MZYA 2L7KA 1LB2A 2BOLA 2VOOA 1AA7A 4QSHA 1S72I 4OWRB 1K4SA 3F21A 2P7CB 2RQPA 3H5RA 2OU2A 4M9XA 4G7OF 1WKMA 3W3CA 1S6LA 2ZC2A 3HGYA 4BQQA 2V4JC 1D1CA 2VLAA 3GFIA 2GAUA 1IUFA 3JAMK 2EL5A 2V85A 1KGSA 2H8WA 2RVCA 4YFKF 4HRIA 1ZBTA 1FMVA 1IW7F 2ODRD 3TP0A 4Z2YA 1I3QJ 1U78A 1QBJA 2FE3A 2OZ6A 3BJOA 4G8XA 2V7FA 2CS3A 3E5UA 3R0AA 4L9TA 4F9CB 2DMUA 2WZOA 3AG1H 1HBXG 5E17F 1ORKA 2JP9A 3DQVC 5IP9J 5FKMA 3LFKA 1MZBA 1R5GA 2ZM6E 5KL7A 4TUIA 2YTGA 4QLCU 4HDVA 3OWTA 2HHHE 4BE0A 4X64E 5JI6A 1HQCA 5FLMJ 1GXPA 5K5OA 2JT1A 2QQ8A 4ITVA 2DW4A 4FCYA 5KVRA 2QGUA 2CQ7A 1IN4A 1I1GA 2R7QA 2RQQA 4EJWA 3C4TA 2HU9A 4D0PA 2HYFA 3KFWX 3FM3A 1BBYA 4A3LJ 1OQYA 3ZMDA 2Q2EB 2VT2A 2WBSA 3A0HC 2V89A 4XRFA 4G9YA 1B69A 3UKGA 2XGEA 4XLEA 2FA5A 1MH4A 1YTYA 2L7FP 1O57A 2M1SA 4CGZA 4IL6C 1MJ9A 1USSA 3TDZC 4ASNA 2LVHA 3CLOA 1J2XA 2LRSA 2P7VB 1X1CA 2N8GA 3S3OA 4LG3A 1ZGAA 3FXUA 2YSRA 2FBIA 4RGXA 2V1DA 3HUGA 2EPMX 1RZ4A 2CQXA 2K9SA 4XLNF 5JFRA 1SEUA 2E36A 2Q8KA 3RZDJ 4BXUA 3DPUA 2L4AA 2KZGA 2XHKA 2KRHA 2EMCA 1MW7A 2D1HA 2V26A 3KX2A 3ZMZA 3H0DA 1I39A 4L5EA 3DEWA 3RSNA 3GUDA 1T8IA 1E3HA 3HOSA 2HKOA 5IPAA 2STWA 3AL0C 3HEFA 3OTOE 4UVBA 3TOAA 2DQLA 4HV6A 4R2EA 2LMZA 2FBHA 2DODA 4M74A 4A69C 2NRAC 2XSJC 4U7DA 4M0VA 3W2VA 4YY3E 2EPAA 1JHFA 3KEQA 1BBOA 1DQ3A 1KQ9A 1IN6A 5LHHA 5JVTA 4GKJE 1IGNA 1XMXA 5J8FA 1Y0NA 2E2IJ 2Q8UA 2E1MB 2X9DA 1YYKA 1YLFA 3CCQI 1OCCH 3MKYB 2M45A 1P4WA 2XDVA 4KDPA 1SR9A 1JTXA 2XPWA 1GT0C 3VSKA 1X3CA 3F6GA 2IBDA 4F92B 2RTXA 3BPVA 3V7RA 3ZCOA 3T5XA 2LNBA 4J8ZA 3KP4A 4R2SA 1SMYF 2A6TA 2IVMA 2EK5A 1H8AC 2CMPA 2BY3A 3VEPA 3OYJA 4LOCA 3L2QA 2IA2A 1UN6B 2JYAA 2IGOA 5J4VA 4E6KG 4LFAE 4NC7A 5B3SH 5F27A 3JTZA 5AASA 4XORA 4WYQB 3MKZA 2RN7A 1IAWA 2WAEA 2B9SA 1QVUA 3RYPA 2IA1A 1FJGE 1B1BA 2MG4A 2X6XA 2ZXJA 3AFHA 1L4SA 4C2TA 1R23A 5LL6R 2ELYA 5FKOA 2BY2A 2YR2A 3E5QA 3PIPF 3CJQB 3BG9A 5M5YJ 4HF1A 1N78A 3TEDA 2EQ0A 2LR8A 3TL4X 5EF6A 2ZJPF 3GTLJ 5FLXC 3SXYA 1GVJA 2Y31A 4E7JA 5EZGA 3L2RA 4N4RB 1U5TA 2EPFA 3KIOA 3HPZA 2F8BA 4ZZLA 3HG9A 1XNRE 3JRAA 3G2BA 3KP3A 2Q0OA 4D1QA 3VYRB 3H92A 1NHAA 4MQ9F 5E79C 3DV8A 2ENAA 3S14J 2P0WA 4UY8I 1V55H 2HDDA 2E7WA 2IGKA 2LY2A 2R7FA 2LSOA 3REOA 2PMUA 1WJPA 3H09A 2M1BA 2K27A 5AIPA 1EH8A 1JXSA 2EM0A 3QG5C 1UHMA 1U5TC 5LBQA 2F5CA 4M73A 2BV6A 2ETHA 1HKSA 4HBLA 3OSFA 4DV5E 2GLIA 4E7KA 4JI4E 3SHFA 1DI2A 2BGCA 1W0UA 1U3EM 2EPPA 1ZG3A 3C6KA 3DU6A 5KHDA 2W25A 4PFPA 4HAMA 1X58A 2DMTA 3ZMSA 2ZFUA 3ZN0A 4DIQA 2DK5A 3K1MA 1VTNC 2CPNA 4IHSA 2JXPA 5FKLA 1RNLA 3GFMA 4BBSJ 1V5FA 2LK2A 4BBYA 4QIWN 5ADZA 4BYYA 1XNQE 3BT9A 3ZXSA 5BOXA 1QU6A 3VODA 3D5RC 1LEBA 2XPUA 3F8BA 4RS8A 1OJLA 1ZG1A 1PP8F 2EOOA 1QPIA 2DA2A 1OKRA 1T0FC 3EUAA 1Y1VJ 4L9JA 4UXNA 2OQRA 2BW3A 4B43A 4JX6A 3HKZA 1TP4A 1YI2I 4HDUA 3DBRB 1CQTA 2HVRA 2DIXA 4ABZA 3H9JA 3D5LA 2B9DA 1A1JA 3CP2A 2PJPA 1XCBA 3K69A 3BCAA 2YU3A 5DUKA 4DR1E 3WG7H 3G73A 1YSAC 3RKWA 3BWGA 2A05A 4G94A 4RAFA 3IWZA 3RJPA 1BA5A 4RHBB 2ZMEB 4YEJA 5IYBJ 4L18B 3BQYA 4ZTFA 1EJ9A 1ETYA 4KMFA 3G1LA 1SVMA 1RR8C 1N33E 1GV2A 2UXNA 4F2JC 1VQ6I 1WRJA 3NARA 3MN2A 4PJLA 3WTYC 1S5LC 2YRKA 4JX4A 1ETOA 2OCCH 3X2QH 4DYCA 4KHPE 3OIQA 4RGSA 5J40A 1RQ0A 3F8MA 2LKSA 2C6YA 2KHXA 2EPUA 3I4PA 1PVEA 1LQ1A 1ONVA 4P9UA 1SD4A 4IF4A 1DPRA 3KEOA 4EJOA 4KITB 2FX0A 2JWOA 2YTDA 3KZYA 3DCFA 2Y75A 1YG2A 2FD5A 2VKVA 3A02A 3K2ZA 4YFNF 3WHCA 2EOIA 1HC8A 3E6MA 1X49A 5KL3A 3F9KA 2EWLA 2FEZA 4X65E 2VB6A 3ZP5A 3HTUA 2MLKA 1O4XA 2N3HA 3HHHA 1XCVA 2WTEA 2FNAA 3SDGA 2RSIA 4DYQA 2JRTA 4DZPA 1UG2A 3OR1C 1W36C 4UUSA 1H0MA 4BDYA 4M9SA 4OU0A 2ADRA 5CVVA 1YYWA 1BW6A 5IYCJ 3S3MA 5IXMB 5EG0A 1X6EA 2A3SA 1UZCA 2AXTC 3ZR8X 2EZIA 2YSOA 4KN7X 1MDMB 5F0HA 5FRNA 2DLKA 2EILH 1O7FA 4L5IA 4B3XA 4H0EA 2HOTA 1VQNI 3WG9A 1D1BA 3S16J 2MKDA 3K70C 2VQGA 2RSMA 4GYGA 3RQIA 2OBPA 4YIFA 5K7ZA 1UFMA 2STTA 3RI4A 2VRDA 3GTOJ 2EPOA 1WJFA 5CYVA 1OYWA 2NVUB 2FQ4A 3GWZA 3KE2A 4AWXB 3AV0A 2LY9A 1VZ0A 2ELZA 2V1XA 1V5GA 4O5VA 3F3XA 1FOWA 5L3GA 3U1KA 2F4VE 3MWMA 1IMUA 1Y56A 2PLYA 1P47A 4NBQA 1TQMA 4P55A 2KIUA 2VJ5A 2DDAA 1N77A 3EDPA 2I5UA 3PUBA 5HVQC 2K3FA 1IJWC 1FJLA 2L6MA 1MMDA 1Z6TA 3RIRA 1J9IA 1XX5A 4BHCA 2K9MA 5HS7A 4MTDA 2KZVA 1XGOA 2CG4A 3S1NJ 3MMYB 5GAHJ 1T6SA 2LVSA 2X48A 2RNGA 4Y15A 5GPAA 5FRMA 3KLNA 1QRYA 1NEIA 3OYIA 2A69F 1J5EE 2QZ8A 1XPXA 3CDHA 1QHGA 2CFXA 1FTTA 2V6CA 1FWZA 1J59A 2HVSA 4CZZA 1SFOJ 3BG6A 1T38A 3RKYA 5HNFA 2K9LA 2N8XA 1B9MA 4LG0B 2DFFA 5E8GA 2Q2EA 4A0XA 1U8BA 3HOYJ 2L2MA 3EYYA 1UHSA 3VHTB 3FZVA 3TO9A 4IX7A 2F48A 4C2MJ 3MQ0A 1XD7A 2DA1A 1VQ4I 4LU9A 4F91B 2NS7A 4C3JJ 1O3SA 1T39A 1I3AA 1U9NA 2JK3A 4PSXA 2EIMH 4R2CA 4XRSA 2EPRA 2EIKH 4ESFA 5FKNA 2V86A 4HQEA 2V83A 4HNUA 5HLIA 4MIMA 2A5WA 3MKWB 2HR3A 2W57A 3ZQLA 4DR7E 1OCOH 3H3UA 2Z3YA 4Q48A 4LF8E 2K5CA 5BNGA 4XBFA 2R0QC 4C3HJ 3GEZA 5DDGA 3E6BA 5E3LA 3F22A 4PJJA 3VYXA 1PJRA 5IY5H 1B9NA 4XLHA 1MBFA 2IXSA 3VYTB 1TNTA 1UBDC 5B1AH 3B6CA 2NS0A 1D5VA 4I8OA 3BG7A 2DLLA 1R49A 3GYHX 2VASA 3BR1A 4II3A 2D9HA 4B3TE 2WAQA 1YW9A 4XONA 1VQ7I 2TCTA 4DV2E 4LTYA 2V9KA 3HPGA 4P7DA 1GHCA 5H6QA 1YQAA 2QVOA 2YTJA 4XOTA 4QPOA 1WJEA 4AQYE 2EBIA 2Y30A 5EJCA 1T4NA 3A01B 3S2DJ 3GZNB 3GTGJ 2F4OB 4UUTA 3OMLA 1HNWE 3ESWB 2CH0A 4UUVA 3GO5A 1RESA 4NZVA 4UV9A 3QWLA 3UK3C 3OIOA 4E7LA 5KAIC 4B4CA 2Z9OA 3A03A 3V8LA 3HTSB 2EPZA 3KYCB 1D5YA 2KDOA 4F7ZA 4HSTA 4M72A 4D5CA 2J5PA 1MBJA 2PJRB 2V1NA 1ZH5A 3F6HA 2JTVA 2M30A 1PJSA 3HL2A 1W1WE 4OINF 4E70A 3JRFA 4GO1A 4FASD 1BIBA 4XQFA 4XKCA 4BXFA 2E1MC 3V7SA 4HX8A 2IS4A 3VYYA 3V7CA 3H9QA 3DEEA 2QQAA 5M5WJ 3G1MA 3R60A 2K85A 3J7AO 1PUFB 3C2HA 4A0YA 2HGHA 2W48A 2L9VA 3BOQA 4AVZA 1MNDA 2WADA 4AM3A 2ZJQF 2VE7C 5CVJA 2ZKZA 1J5YA 2HKXA 2GXBA 3OYFA 3ZMTA 3JSPA 2ZXWH 5E3OA 2M9AA 3BG3A 5HS9A 4KZSA 2V1UA 2GIVA 1OPCA 2P6SA 5ICCA 1MKMA 3OS1A 3HRMA 2BBYA 3E0JB 5LEKA 2VE9A 4L9VA 3I5UA 2PX9A 3FMRA 1LFUP 2UXXA 3ML6A 2K02A 3MFKA 2DJIA 2OF7A 2EFQA 3ISPA 1YJWI 3K7AJ 2Y2ZA 2J7JA 2PFBA 1OYYA 2V9VA 2M7BA 2R5ZB 2L3CA 2GPIA 4ZYGA 1IXCA 2EOEA 1P2FA 1HW2A 4L0ZB 2R92J 1LVAA 4Q28A 3FXRA 3THOB 1U2WA 1BI2A 2V8QB 1MJAA 3ZRGA 3J80C 2DA6A 2AO9A 4LIUA 2RAEA 4LLGF 4NQWA 3BR6A 4B47A 2H6CA 4Q5SF 4HLYA 4CZCA 1KU3A 1F43A 2KIQA 4DJAA 3K2AA 2CQNA 1BOAA 2BZTA 3TP3A 2A5YB 4CXFA 1IF1A 4DUZE 2FMYA 2AQFA 2EV0A 3I55I 5F0CA 5A6BD 2EPLX 1IC8A 1BI3A 2RC4A 4IHYA 2ECBA 3T1BA 1BR4A 3ROUA 2JA6J 3FXOA 4Q35B 1IV6A 3SYTA 4E7HA 2K40A 1FC3A 2JWTA 5KL2A 3A0BC 2QUFA 3IUOA 4R2PA 2ESHA 4IJAA 1K78B 2EMXA 4O24A 5A69A 4DR6E 1DGRM 1X4PA 4N4OB 3CO7C 4MFDA 3MEXA 2E1NA 2H8RA 1Z05A 4XN0A 4U0VA 3ZQQA 1WFXA 2EFWA 2B7EA 3GW2A 2YS9A 3TW6A 2EN7A 3LA7A 1V54H 1W0TA 2LF8A 1IBLE 2VC0A 1JJ6C 2ZSIB 1NG7A 4Y33A 2DN0A 2YTIA 4HG2A 4TUGA 5J6XA 1YHQI 2HOEA 2VBWA 2DRPA 2IRFG 5D5UB 3RPUA 5H6RA 1WZ2A 5BPDA 2QBYB 4IKFA 1KA8A 4O4KA 4V2GA 1TF3A 2VI6A 2DAOA 1PUEE 1IO2A 1TW3A 3JW4A 1NG6A 3WU1B 2XGDA 1DDNA 4IRGA 2R5YB 4ZDPA 5D5XB 4AC0A 5DYMA 2Y0SA 2COBA 3K6GA 4M3GA 3CCYA 3F0CA 4CYCB 4C9YA 2IPQX 2LMDA 1IXSB 3OL3A 2BHYA 1SFUA 1ZREA 2KL4A 1N25A 4BY1J 3FKIJ 4L8NA 3ZGKA 1EF4A 1XGSA 3TO7A 1BW5A 2CYYA 3ULQB 5F08A 2ZMEC 5ICFA 2MC6A 5DM7F 1A36A 2CUJA 3IWCA 4B44A 1D8KA 2I13A 1ZN2A 2RDPA 2YU5A 3E6DA 1K7AA 1REPC 3JRDA 5ED4A 2LRDA 2UU9E 3BR5A 1G6NA 4A2UA 1P6RA 2V6EA 2RNJA 3R0JA 1ON1A 3WE2A 3KYLA 4NXNE 3CJRB 5DCMB 4D5FA 4YG2F 2EN2A 2EQRA 1R5ID 2PQ8A 3I71A 1J09A 2X6OA 2OTJI 4OX9E 4Q4ZF 3Q0UA 3HOTA 5M3FJ 3HOVJ 1ZRCA 4I99C 2DYSH 3KCCA 2YTOA 1YX3A 3QYEA 2CO5A 3MSWA 3HB9A 4Y13A 2MD5A 2OUMA 4NB5A 3AG4H 5D5VB 2LJUA 2M4IA 4RM2A 1MDMA 2VODA 3Q3SA 2R4GA 4R03A 3I4MJ 5FGMA 1HDPA 1XDUA 1Z91A 4N4NB 3HKZN 4AUXA 4A3CJ 2FU4A 4IQJA 1P7IA 4KIGA 4LF4E 3WTUC 1PDNC 1JKRC 2HZDA 2YT4A 2DMIA 1VQLI 1BL0A 1IQOA 5HNHA 4CYDA 2HTSA 1PDAA 5HLTA 4C30A 3D5SC 1UG0A 2XRLA 3HGGA 4M9ZA 2MH9A 3BZCA 5B66C 5J47A 2EJ4A 5KL4A 2MA3A 1LVKA 3DBLB 5D5WB 1ZR4A 1Z0XA 1ZHFA 3KZZA 1LPQA 1WPKA 3PUFA 3OSGA 3L00A 2HDWA 2RGVA 2WV0A 1JT6A 1XMAA 1T95A 1YIOA 2N3GA 5F3WA 4B3RE 4HTGA 5M3MJ 1IN8A 1TWGJ 4W1UA 1UELB 2GIZA 4I6ZA 3ABMH 4KA4A 5IT9Z 4S0HB 2DBBA 3LA3A 3VOEA 2M2EA 1I27A 1CF7B 2EM6A 2JVGA 5KK1A 3PSFA 3BC8A 1GQEA 4B09A 3QODA 2Y48A 1VQMI 1U6GA 4BNCA 3VYUB 4BC7A 3QU6A 3L7WA 1O3TA 2O6GE 5A2QC 1HNZE 3OYCA 3CDIA 3HBLA 4BAYA 3J7AY 2XROA 3JTGA 1FIPA 3VB2A 2EOSA 4RB1A 3LSKA 4B48A 1FBQA 4CSWA 2AS5F 2FBKA 2EMAA 4MLVA 2DPUA 2QKLB 2EE8A 3CCVI 5ICGA 3EPKA 4BS9A 2EOJA 3DF8A 2ESNA 2NNNA 1STUA 5ILVA 3GMEA 2PRTA 3F8CA 3A2KA 2KP6A 3FK7A 3VPRA 4N0BA 2Z16A 2WBUA 2P81A 1P4AA 1STZA 4DR3E 2NOGA 4XLFA 4EATA 4ZTJA 5AE2A 3I64A 1JUMA 4I7HA 2M8GX 4YIRX 4KICA 5LMNE 4ON0A 4CCMA 4NUBA 2R7TA 5GTHC 3QPHA 1HA8A 4A3BJ 2K7IA 2HPMA 1OMIA 3B6AA 2EOMA 1S29A 3OL4A 4LD5A 4DMIA 2F5FA 3CP8A 4G7ZF 2QSGX 2CW0F 2EORA 3DKYA 2LLKA 3CUQB 3ZQ7A 5EEAA 3CCRI 3IWDA 1XG1A 4HSRA 4GGGA 3DTKA 4XRSG 3IV5A 2MC4A 2FOKA 4MGRA 2JR1A 4KNYA 2Y0MA 3K10A 4B3AA 1YRNB 1Q1HA 4GEQB 1X3WB 4GDFA 1S9HA 3TMOA 1XGNA 2Y9ZA 1HSJA 1R00A 4BUPA 4XLAA 1X2NA 5L3FA 1RKTA 2CQKA 4LLLA 2DOFA 3M7GA 3R6SA 1H89C 1UCRA 4Y17A 3WTXC 4DNCA 2VBZA 1YITI 2FQ3A 4F93B 2VE8A 2W24A 1TWHJ 2HWVA 3J81Z 2E72A 1HR0E 3GZ5A 4PZJA 4EJVA 3T1YE 5LFAA 1D0YA 2V88A 4JK1X 1VFCA 2RS6A 2KRCA 4HF0A 2L5QA 2LBSB 4BY7J 2KONA 3J7Yp 3A01A 2JPAA 3KP6A 4QTRA 2NVXJ 5BMZA 1YUIA 1FLIA 3KP7A 3JREA 3MAJA 4ZDOA 1Y8RB 2O8KA 2EN1A 1NTCA 2JPCA 2H1LA 3FMSA 2Z33A 2MC3A 2LTRA 4JI6E 1FZPB 2VL8A 1G3TA 2XF5A 5F0FA 4H4KC 5KCMA 2GXGA 3WHBA 1I94E 4XIDA 4FQGA 3MVPA 4DV0E 3HYIA 2PJRA 2JVHA 2BVLA 4CCOA 2O9LA 3H1CA 3VYSB 5GAGJ 4U7BA 1K6YA 3RKXA 3E6CC 2L2NA 1FBUA 2BEOA 4ZYEA 3DLAA 4C2UA 1VF9A 1ZK8A 3JCUC 1G2FC 5LGNA 1ZLJA 1PUFA 2MGQA 3S32A 3C18A 1S7OA 2PMHA 4AIJA 2EL6A 1HXDA 2DTZA 3P9IA 1P7JA 4M71A 5C4JJ 3OY9A 1B8IA 5BR8E 5DD8A 4BBRJ 1VQPI 2LYCA 2ISYA 4B8XA 5DM6F 1PKPA 2LT7A 4BJTA 2ICWG 1LFBA 5TISC 3ZQIA 1TNSA 3OYBA 2K4BA 3JTHA 3KP5A 3O3KA 4OMZA 4HX7A 4XK4A 4AIKA 3WU0A 2B3TB 3ADGA 2P5KA 4EVIA 1J0RA 3ZQGA 1SAXA 3BPXA 5IYDJ 3CZ6A 2ZXHA 3VWBA 4JV5E 2XUBA 4A6DA 2HQRA 2L33A 1JI8A 3IAM2 2FRHA 3QOPA 4MLOA 5EEHA 1MNMC 2R5ZA 4A3DJ 3JAMC 2A25A 1I1SA 3K4BA 3M3YJ 1B4AA 1HW1A 2QA4I 2HZTA 3EYIA 2UXBE 3DLLF 4FE7A 2DMYA 3LSIA 3IC7A 2WB1N 1WJAA 1T0FA 5B5EC 3W6VA 3H9GA 3MHSC 5HS8A 5TSEA 2JQ7A 2WAQN 4O43A 5HDKA 4HYEA 2E2HJ 1N32E 1FBSA 5LGUA 3OYHA 4EM1A 3I0TA 4X66E 2QF7A 2LREA 3CF2A 5DEQA 5FO5A 2LDUA 3V8KA 5EGOB 3G4SI 1MD0A 1DU0A 2EN3A 2K9QA 4DV4E 1SAUA 2YU9J 1Z67A 2O3FA 4Y7NJ 2E5NA 2E5ZA 4IQ4A 5LD2C 3JRCA 1DGWY 4EQQA 3S2WA 1F1ZA 3CCSI 2DFIA 3W6JB 3K6QA 2JSPA 2O8XA 2FV4B 4R8HA 1RC7A 1N75A 4CUGA 3OYDA 2H09A 4OIOF 2W7NA 1WH7A 3JU0A 1CGPA 4K0KE 2EFPA 3CLQA 1I6HJ 3C3WA 2WY8Q 1YUJA 5CVRA 3DXJF 4KWYA 2HFHA 2OC6A 1W36D 2XB5A 2DO7A 1KU7A 3HOZJ 4BQOA 4HZFA 1D0ZA 3FXLA 2EM4A 1MBKA 1MJBA 2DMPA 3C2BA 2WBTA 4FTHA 3E97A 1BM9A 2CW7A 3I53A 3PSIA 2EPNA 4XICA 1WSUA 3G6EI 4Y52J 1V3FA 4M3EA 4ENNA 4KISA 4J00A 4F6MA 3K9TA 4A12A 3PJRA 3ADIA 3WTVC 3GTMJ 1RETA 3C2GA 3OV8A 1FOXA 4CO8A 3OS0A 3K70D 2DOAA 2QYOA 3NEUA 2HYJA 3I59B 4IVNA 4BU2A 1SVOA 2D1VA 2DFEA 5JHUA 1G8XA 2EM5A 4P9FA 1QZEA 2A6EF 1HNXE 1A1LA 2PEXA 4WXDA 1Z77A 1LLMC 5IT9K 1X1DA 1KYQA 2W4SA 2G0EA 2EA2A 2QWWA 2PMZA 3SEQA 3ASOH 3GTKJ 4HNVA 2EOHA 1V4RA 3LSJA 1R1UA 2R5YA 3OYAA 3SEZA 3W2AA 3HQ1A 2L0KA 3IRRA 4CYCA 4PFOA 2HQ5A 2M8EA 2PG4A 3ABKH 3RYRA 4GRIA 4RDUA 3ERED 3QQAA 1WJDA 2L3JA 2H94A 2O61A 3FXQA 1RKWA 2CW8A 3QAHA 1TQPA 1K83J 5LRSA 2R7VA 4P78A 3LSHA 1ETVA 2FOWA 2XRNA 4KFCA 4M3DA 2NUGA 1B72B 4CH7A 3ELKA 4IXAA 4ZJZA 1QU3A 1R1TA 2KOUA 1IV8A 2FJ1A 3BCBA 4W97A 4B3ME 2JOXA 1W7PB 3WTWC 4RA2A 4G7HF 5EZHA 2P4WA 3OYKA 1BR2A 3MZ8A 2GHFA 3J7ZI 2DU9A 4U88A 1VQ5I 3O6BB 2YTPA 1MNEA 2XIGA 1TWAJ 3H35A 3SJMA 1F9NA 2P8TA 2EN6A 4QPQA 2PBIA 2E35A 4IOCF 2VONA 1R9TJ 5CQEA 3VSLA 3ZQCA 2A61A 2BHZA 2E71A 2BYVE 1GVDA 4DV6E 4BDZA 3H0GJ 1SANA 2NOJB 4M6YA 3S8PA 3F8FA 3NQOA 1BOBA 1LDJA 1TL8A 4P1WA 2NUEA 2JN6A 3ZMUA 2VQLA 1IRZA 3WU2C 2EM3A 2COMA 4X62E 3BJ6A 2JSCA 2W82A 2ZCWA 5J1UA 5BQTA 2ID3A 5TRDA 2ACJA 1WQ2A 1FEXA 2LP0A 2NVTJ 3D0SA 4R8OA 1IG7A 4BL0B 2OA4A 4OAZA 1IRGA 1MEYC 2HS5A 2LC2A 2LE2A 3O8GA 4C3IJ 3OYLA 4O3MA 4BKXA 2V79A 3QU3A 4I09A 4A3JJ 2HXOA 1B6AA 3FHNA 4AD9A 3J81K 2ZNYA 1JGSA 3LL7A 4DBQA 2IGNA 2LOOA 1IBKE 1HDDC 2RREA 1MBEA 2HI3A 4ZZDA 3KWRA 1L0OC 3SZGA 2QEXI 1HOMA 5JR3A 1T4LB 1KU9A 5DV5A 2DLQA 2HEOA 1KYWA 2Y0SN 4CICA 4EV0A 3DF6A 3EUHC 1QGPA 3BJAA 1V5EA 3K4JA 5K1YA 1ETXA 2QM3A 1MMGA 3LQQA 1CF7A 4NHJA 1MH3A 1ZBQA 2EP3A 1X6HA 4MNUA 3N97A 2CV2A 1ULYA 3A1YA 4F55A 4K2EA 2ADUA 5FLVA 3PFIA 1H9GA 2R3SA 3CJNA 1XMOE 2MYSA 2IJLA 1R7JA 4XM3A 2DYRH 5CJ9A 2MC5A 2E5LE 1FOYA 5IOYA 3GTQJ 4RGUA 2DGCA 3GVAA 1BB8A 2GA2A 4LB5A 1FT9A 2CUEA 3HM5A 4X6AJ 5D6EA 2L2OA 5FLXZ 3R4KA 4HV5A 4P5OA 3M9AA 1JTYA 2DPDA 2LTPA 1IUYA 3DPTA 1APLC 4WK8F 5HODA 3RQ4A 1YIJI 2FGGA 3H3VK 2L01A 2CGPA 3LSMA 2WV1A 3PFYA 1E2XA 3FKJA 5K7FA 2ZJ2A 4IRHA 3MZHA 1YJ9I 3EPLA 1O0WA 3HXLA 4Y4RA 2XGCA 1ZGWA 3QOEA 4HNTA 4XOPA 1TT0A 1KONA 3CCLI 1NK2P 4OOIA 4NHRA 2BB8A 2ENHA 3NRVA 4JI8E 2DSYA 2H27A 5F04A 4A6EA 2Y69H 1MBHA 2KHMA 2R7OA 3K1NA 5A6AA 2DA3A 1LUJB 3GXOA 2EOXA 4YELA 5J8CA 1YRNA 4CCNA 1GTKA 2DI3A 1USTA 1WVRA 2E1MA 2E1CA 2HQAA 1J75A 1AWCA 4BMJA 1ACIA 2DCEA 2DQRA 3VDXA 4ENMA 1EH6A 2F5EA 2K4JA 1UHZA 3IHUA 3QPLA 4RB2C 2DXIA 2XSDC 2JA2A 3DBHB 2JOBA 1R1VA 4RGRA 1GDTA 3CUQC 1JKQC 4FK5C 2RKHA 2E7XA 3CCEI 4MEYF 2QCOA 4LB6B 2X4HA 3K4NA 4AYBA 2EZHA 5IP7J 2WCC3 3ABUA 1FSEA 2L9SA 4I98B 4D7NA 4E4HA 4KYWA 2VN2A 5L3BA 2EMHA 1EH7A 1YOVB 4B3SE 4S05A 2TDXA 2NABA 1TZLA 4RMNA 1IZ1A 3PQKA 2KFDA 5EYRA 3EUKL 4GXOA 1YPNA 1MMSA 2R76A 3S1QJ 2UUBE 2DB2A 2XC7A 5AIQA 4RBOA 2JVAA 3LFUA 5D4SA 3JRGA 4DV1E 4JBAA 1QNTA 2FUG2 2DT6A 2V9PA 2XAGA 1A6IA 2K7LA 4R2AA 5FD5A 3JSOA 2VC1A 5E1ZB 4E7IA 3M8EA 2UWMA 3TBIA 3BQZA 2I8DA 3WTSC 1OISA 2A07F 1FYMA 2DTRA 2R7RA 1XMQE 4DV7E 4FETA 4XN3A 3MD2A 2X6WA 1FY7A 1PJTA 1RRJA 3QYFA 2JY9A 1WCMJ 4FE4A 5HDGA 4YHHE 2H36X 1EKEA 4WXCA 2O03A 3HSEA 1W5CC 3T8RA 3W6KB 2EPCA 3GFLA 3JR9A 1ZTRA 4IRIA 2L02A 1XMKA 4F52A 3FXMA 2R7XA 2M0CA 4IPAA 1D8JA 3OOPA 2JA8J 2VF1A 4LF5E 3NWTA 5BPIA 4DBRA 4A5MA 1H88C 1HSTA 3CESA 2O0YA 5KNLA 2VQFE 3SZTA 2UV1A 1LFPA 2JPBA 2HOAA 5HDNA 3L2VA 2PN6A 2VQHA 1Y8QB 3RPUD 2M7AA 1TTYA 1AAYA 5JLXA 1KQ0A 2BXYA 4KIBA 1Q1VA 3GLLA 4FT8A 1BN5A 2EV6A 4FX4A 4X0GA 2YTNA 3FM5A 1Y0UA 2EM2A 2DMQA 4JI2E 3HTXA 2QENA 1ZR2A 2X51A 3UR3C 3FIWA 2KQRA 1A5JA 1XB4A 2HC5A 1DQUA 1WI9A 4ZYDA 1UMQA 1JK1A 3IL2A 1WH5A 3WTTC 4UNOA 3RTRA 4OIPF 3CMMA 1TLHB 4EM0B 2NVYJ 3JRHA 5E3NA 2EA4A 4KN4X 3V8JA 5CQGA 5DNYA 4IHXA 3BZKA 2XAQA 1A1HA 1FX7A 2JA5J 1U0JA 1G3WA 1IDZA 3B73A 2BW3B 3HPHA 5CLSA 1OCPA 2X1CA 3RMPA 4BJ5C 3M99B 2DA5A 3EQLF 5F6FA 1FP1D 1KZHA 5DTDA 3PL8A 2OD5A 2ZSHB 1WI3A 2EMKA 4OMYA 3OYMA 4I02A 5DD4A 4BQAA 2ZMEA 4HW0A 1GV5A 3DWLE 5ICEA 4EJTA 2BY0A 3LAPA 1DP3A 2G9WA 2NUFA 1R4MB 2YPNA 3FISA 2MLGA 1OR7C 3T8TA 1UAAA 2EN4A 1XSXA 3AG2H 4WPYA 2M4GA 2JUCA 4GKKE 1ZU1A 1IN5A 2W84A 2YRMA 3I59A 4A3FJ 1I6XA 3K4LA 3ZMVA 3K1PA 1IQSA 1OYIA 3S2HJ 5LHIA 3BG5A 2YZTA 2HYGD 3TQMA 1ZELA 1WWXA 1XN7A 1Z1BA 3U1DA 3DEUA 2ZNZA 5LLQA 4M9VC 4N9IA 4LK1F 1GLNA 4NC8A 2IS2A 4JOMA 1LEAA 1VQ9I 5J4YA 4G6TB 4AVPA 1R22A 2UXDE 2MD0A 1IRXA 1JT0A 1XGMA 3LSGA 4GCVA 4XLCA 2XAFA 3CMAI 4LF9E 2LUQA 2M4KA 2O7OA 2EFOA 5FKKA 1UB9A 4MFEA 1ZRDA 2WC2A 4UV8A 1TQIA 3BDDA 5L3CA 1BC7C 1B72A 4A3IJ 4XSZF 3CO6C 2MDRA 3D1NI 2LH9A 5FLXK 2XPVA 4XKVA 2KIFA 4BE2A 4YRVA 4UUSB 5FJ8J 2KLOA 3F72A 1X48A 2R1FA 4BHBA 3BIDA 3DTEA 5F64A 1A1KA 2HVQA 1TC3C 4DOZA 5EG0B 3BLYA 3N4MA 3E5XA 2YPRA 4F3QA 4KUMA 2ELKA 3DU5A 1JUPA 4XL9A 5K7HA 3GLXA 4IZZA 1TWFJ 4P96A 2GXAA 3I58A 1X6FA 4XKWA 3PIOF 4I2OA 2F4MB 3LOCA 3TOBA 1MSFC 3FX3A 3CC2I 2VBXA 2FSWA 1W4MA 2A6HF 3CMYA 1JHHA 1ZGJA 4O5GA 4NNJA 4V19K 5ILSA 4R2DA 4A3EJ 3DFGA 5JLWA 2IAIA 2EINH 2LF7A 2X6YA 3G1OA 3CCMI 2IS6A 1Z7UA 2OCEA 1EA3A 1RMDA 1IDYA 2KISA 2K4VA 1TN9A 1J26A 1R4NB 1ZKGA 2F6CA 5LGTA 3L2CA 2GQQA 3HRSA 2EM9A 2F5VA 5DUIA 2RPCA 3J7YJ 3HHGA 4CCLA 1ZRFA 3NAUA 1QVTA 2M0MA 1T4OA 4JP0A 3ASNH 3QPTA 3N05A 2GLOA 3KPHA 3E1SA 1R71A 1T33A 5IWAE 3FBIB 2PMZN 4MTEA 5K5RA 2MBFA 1FOKA 5M5XJ 2PI0A 1T98A 3WE3A 1K61A 5F1RA 3VK6A 4G6DA 2UUCE 2KPMA 2DA7A 1QZYA 2R7SA 3LAJA 1SC7A 2RV8A 4LG0A 1ETWA 1BJZA 2XAJA 2Z99A 3HJEA 2LJHA 4HQMA 3HZJA 5CVIA 1YX5A 5HOOA 2P5LC 1X47A 4PDKA 1UHWA 2CU7A 4ZYAA 3V42A 5FROA 5JVGF 1AKHB 3PNYA 3BBGA 4OIQF 2NYXA 2P5VA 4BE1A 3F6OA 4MLQA 4WCGA 4UVAA 1A1IA 1A1FA 4II2A 4WXHA 3U21A 2IW5A 2ODRC 2KJCA 4ZH4F 1HW5A 2VPRA 3BTCA 3IKVA 1XSVA
chains in the Genus database with same CATH topology
2FNPA 1JE8A 1BI1A 5E8IA 4I0AA 1BI0A 1ZARA 1YW7A 4XSXF 4PGGA 3J80Z 4Q47A 4MQVA 3GX4X 1Z9CA 1E17A 1R36A 4ZYHA 4BHPA 1QZZA 3L9FA 5IT3A 4A5NA 1X3UA 2OQGA 5CVUA 2CSOA 2IP2A 2ZO4A 3EETA 3VFZA 2XASA 2HTJA 3F6VA 4TV7A 1DPUA 5E1XA 4YFXF 4RAYA 3M8FA 3LQRA 2FXAA 5DCFA 2G7UA 2QQBA 1P92A 4CHUA 3DP7A 4HOBA 2EJRA 2M87A 1RIOH 3MCZA 4U0WA 1O3RA 1KQ8A 4YIIA 4UVCA 5EEGA 3HRUA 2UZKA 2R7DA 3C1DA 4O6JA 2KRFA 3GZ6A 3E3VA 4LK0F 3COAC 4RAZA 1FP2A 3FF5A 4WF2A 3L09A 5ILUA 3Q9SA 3M1EA 2YX7A 1TBXA 1LNWA 1W5SA 1ZG5A 1T2KA 2B0LA 3KLOA 1IRFA 4U0YA 2OZUA 3ABTA 5E20A 3U2RA 1SFXA 2Z5UA 1S3JA 1K79A 4I0BA 1D3YA 2YX4A 4RB3C 3BP8A 1RUOA 1K78A 1RI7A 4L0YB 1W5TA 1YFHA 3BZ6A 2OAZA 2QQ9A 1ODDA 3ZPLA 3FMQA 2DT5A 2EWNA 4KMUX 1FSHA 2WWYA 1LDKB 2XGXA 1F4KA 2XV4S 4AIHA 1RUNA 2L54A 3TO6A 2QBYA 2XAHA 3HRTA 3PQJA 2GWRA 5L3DA 1ZYRF 5HLHA 1R58A 2HGCA 3DPLC 4L5JA 1Z6RA 1FYKA 5A2QZ 1C0WA 4WX9A 2EB7A 2D45A 1O3QA 3FWEA 4BH9A 1BJAA 3GFJA 3KETA 2BE5F 2KKOA 4L9NA 2NAZA 4HX4A 1TW2A 3WODF 5D8KB 2ISZA 5DCMA 2DK8A 2FMLA 3F23A 3O2PE 3DKWA 3KP2A 4EGYA 3AAFA 4N9HA 3ECHA 1FPQA 1Z1DA 5FB2A 1I5ZA 2VBYA 2JZYA 3J80K 3WGGA 2F5DA 4M6XA 4RB0A 3EUHA 3LA2A 2ZFWA 5FD6A 4LMYA 3F8NA 1ZLKA 3P7NA 3SQNA 2P6TA 1HKQA 1IXRC 1S8NA 5D8LB 4MEXF 4LLNA 2HQNA 1IN7A 1P4XA 5LRRA 2XVCA 2X0LA 2NNYA 1MGTA 4QWQA 4CDGA 1ZAOA 3QP5A 4EM2A 1AOYA 1QQIA 3IRQA 2L4MA 1FYLA 5E18F 3P9KA 3WGHA 1L3LA 3HIFA 2KJBA 3IWFA 2CWEA 2IT0A 1LDDA 4I01A 2FF4A 2AXLA 4DQ2A 2KIMA 1PP7U 1BIAA 5FFXA 4LGWA 4HA8A 2VT3A 3CUQA 3JAMZ 1YS6A 2XKOA 3Q5FA 1R5HA 3I54A 4GYIA 1LJ9A 2LKPA 3RPQA 1YS7A 1H9TA 4HF2A 1SD6A 2MH2A 2EV5A 3BY6A 5HLGA 6PAXA 1G4DA 3SZPA 2QLZA 2XKPA 3FHZA 4MHGA 4HLXA 4ESBA 4A0ZA 1J7KA 3ZN1A 3BROA 2W85A 2G7HA 3H3ZA 5TJJA 1YW8A 2A68F 3R61A 1FNNA 2IA0A 3Q9VA 2HDCA 3RDIA 3HSFA 2GA1A 3TGNA 2F2EA 2M5WA 1A04A 1GXQA 5D4RA 1U5TB 4EJUA 4ETSA 3U9GA 1SFEA 3CTAA 3LSTA 4KT5C 3QP6A 4LFUA 5A2QK 2ELHA 4KIFA 1SMTA 2VOPA 3T0YA 4ENJA 4ENKA 3K0LA 3LWFA 1KYZA 3TKYA 1HKTA 2H6BA 4JQFA 4S04A 1SD5A 1YYVA 4OIRF 2D2WA 3QRFF 1K6OA 2VXZA 4EMSA 1G3YA 2L3DA 2EFNA 3TQNA 1DP7P 4ESJA 4R1HA 1OR7A 4G6QA 3P9CA 3WTZA 5BS6A 3GF2A 4EGZA 4XLPF 5K5QA 1F5TA 4WWCA 1B59A 5E1WA 5H20A 1SD7A 5ERIA 1G3SA 3SFZA 1O7LA 4R79A 4FX0A 3C7JA 1QPMA 1EV7A 5LHGA 3ECOA 1QO0D 3G3ZA 4IHTA 2GZWA 1ON2A 1U8RA 1W7PD 4UHTA 1YO5C 4PGHA 2ZBKA 1XSDA 5LEJA 3IKTA 5D6FA 3V4GA 4FHTA 5FFZA 5AONA 1S7AA 1KU2A 4LJZF 1BC8C 1XDSA 4PCQA 3CUOA 2J5OA 2K86A 3TDUC 1W7PA 1DUXC 3WGIA 3HSRA 5L3EA 3B02A 3MZYA 1LB2A 2VOOA 3F21A 2P7CB 2RQPA 4M9XA 2OU2A 4G7OF 1WKMA 1S6LA 3GFIA 2GAUA 3JAMK 1KGSA 2RVCA 4YFKF 1IW7F 4Z2YA 1U78A 1QBJA 2FE3A 2OZ6A 3BJOA 4G8XA 3E5UA 3R0AA 4L9TA 1HBXG 5E17F 3DQVC 3LFKA 1MZBA 1R5GA 4QLCU 4HDVA 5JI6A 1HQCA 1GXPA 5K5OA 2JT1A 2DW4A 5KVRA 1IN4A 1I1GA 4EJWA 4D0PA 2HYFA 3KFWX 3FM3A 1BBYA 3ZMDA 2VT2A 4XRFA 4G9YA 2FA5A 1YTYA 1O57A 4CGZA 1MJ9A 1USSA 3TDZC 4ASNA 3CLOA 1J2XA 2P7VB 1ZGAA 3FXUA 2YSRA 2FBIA 4RGXA 2V1DA 3HUGA 1RZ4A 4XLNF 5JFRA 2Q8KA 4BXUA 2L4AA 2XHKA 2D1HA 3ZMZA 3GUDA 3HOSA 2HKOA 2STWA 4UVBA 3TOAA 2DQLA 4HV6A 2FBHA 4M74A 2NRAC 4U7DA 1JHFA 3KEQA 1KQ9A 1IN6A 5LHHA 5JVTA 5J8FA 1YLFA 2M45A 1P4WA 4KDPA 3BPVA 3V7RA 3T5XA 2LNBA 3KP4A 1SMYF 2IVMA 2EK5A 3VEPA 2IA2A 2RN7A 1IAWA 3RYPA 2IA1A 1B1BA 2ZXJA 1R23A 2YR2A 3E5QA 4HF1A 3SXYA 1GVJA 1U5TA 4ZZLA 3KP3A 2Q0OA 3H92A 1NHAA 4MQ9F 3DV8A 2E7WA 2R7FA 2LSOA 3REOA 2PMUA 2M1BA 2K27A 5AIPA 1EH8A 1JXSA 1UHMA 1U5TC 5LBQA 2F5CA 4M73A 2BV6A 2ETHA 1HKSA 4HBLA 3SHFA 2BGCA 1U3EM 1ZG3A 2W25A 4HAMA 3ZMSA 3ZN0A 2DK5A 3K1MA 1VTNC 4IHSA 1RNLA 3GFMA 4BYYA 5BOXA 3VODA 1LEBA 3F8BA 4RS8A 1ZG1A 1PP8F 1OKRA 4L9JA 4UXNA 2OQRA 4HDUA 3D5LA 2PJPA 1XCBA 3K69A 2YU3A 5DUKA 3G73A 3RKWA 3RJPA 3BWGA 4G94A 3IWZA 2ZMEB 4L18B 4KMFA 2UXNA 1WRJA 3WTYC 4RGSA 3F8MA 2C6YA 3I4PA 1LQ1A 1ONVA 4P9UA 1SD4A 4IF4A 1DPRA 4EJOA 3KEOA 3KZYA 2Y75A 1YG2A 3K2ZA 4YFNF 3E6MA 2FEZA 3ZP5A 3HTUA 2MLKA 3HHHA 1XCVA 2WTEA 2FNAA 2JRTA 1H0MA 4M9SA 4OU0A 5CVVA 2A3SA 4KN7X 1MDMB 1O7FA 4L5IA 4H0EA 3WG9A 4GYGA 2OBPA 4YIFA 2STTA 1UFMA 3RI4A 4AWXB 5CYVA 1OYWA 3KE2A 3GWZA 2V1XA 5L3GA 4O5VA 3F3XA 3MWMA 2PLYA 1TQMA 4P55A 2KIUA 3EDPA 5HVQC 1Z6TA 3RIRA 1J9IA 4BHCA 5HS7A 4MTDA 1XGOA 2CG4A 1T6SA 4Y15A 3KLNA 2A69F 2QZ8A 3CDHA 2CFXA 2V6CA 1FWZA 1J59A 4CZZA 1T38A 3RKYA 1B9MA 4LG0B 5E8GA 2Q2EA 4A0XA 3EYYA 3FZVA 3TO9A 3MQ0A 1XD7A 1O3SA 1T39A 4ESFA 4HQEA 5HLIA 2HR3A 2W57A 3H3UA 2Z3YA 4Q48A 4XBFA 3GEZA 5DDGA 3E6BA 3F22A 1B9NA 1TNTA 1D5VA 2NS0A 2DLLA 3GYHX 1YW9A 1GHCA 5H6QA 1YQAA 2QVOA 4UUVA 3GO5A 4UV9A 2Z9OA 3HTSB 3V8LA 4F7ZA 4M72A 2J5PA 1ZH5A 2JTVA 2M30A 4OINF 4E70A 4GO1A 1BIBA 3V7SA 4HX8A 3V7CA 2QQAA 3R60A 3J7AO 4A0YA 3BOQA 5CVJA 2ZKZA 1J5YA 2HKXA 2GXBA 3ZMTA 3JSPA 5HS9A 2V1UA 2GIVA 1OPCA 2P6SA 5ICCA 1MKMA 3HRMA 2BBYA 5LEKA 2VE9A 4L9VA 3I5UA 3FMRA 2UXXA 3ML6A 2K02A 3MFKA 2EFQA 3ISPA 2PFBA 1OYYA 2V9VA 4ZYGA 1IXCA 1P2FA 1HW2A 4L0ZB 1LVAA 3FXRA 1U2WA 1BI2A 1MJAA 4LLGF 4NQWA 2H6CA 4Q5SF 4HLYA 1KU3A 1BOAA 2A5YB 4CXFA 1IF1A 2FMYA 2EV0A 1BI3A 2RC4A 3T1BA 3ROUA 1FC3A 2QUFA 2ESHA 4IJAA 1K78B 3CO7C 3MEXA 2E1NA 1Z05A 4U0VA 2EFWA 3GW2A 3LA7A 2LF8A 2VC0A 5J6XA 2HOEA 2VBWA 2IRFG 5D5UB 3RPUA 5H6RA 5BPDA 2QBYB 1KA8A 2DAOA 1PUEE 1TW3A 3JW4A 3WU1B 1DDNA 4IRGA 5D5XB 5DYMA 2IPQX 1IXSB 1ZREA 1SFUA 1XGSA 3TO7A 2CYYA 3ULQB 5ICFA 1D8KA 1ZN2A 2RDPA 3E6DA 1K7AA 1REPC 5ED4A 1G6NA 4A2UA 1P6RA 2RNJA 3R0JA 1ON1A 3WE2A 5DCMB 4YG2F 2PQ8A 3I71A 4Q4ZF 3HOTA 1ZRCA 3KCCA 2CO5A 4Y13A 5D5VB 2MD5A 4NB5A 1MDMA 2VODA 5FGMA 1XDUA 1Z91A 2FU4A 4KIGA 3WTUC 1PDNC 4CYDA 2HTSA 4M9ZA 2MH9A 2MA3A 5D5WB 1ZHFA 3KZZA 3L00A 2RGVA 2WV0A 1XMAA 1YIOA 1IN8A 4KA4A 5IT9Z 2DBBA 3LA3A 3VOEA 1I27A 1CF7B 5KK1A 4B09A 4BNCA 2Y48A 1U6GA 3QU6A 3L7WA 1O3TA 2O6GE 4BAYA 2XROA 3JTGA 3VB2A 4RB1A 2AS5F 1FBQA 2FBKA 2DPUA 5ICGA 3DF8A 2ESNA 2NNNA 5ILVA 3F8CA 4N0BA 1P4AA 1STZA 3I64A 4I7HA 4KICA 4ON0A 3QPHA 1OMIA 1S29A 4LD5A 2F5FA 4G7ZF 2CW0F 3CUQB 3ZQ7A 4GGGA 2FOKA 4MGRA 4KNYA 2Y0MA 1Q1HA 1XGNA 1HSJA 1R00A 5L3FA 2CQKA 4LLLA 3M7GA 3R6SA 1UCRA 4Y17A 3WTXC 4DNCA 2VBZA 2FQ3A 2VE8A 2W24A 2HWVA 3J81Z 3GZ5A 4PZJA 4EJVA 4JK1X 4HF0A 3KP6A 5BMZA 1FLIA 3KP7A 3MAJA 2JPCA 3FMSA 2Z33A 2MC3A 1FZPB 1G3TA 2GXGA 3HYIA 4U7BA 3RKXA 3E6CC 1FBUA 2BEOA 4ZYEA 5LGNA 1ZLJA 3C18A 1S7OA 2PMHA 4AIJA 1HXDA 3P9IA 4M71A 5DD8A 4B8XA 2ISYA 1TNSA 2K4BA 3JTHA 3KP5A 3O3KA 4OMZA 4HX7A 4AIKA 3WU0A 2P5KA 4EVIA 1J0RA 1SAXA 3BPXA 2XUBA 4A6DA 2HQRA 2FRHA 3QOPA 5EEHA 1I1SA 1B4AA 1HW1A 3EYIA 2HZTA 3IC7A 1T0FA 5HS8A 5HDKA 4HYEA 1FBSA 5LGUA 4EM1A 3I0TA 5FO5A 5DEQA 3V8KA 2LDUA 1MD0A 2O3FA 4EQQA 3S2WA 1F1ZA 2DFIA 3W6JB 2O8XA 4R8HA 2H09A 4OIOF 1CGPA 2EFPA 3C3WA 5CVRA 3DXJF 2HFHA 2DO7A 1KU7A 4HZFA 1MJBA 3E97A 1BM9A 3I53A 1WSUA 1V3FA 4ENNA 3K9TA 4A12A 3WTVC 3OV8A 4CO8A 2QYOA 3NEUA 4IVNA 3I59B 2D1VA 5JHUA 4P9FA 2A6EF 2PEXA 4WXDA 5IT9K 2EA2A 2QWWA 1V4RA 1R1UA 3IRRA 2M8EA 2PG4A 3ERED 3RYRA 2H94A 2O61A 3FXQA 3QAHA 1TQPA 5LRSA 2XRNA 4KFCA 3ELKA 4IXAA 1R1TA 1W7PB 3WTWC 4G7HF 2P4WA 2DU9A 4U88A 3O6BB 2XIGA 1F9NA 2P8TA 2PBIA 2VONA 2A61A 2BYVE 4M6YA 3F8FA 3NQOA 1LDJA 3ZMUA 2COMA 3BJ6A 2JSCA 2ZCWA 5BQTA 5TRDA 2ACJA 1WQ2A 3D0SA 2OA4A 1IRGA 2HS5A 4O3MA 2V79A 3QU3A 4I09A 1B6AA 4AD9A 3J81K 2ZNYA 1JGSA 4ZZDA 1L0OC 5JR3A 1KU9A 5DV5A 2HEOA 1KYWA 4CICA 4EV0A 1QGPA 3BJAA 5K1YA 2QM3A 1CF7A 3LQQA 4NHJA 4MNUA 3N97A 1ULYA 4K2EA 2ADUA 3PFIA 1H9GA 2R3SA 3CJNA 2IJLA 1R7JA 5CJ9A 4RGUA 3GVAA 2GA2A 4LB5A 1FT9A 5D6EA 5FLXZ 3R4KA 4HV5A 4P5OA 3M9AA 2DPDA 1IUYA 3DPTA 4WK8F 2L01A 2CGPA 1E2XA 2ZJ2A 4IRHA 3MZHA 4OOIA 3NRVA 2H27A 4A6EA 3K1NA 3GXOA 5J8CA 2DI3A 1USTA 2E1CA 1J75A 1AWCA 4ENMA 2DQRA 1EH6A 2F5EA 2K4JA 3IHUA 4RB2C 1R1VA 4RGRA 3CUQC 2RKHA 2E7XA 4MEYF 4LB6B 2X4HA 3ABUA 1FSEA 4I98B 4KYWA 2VN2A 5L3BA 1EH7A 4S05A 2TDXA 1IZ1A 3PQKA 4GXOA 5AIQA 5D4SA 4JBAA 1QNTA 2XAGA 2K7LA 5FD5A 3JSOA 2VC1A 5E1ZB 3M8EA 2UWMA 3WTSC 2A07F 1FYMA 2DTRA 1FY7A 5HDGA 4WXCA 2O03A 3HSEA 3T8RA 3W6KB 3GFLA 4IRIA 2L02A 1XMKA 4IPAA 1D8JA 3OOPA 5BPIA 4A5MA 1HSTA 2O0YA 3SZTA 2JPBA 5HDNA 2PN6A 1TTYA 1KQ0A 4KIBA 4FT8A 1BN5A 2EV6A 4FX4A 3FM5A 1Y0UA 2QENA 1XB4A 1WI9A 4ZYDA 3IL2A 3WTTC 4UNOA 3RTRA 4OIPF 1TLHB 4EM0B 2EA4A 4KN4X 3V8JA 2XAQA 1FX7A 1G3WA 3B73A 5CLSA 3EQLF 5F6FA 1FP1D 2OD5A 4OMYA 4I02A 5DD4A 4BQAA 2ZMEA 4HW0A 5ICEA 4EJTA 3LAPA 2G9WA 2MLGA 3T8TA 1XSXA 1IN5A 2W84A 3I59A 1I6XA 3ZMVA 3K1PA 1OYIA 5LHIA 2HYGD 1WWXA 1XN7A 3U1DA 3DEUA 5LLQA 2ZNZA 4N9IA 4LK1F 1LEAA 4AVPA 1R22A 1XGMA 4GCVA 2XAFA 2EFOA 1UB9A 1ZRDA 2WC2A 4UV8A 1TQIA 3BDDA 5L3CA 1BC7C 4XSZF 3CO6C 5FLXK 2KIFA 3F72A 4BHBA 5F64A 3N4MA 3E5XA 2YPRA 4KUMA 3GLXA 4P96A 3I58A 4I2OA 3TOBA 3FX3A 2VBXA 2FSWA 1W4MA 2A6HF 1JHHA 1ZGJA 5ILSA <