4BHBA

Crystal structure of mycobacterium tuberculosis o6-methylguanine methyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
165
structure length
165
Chain Sequence
MVHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords METHYLATED-DNA--PROTEIN-CYSTEINE METHYLTRANSFERASE
publication title Biochemical and Structural Studies of the Mycobacterium Tuberculosis O6-Methylguanine Methyltransferase and Mutated Variants.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 50
structure length 165
sequence length 165
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4bhbA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 4bhbA01
1QZZA 1OYIA 3JAMZ 3ABTA 1D3YA 5F1RA 2IT0A 1XDSA 5BS6A 5DUIA 3ZPLA 3COAC 1TNSA 1RIOH 1I27A 2AS5F 3TO6A 2XKPA 5L3EA 3KZYA 2GXGA 3VOEA 2RQPA 3T8RA 4CYDA 2XVCA 1MJBA 1ONVA 1WKMA 1U5TC 2H27A 4HV6A 5LHGA 4IF4A 3M8FA 3ROUA 4M9SA 4DNCA 2PEXA 3EETA 1BJAA 5DCMA 3QRFF 4G8XA 3NQOA 4ZH4F 2HS5A 2DAOA 2FU4A 3JSOA 2F5EA 4U0VA 1HKQA 1JHHA 2L3DA 4U7BA 1XMKA 3D5LA 2HYFA 4R1HA 2CWEA 2YR2A 1U6GA 4OIOF 1GHCA 1XSVA 3RTRA 3EQLF 3IWFA 1SD6A 3MZYA 2JPCA 5JR3A 2F5FA 3BPVA 5DD8A 2GA1A 1ZREA 2JPBA 2PQ8A 1QGPA 3WTSC 4IHSA 2DO7A 1TQIA 1AOYA 1LJ9A 1Z6RA 1F5TA 1S6LA 3I0TA 3I58A 3SZPA 1LB2A 1ZRDA 1DPRA 2VE9A 5JVTA 1JHFA 2V9VA 4XSZF 1QZYA 3TDZC 3T1BA 2G7HA 2P5VA 5DCMB 3RIRA 2XAJA 1FT9A 3K0LA 2LNBA 3KE2A 4F7ZA 4EJWA 3BWGA 4UUVA 1FOKA 1BOAA 2KIFA 3D0SA 3RKYA 1QNTA 1CF7A 4Y13A 4CGZA 1H0MA 5FGMA 4RGUA 2FBIA 2RDPA 2M45A 2ZFWA 1Q1HA 3WG9A 2P4WA 4PGGA 2O6GE 4OMYA 1Z9CA 2ZMEA 4G7HF 1FZPB 1FX7A 2VC1A 1U2WA 3RYPA 1UHWA 3E6DA 2XAHA 3RPQA 1J0RA 2GWRA 1MJAA 3ECOA 3EUHA 3V8LA 4UXNA 5DEQA 1BI3A 2FF4A 3E5UA 1ZN2A 2Z99A 4YIIA 2HYGD 2XV4S 5FFXA 4CICA 1LDKB 4BHPA 1CGPA 3IKVA 4N9IA 2EFQA 1O7LA 2VBYA 4IRGA 2CYYA 2WC2A 3ZMVA 1DDNA 4LJZF 4EM1A 2GA2A 2QQBA 1Z1DA 1KU9A 2JTVA 2MLKA 4AWXB 3RDIA 4B09A 3T5XA 1L3LA 1CF7B 1V4RA 2ETHA 1SFUA 2PFBA 2ACJA 5D6FA 3ZMSA 4RB2C 2DPUA 2LSOA 4OU0A 1EV7A 2A07F 3HRMA 3GEZA 1YIOA 2JRTA 2ZMEB 4JQFA 4WCGA 1QBJA 4OIQF 4GCVA 5ICFA 2L4MA 2K86A 2MD5A 4A2UA 2CO5A 4XLPF 4MEXF 3IL2A 1OYWA 2EWNA 3O6BB 1R1UA 6PAXA 4HLXA 3B73A 3FXUA 1F9NA 1FWZA 2A6HF 1WSUA 3FWEA 3JW4A 3FF5A 1RZ4A 1MZBA 3DEUA 5LBQA 1D8JA 4WF2A 1QPMA 2P6TA 3WE2A 3CUQA 4WWCA 4LB5A 4ENMA 4YFKF 2QVOA 3WU0A 3HRUA 2HQRA 3ULQB 4M72A 1FSEA 2RGVA 3I59B 4L0ZB 5E18F 2HOEA 4HF0A 3U1DA 2IW5A 5BPDA 3GXOA 4GXOA 1BI0A 5ED4A 3DP7A 3ZN0A 3ZQ7A 2K02A 2EV5A 2ZO4A 4EV0A 3SXYA 1ZLJA 3NRVA 4GYIA 4DQ2A 3FM5A 4EM2A 4ZYGA 3HIFA 3HRSA 3E6CC 2FE3A 1H9TA 1XSDA 2R7FA 2IVMA 3PFIA 2NAZA 4LMYA 5L3DA 1LEBA 1ZRCA 2BGCA 4HQMA 2DQRA 5LHHA 1O3QA 3V8JA 3JSPA 4RS8A 1U78A 3LA7A 2ISYA 5D5UB 2LKPA 2QBYA 2COMA 2D1VA 1ZG1A 3L2CA 3GO5A 2Q8KA 2QLZA 4OMZA 4QLCU 2QWWA 1UB9A 4B8XA 3M9AA 2ADUA 2Y75A 4G6DA 3FXQA 5LRSA 4G7OF 4BXUA 3CTAA 3MWMA 4GO1A 3EDPA 4MGRA 5BPIA 4Y17A 1T0FA 2O8XA 1K7AA 4ON0A 1I6XA 4L18B 5CLSA 5E8GA 3V4GA 5ICEA 2P6SA 1YW7A 5BQTA 1Z91A 3QP5A 2DK8A 3R60A 3FM3A 3BJOA 4UVBA 1XSXA 2JZYA 2G7UA 3F72A 4R79A 1XGOA 1WQ2A 3K69A 4L0YB 2F5DA 4U0WA 2P5KA 1Z7UA 2FMYA 3F3XA 2EV6A 3TOBA 3I64A 1U5TB 3DXJF 3U9GA 1P4AA 1W5SA 5LGTA 1KQ9A 2M30A 3FHZA 1B59A 2QBYB 2L54A 3F22A 1J2XA 1B1BA 1GXPA 1FBQA 1SD7A 3GLXA 3VODA 1F4KA 3CDHA 3I4PA 4ZZLA 5L3FA 4RAYA 2EFOA 1T39A 2ZNZA 3HYIA 4HW0A 3L00A 1B9MA 5A2QZ 2QYOA 4HQEA 2Y48A 5IT9K 1ZGAA 2XAQA 3KEOA 4IVNA 4LD5A 1YLFA 2O3FA 2UWMA 3GFLA 2GAUA 1ZGJA 3WTYC 2NS0A 4KUMA 1FYLA 2PG4A 4XSXF 2KRFA 5FO5A 4FX4A 3FX3A 2QM3A 5HDGA 2E1CA 3F6OA 1R58A 1KU3A 5FB2A 4I02A 2PBIA 3TOAA 4BHCA 4AIKA 5K5OA 4UVCA 4K2EA 3WTZA 4GGGA 4M73A 3ZMZA 1BN5A 3WODF 3VEPA 2DPDA 5HLHA 1BC7C 1TBXA 5E1WA 3Q5FA 3MZHA 4HLYA 4KDPA 1HKSA 2XAGA 3F8MA 3BOQA 1G4DA 2HFHA 1PUEE 3T0YA 1J75A 4KMUX 2L02A 4N0BA 2BE5F 3MAJA 1R23A 3MCZA 4G6QA 5K1YA 3E6BA 4KNYA 5FLXK 1FLIA 2KJCA 5D5VB 1IZ1A 1GXQA 3BROA 3J81K 1JE8A 3RI4A 4G7ZF 3RYRA 1ZG5A 4U0YA 1ZARA 1SMYF 2ESHA 2DFIA 2RNJA 4YIFA 3GVAA 4MQVA 5D4SA 4I7HA 1XCVA 2V1UA 1OPCA 1FYKA 3KP7A 1SD4A 2XAFA 2QENA 1HSJA 2NYXA 2MLGA 4Z2YA 1S7OA 2FQ3A 5LEJA 2IP2A 5AIPA 2KKOA 2WTEA 2OU2A 2VOPA 2XHKA 2GZWA 3ZMTA 4RB3C 4KICA 1XB4A 3GF2A 1PDNC 2GQQA 1ZH5A 2KIMA 3IKTA 2STWA 2Q2EA 3F8FA 4L9NA 1IXRC 2FMLA 4A6DA 1R5GA 2P8TA 3HUGA 3GFMA 4U88A 3JAMK 3KFWX 1W5TA 1FNNA 2HGCA 3KLOA 2H6BA 3KCCA 1KQ0A 4QWQA 3QU3A 3REOA 1D8KA 2DBBA 1G6NA 5L3CA 2Z33A 3KZZA 5CVIA 4YFNF 5ICCA 4A5MA 5IT3A 2V1DA 1YS7A 3F21A 2FA5A 5E20A 2DW4A 1TNTA 3CUOA 1OMIA 2ZXJA 4LLLA 3DF8A 5FD6A 2M1BA 4KIBA 3NEUA 1LEAA 1BIBA 4PZJA 4RB0A 2FEZA 2LF8A 4ENKA 3GFIA 2Z9OA 3R61A 1R1TA 1O3SA 1MJ9A 2XIGA 4HDVA 5DYMA 1B4AA 3K1NA 3F6VA 3QPTA 1AWCA 2W25A 4MEYF 1TW3A 2QQ9A 3M8EA 1LQ1A 3RKWA 2O03A 5CVVA 1I1SA 1T6SA 1TQPA 2OAZA 2YPRA 4O5VA 2ZBKA 3HSRA 1MKMA 2QUFA 1OYYA 2M87A 3TO7A 3I53A 4CHUA 3GFJA 1K79A 5HS9A 3TDUC 1GVJA 3J80Z 1LDJA 4WXDA 3KP3A 1IN8A 3I59A 2O61A 1YQAA 1S29A 1Z05A 2X4HA 1O3TA 4EQQA 1TTYA 2HZTA 4MQ9F 1LNWA 2A68F 5H6QA 4GYGA 1NHAA 4ASNA 2D2WA 2W85A 1J5YA 3OV8A 2M8EA 3Q9VA 5AONA 3ZN1A 4HX4A 3TO9A 2VODA 5ILUA 5CVJA 4UV8A 1LVAA 1WI9A 1TQMA 5JI6A 4PCQA 2FNPA 2FBHA 1R00A 2IJLA 2MBFA 1XGMA 2ZNYA 1IRGA 3E5QA 2JT1A 3WGGA 4CXFA 3B02A 5DD4A 5DCFA 1W7PA 1HQCA 4OIPF 4IXAA 1V3FA 4D0PA 1EH8A 1S8NA 3RKXA 1FP1D 3RJPA 4EJUA 4ZYHA 2QQAA 5LHIA 2VBXA 4KN4X 1KU7A 2XUBA 4BYYA 1D5VA 2HQNA 3W6JB 3PQJA 4FT8A 5KVRA 2OA4A 4H0EA 4L9TA 1IXCA 5F64A 3T8TA 2FNAA 2V6CA 1S3JA 3R4KA 1UHMA 5BMZA 1P4WA 4M9ZA 4Q48A 4A5NA 2ZKZA 4L9JA 3I54A 2A5YB 5CYVA 2STTA 2Z5UA 3CJNA 1O57A 3G73A 3H3ZA 3GUDA 4IHTA 1U5TA 1YO5C 1R22A 1FBUA 2R7DA 4OIRF 1IN6A 4O6JA 4EJOA 2CQKA 3TGNA 3W6KB 4P9UA 4L9VA 2PMHA 4RGSA 2VBZA 3V7SA 2OD5A 4EM0B 4P96A 3WTTC 1W7PB 1YTYA 2K7LA 2ESNA 4HX8A 1ULYA 4S05A 3MQ0A 4LK0F 2YSRA 5HOOA 2IA2A 2VONA 2EFWA 2NNYA 4AIHA 2MH2A 5EEHA 1FY7A 4I09A 4ENJA 3HHHA 1XCBA 4OOIA 2HKOA 4BHBA 2J5OA 5K5QA 4WX9A 3R0JA 2L01A 3DV8A 1QO0D 3E6MA 2OBPA 1JGSA 3KLNA 4MTEA 1I1GA 5HDKA 2NRAC 3LA2A 4FX0A 2F5CA 4I01A 4BQAA 1O7FA 1O3RA 4EGZA 1VTNC 1W4MA 4WXHA 3LA3A 2E7XA 1KYWA 2E7WA 1K78A 5HLIA 3HOTA 4YG2F 1RUOA 4P9FA 3K1MA 4NQWA 3QU6A 1ON2A 2RVCA 3HTSB 4IJAA 4ZYDA 2C6YA 4UV9A 2CFXA 3MFKA 4WK8F 3ISPA 1ZHFA 1WRJA 1KU2A 2K4BA 4MHGA 1MD0A 3I71A 1X3UA 5FD5A 1KYZA 3RPUA 1ZYRF 5EEGA 2DI3A 3SZTA 4LB6B 4ESBA 5DV5A 3GYHX 3Q9SA 4MTDA 1T38A 1U8RA 3JTHA 2P5LC 2M5WA 3ZMDA 1IXSB 5L3GA 3DQVC 4HZFA 1J9IA 2DTRA 3HOSA 2QZ8A 2UXNA 4XLNF 1MDMA 1HW1A 4U7DA 2RKHA 1K78B 4IRHA 4M71A 1XD7A 3IWZA 4FHTA 2BEOA 2HDCA 2A3SA 2DLLA 5D6EA 4HX7A 4WXCA 4Q4ZF 1ON1A 3WGIA 1P92A 5J8CA 1FSHA 1IRFA 3BJ6A 5E1ZB 1RUNA 4I2OA 1REPC 2HEOA 3V8KA 3V7RA 1BM9A 3IRRA 4CDGA 2DQLA 1IW7F 2PMUA 3SFZA 4O3MA 3CUQC 2W84A 4KIGA 1P4XA 5CJ9A 4HF2A 1XGSA 3CO7C 3S2WA 4A0YA 2EB7A 4LGWA 5D8LB 1FBSA 4A12A 4YFXF 5A2QK 2DK5A 4EMSA 1E2XA 1MDMB 3BJAA 3QP6A 2TDXA 2PI0A 4EJTA 2CG4A 5HLGA 1G3YA 5HDNA 1B6AA 3I5UA 3ZP5A 4HBLA 5E17F 4AD9A 5ILSA 4HF1A 2E1NA 1R5HA 1PP8F 1ZLKA 3GWZA 3SHFA 3F8NA 1S7AA 1SMTA 2HWVA 4LK1F 2RC4A 4OINF 1ZG3A 2X0LA 5E1XA 3HHGA 2VC0A 4ESFA 4Y15A 3IHUA 1FYMA 3WTVC 2Y0MA 3TQNA 1UFMA 4HAMA 4PDKA 3AAFA 2KIUA 1TW2A 3E97A 2EK5A 2OZUA 3FMQA 5CVRA 1A04A 5L3BA 1FC3A 2NNNA 1IAWA 2EA2A 4Q47A 2VE8A 2Q0OA 1USSA 3H3UA 5CVUA 4LLNA 5D8KB 3C7JA 4HYEA 1HBXG 3WTUC 2IA0A 1IF1A 2A69F 1HXDA 3R0AA 3O2PE 5BOXA 3LSTA 4UVAA 3ECHA 3LWFA 2HTJA 3C1DA 2D45A 3QPHA 1HSTA 2HKXA 1EH7A 4BAYA 1BI1A 3GZ6A 2GXBA 2W57A 5D5WB 3K1PA 4ZZDA 4TV7A 4G94A 2HR3A 5AIQA 1MGTA 3VB2A 1J7KA 2ZJ2A 2XASA 3FMRA 1RI7A 5DUKA 3V7CA 4EGYA 1ZAOA 2EV0A 4KYWA 3MEXA 4RGXA 4KN7X 2LF7A 1HKTA 3R6SA 1T98A 2EA4A 4P55A 2JSCA 2MA3A 2K27A 1LDDA 2YX4A 4JBAA 2ZCWA 4HOBA 1R36A 1BIAA 1KA8A 4UNOA 1XDUA 3GZ5A 4M74A 1DP7P 1BI2A 2VOOA 3DPLC 3HSEA 3GW2A 2DU9A 2K4JA 2OQGA 1YW9A 3KP2A 3GX4X 5D5XB 2IRFG 1XGNA 3FZVA 5ILVA 4M6YA 3CLOA 3EYYA 2A6EF 4KA4A 3KP4A 2D1HA 4L5JA 1C0WA 5J6XA 2VT2A 1SD5A 5D4RA 2L4AA 3L09A 2LDUA 2OQRA 2Z3YA 2PLYA 3ELKA 3QOPA 2CGPA 5JHUA 3P9KA 3LQQA 5HS7A 3VFZA 2VN2A 3F8CA 2FOKA 2RV8A 3WU1B 2IPQX 5ICGA 4JK1X 1YS6A 3BY6A 3BDDA 4P5OA 1KGSA 3C3WA 4A0XA 3CO6C 1UCRA 3TKYA 3JTGA 3F8BA 1RNLA 4I0BA 2FXAA 2F2EA 4BNCA 1YG2A 4R8HA 1JXSA 2VBWA 1J59A 5HVQC 1G3TA 5TRDA 2DT5A 2EFNA 1QQIA 4EVIA 3IRQA 3L7WA 4RAZA 1SFEA 4IRIA 3KP5A 1TLHB 4HDUA 2W24A 1E17A 4ETSA 1IUYA 2WWYA 4Q5SF 5F6FA 1WWXA 3SQNA 3J80K 4I98B 3O3KA 1H9GA 5H6RA 4LLGF 4N9HA 1DUXC 2GIVA 5FFZA 3KP6A 4L5IA 2R3SA 1HW2A 2H6CA 2IA1A 3WTWC 2PJPA 3HSFA 1P2FA 3N4MA 4ESJA 1P6RA 1IN5A 1ZRFA 3LAJA 4LG0A 3IC7A 5KK1A 3M1EA 3KETA 2BBYA 4A6EA 4HV5A 3WGHA 4KMFA 4EJVA 5LGUA 2MH9A 3M7GA 3P7NA 1DPUA 1L0OC 3G3ZA 1SAXA 2G9WA 2BV6A 4G9YA 5DDGA 5HS8A 1XN7A 5LRRA 5TJJA 1BBYA 3DKWA 2ISZA 4LFUA 3HTUA 1OR7A 5LGNA 1F1ZA 1USTA 3ABUA 3C18A 5IT9Z 1HW5A 1FPQA 3QAHA 4CO8A 3CUQB 3K2ZA 4ZYEA 2CSOA 5K5RA 3L9FA 4NB5A 2XGXA 3H92A 3LFKA 2RN7A 2VT3A 1U3EM 4NHJA 5ERIA 2YU3A 5JFRA 1W7PD 2EFPA 4I0AA 1SFXA 2O0YA 4RGRA 5LEKA 2FBKA 1YYVA 3KEQA 4LG0B 2FRHA 2UXXA 3E3VA 1STZA 1XMAA 1T2KA 2YX7A 2P7CB 4MNUA 3ZMUA 2J5PA 2OZ6A 2P7VB 2CW0F 1B9NA 4RB1A 2BYVE 3BP8A 5E8IA 2XRNA 2AXLA 3WTXC 2UZKA 2XROA 1YFHA 1I5ZA 3DPTA 3FMSA 3PQKA 5LLQA 2V79A 3FXRA 1IN4A 3BPXA 4XRFA 3P9CA 3K9TA 5FLXZ 1Y0UA 2H94A 4E70A 3WE3A 4KT5C 2A61A 4PGHA 5J8FA 1Z6TA 1KQ8A 3J81Z 1K6OA 2FSWA 4KFCA 1EH6A 1R7JA 3E5XA 3N97A 4KIFA 4BH9A 4IPAA 2MC3A 1OKRA 4UHTA 2WV0A 2B0LA 3BZ6A 3EYIA 2V1XA 3LQRA 5H20A 2ELHA 4HA8A 4AIJA 3LAPA 3HRTA 3F23A 1YW8A 3U2RA 1G3SA 3ERED 2PN6A 4M9XA 1ODDA 3J7AO 4AVPA 3OOPA 1G3WA 2HTSA 3ML6A 4M6XA 2H09A 4S04A 4ENNA 1FP2A 3DFGA 2VXZA 3P9IA 2XKOA 2EJRA 4A0ZA 4CZZA 1BC8C 2KJBA 1R1VA 1PP7U 1IN7A 4XBFA
chains in the Genus database with same CATH superfamily
1QZZA 2YSPA 5LD2C 1Y56A 4C2TA 2WBTA 5AE3A 4TUIA 3ABLH 1X47A 2XGDA 3DTKA 1OYIA 3W6VA 5F3WA 3JAMZ 4F3QA 2QSFX 5TGTA 1OCOH 2YT4A 2IAIA 4EEFG 3ABTA 2A25A 1D3YA 5F1RA 2IS6A 1IQSA 2IT0A 2KDZA 4AYBA 3PUBA 4CCJA 1I6HJ 1XMOE 1GZ6A 5B1AH 1XDSA 2RPCA 5BS6A 5DUIA 3ZPLA 3HG9A 3ABKH 3CC4I 3COAC 4ANJA 1TNSA 4KHPE 1RIOH 1FMWA 1I27A 2CQXA 5GTHC 4F9AB 3CCQI 2AS5F 2VPRA 1AH5A 3TO6A 2XKPA 5L3EA 1P47A 3DEEA 3KZYA 2GXGA 3M8JA 3ECRA 3F0CA 1QVTA 4IOAF 2EN3A 2L2OA 4E7IA 4GFBA 2XF7A 3VOEA 4O43A 2X6OA 2M9AA 4E7HA 1PKPA 2RQPA 3T8RA 4CYDA 2XVCA 1MJBA 1ZELA 1ONVA 2EIKH 1J09A 5CKTA 1WKMA 2A6TA 1U5TC 4M30A 2H27A 1MBGA 4HV6A 5LHGA 4IF4A 1MMNA 3M8FA 4A93J 4IHYA 3PSIA 3ROUA 1HNZE 1X6EA 2EQ0A 1GDTA 1P7IA 4M9SA 2DA1A 4DNCA 2EOEA 2E19A 2PEXA 2EL5A 3Q0VA 1LVKA 5IYDJ 3EETA 1BJAA 3OOUA 2EPMX 5DCMA 3KIOA 4V2FA 3ZOQB 2CUJA 3G2BA 5FRNA 4BCAA 5A69A 1X1BA 1YOVB 2MD0A 4X65E 4E7SA 3QRFF 5KCMA 2NVTJ 3K70D 4G8XA 3NQOA 4ZH4F 1KZHA 4Y33A 1FMVA 3FKJA 3LMMA 2HS5A 2DAOA 2EM8A 5B3SH 1ENHA 5IT9C 4HNUA 3HGYA 2CT1A 2B9DA 2FU4A 3JSOA 2F5EA 2EQ1A 4U0VA 1HKQA 1JHHA 5M5YJ 4IKFA 2A5WA 2L3DA 4U7BA 1T8IA 4AUXA 3OYEA 1XMKA 4AC0A 1VF9A 3D5LA 2O9LA 1IUFA 2NS8A 2HYFA 1T0FC 5EZHA 4R1HA 2GLOA 2IGKA 3UK3C 2VXDA 2LJHA 2CWEA 4ITVA 2ZC2A 2YR2A 2B3TB 4BJ6C 1U6GA 2W48A 4OIOF 5IYBJ 1XSVA 1GHCA 3RTRA 3EQLF 1QPIA 2QQ8A 3IWFA 2TRTA 2E72A 2LFBA 1SD6A 1ORKA 3MZYA 2JPCA 5JR3A 1WH5A 1WI3A 2F5FA 2DFEA 2ZXHA 1WFXA 3BPVA 5DD8A 4AVZA 2GA1A 1TWAJ 1ZREA 2LY2A 2JPBA 1JT6A 2PQ8A 1QGPA 3OR1C 2OF7A 4RH8A 4LTYA 4DV4E 3WTSC 4IHSA 4XQFA 2DO7A 1TQIA 1AOYA 2VL8A 3QG5C 4AIDA 1LJ9A 1Z6RA 3F9KA 1F5TA 1S6LA 5IPAA 3L2QA 3I0TA 3W2VA 1MSFC 4CCKA 3I58A 4K0KE 3SZPA 2HNHA 1LB2A 1FEXA 1A36A 1DQ3A 1ZRDA 1VFCA 1DPRA 3I9V2 2K5CA 1Y39A 2VE9A 3JTZA 3E0JB 5JVTA 1JHFA 2CSHA 2V9VA 1YRNA 4XSZF 1QZYA 3TDZC 4A3MJ 2EMLA 3G1LA 3T1BA 2G7HA 2P5VA 5DCMB 4HSTA 3RIRA 2XAJA 1FT9A 2DIXA 3K0LA 4P7DA 5AC5A 2LNBA 3KE2A 1S9HA 4F6MA 2EM5A 4CYCA 4F7ZA 4EJWA 1ZBQA 3BWGA 2N3GA 4UUVA 2R5ZA 1FOKA 1BOAA 2KIFA 3GTLJ 2CS3A 3D0SA 3RKYA 1QNTA 2JMWA 1CF7A 2DCEA 3GZNB 4Y13A 4CGZA 2LMDA 4DV0E 2JP9A 2LRDA 1H0MA 4E4HA 5GTIC 5FGMA 2GPIA 4RGUA 4D5FA 5CQEA 3C2HA 1IRZA 2FBIA 3DU5A 2RDPA 3IH2A 2M45A 5KAIC 3G6EI 3BQZA 4LOCA 5EGOA 2ZFWA 4R2PA 1Q1HA 3WG9A 3B6CA 2OJED 2EOMA 1RRJA 3BG6A 4IJDA 2P4WA 4PGGA 1RR8C 3BR6A 2LKXA 2M7AA 3EPZA 2O6GE 1QU3A 2F6CA 4OMYA 1Z9CA 2ZMEA 2M1SA 4NHRA 4YELA 4G7HF 5J4YA 1FZPB 1FX7A 2VC1A 2NUFA 4M3FA 1U2WA 3RYPA 1FJGE 3FXMA 3E7LA 5GAEJ 2HOAA 2V8QB 1PYVA 4XORA 2JR1A 1I50J 4L5EA 2DSYA 2KZVA 3CCLI 1UHWA 3E6DA 2XAHA 3RPQA 1J0RA 2VKDA 2GWRA 1MJAA 1B8IA 3ECOA 4BXXJ 3EUHA 4R2EA 3VHTB 3C2GA 4NC8A 3RQIA 3V8LA 4Z6YA 4M2ZA 1SFKA 3CCMI 4UXNA 1Y8RB 1BI3A 2WAQN 5DEQA 4MFDA 4HNTA 2FF4A 3E5UA 4IOCF 2KRCA 1ZN2A 2EM2A 2Z99A 3A03A 2HYGD 4YIIA 5IOZA 4NNJA 2XV4S 3BGHA 3T1HE 5FFXA 3BG3A 4CICA 5DNYA 2EN8A 1LDKB 2KRHA 2F4OB 2EM7A 2YRHA 4BHPA 5M3FJ 1CGPA 3IKVA 4N9IA 4AQYE 2EFQA 1W5CC 1TWCJ 1O7LA 2VBYA 4DZPA 4IRGA 2CYYA 2WC2A 3FBNB 3ZMVA 2Z2SB 1DDNA 2XPVA 4LJZF 4EM1A 2GA2A 5ADZA 3AFHA 2KHMA 2QQBA 1IGNA 2YU8A 3D5SC 1Z1DA 1KU9A 2UUAE 2EL4A 4DMIA 2R5ZB 1TC3C 3CC2I 4M3EA 2JTVA 2MLKA 1A6IA 2K9SA 3RDIA 4AWXB 2EOFA 4B09A 2FTXB 1BA5A 3T5XA 1L3LA 1CF7B 2YU9J 1T33A 1V4RA 2ETHA 1SFUA 4IS1C 2F48A 3ZOBA 3L2WA 2LTRA 4A69C 2PFBA 3C4TA 2ACJA 5D6FA 4UB8C 1STUA 3ZMSA 3OYLA 2LD5A 2E2JJ 4RB2C 4XL9A 3JAMC 4LG3A 5EGOB 1RETA 3QYEA 4E7KA 2DPUA 3HTXA 2LSOA 1LFBA 4OU0A 1ZGWA 9ANTA 1EV7A 1ZR4A 1YJWI 2A07F 2M0CA 1WGXA 5FKNA 5JVGF 5CQGA 3HRMA 3GEZA 4JP0A 2GOMA 3HPZA 1TF3A 3CDIA 1A1KA 1YIOA 2JRTA 2ZMEB 4NC7A 2N8GA 3CDLA 1A6QA 2Y30A 4JQFA 4WCGA 1QBJA 4OIQF 4GCVA 2FV4B 2R7UA 2ODRD 1A1HA 5ICFA 2L4MA 2L8TA 5E3OA 2K86A 2MD5A 3BR5A 1HNWE 3H9JA 1YHQI 2M3AA 4LIUA 4A2UA 2CO5A 5HNFA 4RA2A 4XLPF 4MEXF 3QPLA 2YTEA 3IL2A 3LMLA 1OYWA 2EWNA 2R93J 4RM3A 3O6BB 4U87A 1R1UA 1WH7A 6PAXA 4HLXA 3B73A 3FXUA 4YHHE 1F9NA 2M34A 1FWZA 2JWOA 2LP0A 2O8KA 2JA7J 2A6HF 2IHR1 3OWTA 2V4JC 2M4GA 4LF5E 2DJIA 1WSUA 3FWEA 3HOZJ 3VYXA 3JW4A 3FF5A 1RZ4A 4KISA 2BVLA 1MZBA 3BCAA 3DEUA 4ABZA 5LBQA 1D8JA 2L92A 4JI7E 4WF2A 2ELZA 3S17J 1QPMA 2P6TA 1SANA 3WE2A 3JREA 3HDDA 1UELB 3CUQA 1MBEA 4WWCA 4LB5A 4YFKF 1Z21A 4ENMA 2X6WA 2X1EA 2XSJC 2NVQJ 1QZEA 2H1LA 4O24A 1YIJI 4RBOA 2L9SA 2QVOA 1UAAA 3WU0A 3ZQIA 3HRUA 4BBRJ 2HQRA 3ULQB 1V5EA 4GKKE 4M72A 4JV5E 2QF7A 1FSEA 2RGVA 5F1JA 2JVGA 3I59B 2BHZA 2VKVA 2HOEA 4HF0A 5E18F 4L0ZB 1FTZA 3SEQA 2CW8A 2EM9A 3U1DA 4FTHA 2IW5A 1MNEA 5BPDA 3GXOA 4GXOA 1JKPC 2X1DA 1BI0A 1MH3A 2EIMH 5ED4A 3DP7A 3ZN0A 3ZQ7A 2K02A 1GT0C 2EV5A 2ZO4A 3TBIA 2EOZA 2QGUA 3VWBA 4EV0A 2WBSA 3SXYA 1G8XA 2BB8A 2L9RA 2UUZA 2YPNA 3CCYA 1ZLJA 3J7YJ 3NRVA 1H88C 3QYBA 4BDYA 2KL4A 4XOPA 4GYIA 4DQ2A 3FM5A 4EM2A 4ZYGA 3HIFA 3JRGA 3FXLA 3HRSA 3ABMH 3E6CC 1AKHA 2FE3A 3THOB 1H9TA 1XSDA 2R7FA 1N3GA 2IVMA 3ADGA 4NUBA 3MHHC 3PFIA 2NAZA 4LMYA 3PO3J 5L3DA 4BACA 1B72B 2BGCA 1K4TA 1ZRCA 1LEBA 4HQMA 2DQRA 5LHHA 1O3QA 3V8JA 1W36D 3JSPA 5AE2A 4RS8A 1U9NA 1TZLA 4Y4RA 1U78A 3LA7A 2ISYA 2LVSA 3HKZA 5D5UB 2LKPA 2QBYA 3MN2A 2COMA 2D1VA 2DLQA 3CMYA 3WG7H 3L2CA 1ZG1A 3GO5A 3FXOA 2Q8KA 4GZNC 2QLZA 4RLQA 1RC7A 4IL6C 4OMZA 4QLCU 2QWWA 1UB9A 4RMNA 3M9AA 4B8XA 2X9DA 2ADUA 2LVHA 2Y75A 4G6DA 3OL4A 4IEJA 3MMYB 5E3MA 2BVMA 4GEQB 3FXQA 4CA0A 3H35A 5LRSA 5A6AA 4LF7E 2Y0SN 4G7OF 4JI8E 4BXUA 3CTAA 2ZSHB 3MWMA 4GO1A 2LH9A 1N33E 3EDPA 4MGRA 5BPIA 1GQEA 1YSAC 4Y17A 4BS9A 3SDBA 4DKKA 1NG7A 2WB1N 1T0FA 2O8XA 1WVRA 1K7AA 4DV7E 4ON0A 1I6XA 2F4IA 1ETKA 2ID3A 4L18B 5CLSA 5E8GA 3AL0C 2DFFA 3V4GA 3H1CA 5ICEA 1X1AA 3SFIA 1UJ8A 2KFDA 2KQRA 1ZAAC 2ZSIB 3HOUJ 4HSRA 2P6SA 3OS2A 4E7JA 2YTGA 2K7IA 1YW7A 2F5VA 5BQTA 2CV2A 2DK8A 1Z91A 3QP5A 3MKZA 3R60A 2EMHA 2VPLA 4YRVA 3FM3A 3BJOA 4UVBA 1XSXA 2JZYA 2G7UA 2Z1DA 3F72A 4R79A 1XGOA 1WQ2A 2E36A 3K69A 4L0YB 2F5DA 4U0WA 2KDOA 3M4OJ 1AKHB 4JI6E 1RR7A 2NOGA 3EQ1A 2P5KA 2R7ZJ 1Z7UA 2YWQA 2EWLA 2FMYA 1NG6A 3F3XA 4CCOA 4X9JA 2EV6A 3LSJA 4FISA 3TOBA 3I64A 1U5TB 4X62E 1X19A 3DXJF 3U9GA 5A6KA 2W1OA 2LTPA 1YJNI 1P4AA 1W5SA 5LGTA 2DMUA 1KQ9A 2M30A 3FHZA 2QSHX 2WAEA 3FHNA 4DV3E 4MFEA 1B59A 1UMQA 2QBYB 2HC5A 4W1UA 2L54A 3F22A 1J2XA 2DYSH 2VKHA 1FIAA 2ME6A 3EPJA 1B1BA 2EILH 1IBKE 5J1RA 4GRIA 1GXPA 1FBQA 1SD7A 3TQMA 3LSRA 3IAS2 3GLXA 3VODA 2DT6A 3S3NA 1F4KA 4RAGA 3CDHA 3BR1A 2L3JA 3I4PA 4ZZLA 3OS0A 5L3FA 4P78A 4RAYA 2EFOA 1T39A 2ZNZA 3DTIA 3HYIA 4HW0A 4IQ4A 3L00A 1B9MA 1D5YA 4B3TE 2UUBE 2EPLX 5A2QZ 3EPKA 4JX6A 3L2UA 2QYOA 2K9MA 4HQEA 2Y48A 2V88A 5IT9K 1ZGAA 2XAQA 3KEOA 4IVNA 4LD5A 3S14J 1YLFA 2O3FA 1XG1A 2UWMA 3ZR8X 1QHHD 4PJMA 1YYWA 3AV0A 3GFLA 2V9KA 2GAUA 3VYSB 5JHFA 2L7ZA 4NBQA 1ZGJA 3S32A 3WTYC 3OY9A 2YTDA 2CUEA 2NS0A 4KUMA 1XC5A 4H4KC 1FYLA 2JUGA 4QIWN 2PG4A 4XSXF 2IBDA 4M6VA 1DGWY 1XNQE 1OQYA 1FTTA 4XRSG 5HLTA 1BW5A 3KEYA 1TWFJ 2KRFA 5GAHJ 5FO5A 4FX4A 4XKCA 1T4NA 3RMPA 4JI1E 3FX3A 2QM3A 4QSHA 5HDGA 2E1CA 3F6OA 1UHZA 4LFCE 1R58A 3OL3A 2EPZA 3IAM2 5LFAA 1KU3A 5FB2A 3CD6I 4I02A 2PBIA 3UKGA 2EMXA 3TOAA 1MBJA 4BHCA 2FOWA 3FISA 3H5RA 4AIKA 1ITYA 2RTXA 5T6JA 5J40A 2ELKA 2VUMJ 4BE0A 1KJKA 3UNGC 2OC6A 3S15J 5K5OA 4OOGC 4UVCA 4K2EA 3X2QH 3THNA 3WTZA 3ZXSA 4GGGA 2W4SA 5FRMA 4M73A 4NQWB 3ZMZA 4IHVA 1BN5A 5F08A 4JX4A 4D9JA 2IEKA 4MO7A 4PJNA 3WODF 3VEPA 2DPDA 5HLHA 1X3ZB 1BC7C 1TBXA 4XM3A 5E1WA 2L5QA 4CCLA 4XIDA 3MZHA 2YUSA 3Q5FA 1RQ0A 2CUFA 4PUSA 1N77A 3ERMA 4BJ5C 4HLYA 4KDPA 3VYTB 2Y9YA 1HKSA 2XAGA 3F8MA 3JU0A 3DBLB 4PJLA 1ZKGA 3BOQA 1G4DA 3PJRA 2UXCE 2HZDA 2LBFB 4B48A 2HFHA 2I9IA 1PUEE 3T0YA 4HEIA 2VJIA 4II2A 1FOXA 1J75A 3OR2C 4KMUX 1VQ7I 1APLC 2V87A 2HVSA 3LSHA 4KJZA 1IBLE 4XONA 1X6FA 1LPQA 1VNDA 1Z3YA 2L02A 3BR3A 1JUPA 3EUKL 2BE5F 4N0BA 5DM6F 3JRAA 3MAJA 4PK4A 1MMSA 1R23A 3MCZA 4G6QA 2MC4A 4LFAE 2R7RA 4BQNA 5K1YA 3MKWB 3E6BA 4KNYA 5FLXK 1U8BA 1I3QJ 1NTCA 1FLIA 2KJCA 5D5VB 4AU7A 2YTOA 1IZ1A 4F6NA 1GXQA 3BROA 3J81K 1JE8A 3ZGKA 3RI4A 3OYAA 2EMBA 4DR6E 3JRHA 4R03A 2EPFA 2EM6A 2R0QC 3K4CA 4G7ZF 3RYRA 1ZG5A 4Q28A 1MW7A 4L5NC 4XRMA 1H89C 2RNGA 4DUYE 4DV1E 1R4NB 5AASA 3BR0A 4U0YA 1ZARA 1SMYF 2ESHA 4BQQA 2DFIA 2RNJA 4UUTA 3DKXA 4YIFA 3JRDA 3GVAA 5M5XJ 1ZK8A 2OTLI 4I76A 1T4OA 2WBUA 4M9VC 4MQVA 5D4SA 4I7HA 1XCVA 2V1UA 1HOMA 1OPCA 1D0YA 1QU6A 1S72I 1FYKA 3KP7A 3KWRA 1SD4A 2XAFA 2EN1A 2FUG2 2NOJB 2QENA 2DA6A 3GTPJ 1HSJA 2YRMA 2NYXA 2VRDA 2K3FA 2MLGA 2L7MP 2BW3A 4Z2YA 1N36E 3GTGJ 1S7OA 2FQ3A 3P5JA 2MDGA 1YZ9A 2XB0X 3JRIA 5LEJA 2IP2A 5AIPA 2KKOA 2WTEA 2WCC3 2OU2A 1YUIA 2L2KB 2MG4A 3HOWJ 2VOPA 2XHKA 4BY1J 3DBHB 2L2MA 2GZWA 3OYIA 4LU9A 1T56A 3ZMTA 4KICA 4RB3C 2DA2A 1XB4A 3O8HA 2XGEA 3DKYA 4XLHA 2EM0A 3GF2A 1PDNC 2GQQA 1MBKA 2LY9A 3FIWA 1ZH5A 1SVMA 2ADRA 2KIMA 3HOXJ 3IKTA 3ADIA 2STWA 1OR7C 2K9NA 2Q2EA 3F8FA 5IV8B 4DV2E 2DFHA 4L9NA 4E7ZA 3ADJA 3BTCA 1IXRC 1QRYA 2LO3A 3A01B 2FMLA 1TP4A 3KZIC 2EMWA 1OCCH 2Y69H 1R5ID 4XMYA 3S1MJ 4NXNE 4XNFA 4A6DA 1R5GA 2P8TA 3HUGA 3CMEI 4D5CA 2BZTA 3GFMA 4U88A 3JAMK 3P1XA 2QCOA 3FXJA 3KFWX 1KYQA 1W5TA 2JJ7A 3PSFA 4GKJE 2ZJRF 2E2HJ 2O7OA 4LF6E 1BR1A 1FNNA 2HGCA 2KP6A 3KLOA 3MZ8A 4HNVA 2H6BA 3KCCA 1KQ0A 1S5LC 1XMQE 2EPPA 2R76A 3PNVA 4QWQA 1W1WE 3AG2H 3QU3A 3NARA 3ONQA 5A6BA 2EZIA 2VE7C 4J8ZA 4PJJA 2JQ7A 5CPRB 1UILA 3REOA 2WAQA 1D8KA 2DBBA 3PUFA 1XPXA 3I56I 3RZOJ 3ZQFA 1G6NA 2AO9A 5L3CA 2EOSA 3MSWA 2Z33A 3KZZA 1JT0A 5CVIA 2EPKX 4CZCA 4YFNF 3BCBA 5ICCA 4A5MA 2NA2A 5IT3A 2ME0A 2V1DA 3FK7A 2VB6A 4B3XA 3BG5A 5KHDA 1YS7A 3F21A 2BW3B 3CCSI 2HOTA 3BC8A 3VYRB 1X3WB 1N75A 2FA5A 5E20A 3M07A 2DW4A 5IXMB 1TNTA 2HXIA 2KMUA 3CUOA 1OMIA 1BR2A 2ZXJA 1Y1VJ 3D1NI 1MMGA 4XR6A 4LLLA 1A1IA 1R49A 3DF8A 5FD6A 1AA7A 1WHNA 1A1JA 2M1BA 4KIBA 3NEUA 2HPIA 1WJPA 5FLXC 1LEAA 2COBA 3C2BA 5J1UA 1BIBA 1Y8QB 4FE4A 2X48A 3V42A 3OTOE 3S93A 2Q2EB 2LREA 3LSIA 2GBYA 2I8DA 4PZJA 3BQYA 4RB0A 3J81C 2X1CA 2FEZA 1IV6A 2LF8A 3CZ6A 2XDVA 4ENKA 2R92J 2M7QA 3GFIA 1PUFA 1Q1VA 1UN6B 3NWTA 1XS9A 4G12A 2EOOA 5GPCA 3R61A 2Z9OA 1R1TA 1VQOI 1O3SA 1MJ9A 2XIGA 4HDVA 5DYMA 3VSLA 2R7SA 1B4AA 3HUGB 4W97A 1HA8A 1VQ4I 3K1NA 1XNRE 4BL0B 2X85A 1TN9A 1HR0E 2M4KA 2A05A 3F6VA 3QPTA 3K2AA 1AWCA 1ZR2A 2W25A 2RQLA 4MEYF 2K9QA 3K70C 2UUCE 1TW3A 2F8BA 1A5JA 2M9HA 2M2EA 2QQ9A 3M8EA 2P81A 1LQ1A 3RKWA 2O03A 5CVVA 1I1SA 1T6SA 1TQPA 1V5GA 2IXSA 2OAZA 4RHBB 2YPRA 2ZJPF 3IH4A 2XRLA 3PL8A 1E0EA 2CH0A 3A0BC 2DGCA 4O5VA 2ZBKA 1A1GA 3DU6A 4XLAA 4R2SA 3HSRA 1PJSA 4IQJA 2E34A 1MKMA 4BBYA 2MGQA 2QUFA 3G1OA 1OYYA 4BXFA 3PNTA 3CMAI 3S1NJ 1SVLA 2L9VA 2M87A 3CESA 3TO7A 1NEIA 1K6YA 4A3LJ 4DIQA 3CP8A 3I53A 5E79C 4CHUA 3GFJA 1K79A 3GTOJ 5HS9A 3S1RJ 4BQOA 2YTPA 4PSXA 4FK5C 3TDUC 1GVJA 1O0WA 3J80Z 3H36A 2J7JA 4M3GA 1LDJA 1WJEA 2X6YA 3CCUI 2ZFUA 2HOSA 4WXDA 1Z3XA 1D1CA 2EINH 2LK2A 3KP3A 1IN8A 1WZ2A 3CCJI 3S1QJ 3I59A 2EMCA 2O61A 2YTIA 1AHDP 1YQAA 1S29A 2HDDA 4FE7A 1Z05A 2N8XA 1LLMC 1BBOA 3CCVI 2BHYA 5IOYA 2X4HA 1O3TA 4EQQA 2JSPA 2AQFA 2XPWA 1TTYA 2HZTA 4XKBA 4MQ9F 3OIQA 5A6BD 2V86A 1X6HA 1PUFB 3ASOH 3AL0B 2I13A 1LNWA 2A68F 5H6QA 4GYGA 4RAFA 1NHAA 1YX3A 4ASNA 4F54A 3HL2A 2D2WA 2OCCH 2W85A 1J5YA 4BE1A 1GV5A 3OV8A 2M8EA 3Q9VA 5AONA 2LG4A 4BGDA 3ZN1A 4BC9A 1TT5B 2PJRA 1ZTRA 1YE9A 4HX4A 3TO9A 2IS1A 1IDYA 2MC5A 4LF8E 5EDNA 2E5ZA 1DU0A 3L2VA 2VODA 5ILUA 4X64E 2CJJA 5CVJA 5KNLA 2EOIA 1GV2A 2YS9A 2HYJA 4UV8A 1Y1WJ 1LVAA 1WI9A 1TQMA 5JI6A 1B72A 4X1EA 4F2JC 1EKEA 2FX0A 4PCQA 2FNPA 2BY0A 3DBRB 2FBHA 3QYFA 1O4XA 1R00A 2IJLA 1NK2P 1JKQC 2MBFA 1XGMA 2VKEA 2ZNYA 1RKWA 2DMQA 3K4JA 1IRGA 3E5QA 1X48A 1TWGJ 4GDFA 4B3ME 1ETXA 2JT1A 4XLEA 2HXOA 3WGGA 4CXFA 3B02A 2NUGA 5DD4A 5DCFA 1W7PA 2LYCA 1HQCA 2QKMB 4OIPF 4QTRA 4IXAA 1N34E 1FOWA 1V3FA 4D0PA 2W7NA 1EH8A 4CH7A 1PJTA 1S8NA 4XN3A 3RKXA 4OX9E 1CQTA 1FP1D 3RJPA 3DCFA 4EJUA 4ZYHA 1Z0XA 5IP6A 3RCOA 2QQAA 2LUPB 5LHIA 2VBXA 4KN4X 3LSGA 1KU7A 2XUBA 4BYYA 1D5VA 2HQNA 2JK3A 3W6JB 2NVYJ 2B7VA 2E1MC 3PQJA 2EN7A 3KYCB 4FT8A 1MMAA 2Y0SA 4NDLA 2K85A 1NH3A 4ZTFA 1W0UA 5KVRA 2OA4A 4HRIA 4H0EA 1RPWA 4F91B 4BJTA 4L9TA 2WB1A 3OYKA 3LLHA 2EQ3A 3DLAA 3S3MA 2LV2A 1IXCA 3CJQB 5F64A 2AQEA 3JRFA 3T8TA 2FNAA 2V6CA 4ZYAA 1S3JA 1Z77A 3A0HC 4KITB 2JOBA 3R4KA 3ZQHA 4JYAE 2EZLA 1UHMA 4XRSA 1P4WA 5BMZA 3S2DJ 2PJRB 4M9ZA 3IWDA 2KIQA 4Q48A 2WBMA 3K7AJ 2Z16A 4HG2A 2HI3A 3CMMA 3HXLA 2ZKZA 4L9JA 3I54A 4A5NA 4DR7E 2A5YB 5CYVA 2STTA 3IWCA 5TISC 2K4VA 2VI6A 1I39A 2EPOA 3MKYB 2JPAA 2Z5UA 1IRXA 4F9BB 3CJNA 1H8AC 5FKMA 1VQ5I 1O57A 4G6TB 3H3ZA 3LNQA 3QPSA 3G73A 3PIOF 4DOZA 5C4JJ 3FXKA 3GUDA 4IHTA 2L6MA 2X6XA 1U5TA 1YO5C 1R22A 2F4MB 1FBUA 2R7DA 2H8RA 4OIRF 4DZJA 2RAEA 1YITI 2EPAA 1IN6A 4O6JA 1BR4A 4EJOA 3H09A 3HGGA 2CQKA 2DB2A 2GIZA 4C30A 3HPSA 3TGNA 3W6KB 4P9UA 3HPHA 2HQ5A 4BEHA 4BMJA 3BF2A 4L9VA 2PMHA 1UBDC 4C2MJ 3HZJA 4RGSA 5IP9J 1R71A 2VBZA 3HQ1A 3V7SA 3VPRA 1HC8A 5C44J 1JKRC 2OD5A 4EM0B 1WHUA 4P96A 3WTTC 1W7PB 4DYCA 2D9HA 1LE8A 1YTYA 2K7LA 2ESNA 2HQAA 4HX8A 1ULYA 1F43A 2EOHA 4S05A 1GTKA 3MQ0A 2CQNA 4LK0F 2BY1A 2YSRA 1DU6A 1SR9A 2OUMA 5HOOA 1VQMI 3G71I 3M3YJ 2IA2A 1X5WA 1MMDA 2VONA 4X6AJ 2JY9A 2KISA 2ODRC 2ZB9A 4A3JJ 2EFWA 2QKLB 2NNYA 4AIHA 2MH2A 4NXME 1A35A 4J01A 2PRTA 5EEHA 1FY7A 2CUZA 4I09A 3PO2J 4A3FJ 1D1BA 1W0TA 4ENJA 3HHHA 1XCBA 2LLKA 4OOIA 4RDUA 2HKOA 4BHBA 4PFPA 3OMYA 2J5OA 2LJUA 5K5QA 4WX9A 3R0JA 2L01A 3ZQQA 3DV8A 1QO0D 3E6MA 2OBPA 3LFUA 5FKLA 1JGSA 3KLNA 4MTEA 1I1GA 1ZQ3P 3ADLA 5HDKA 2NRAC 3LA2A 4FX0A 3TL4X 4F92B 1YI2I 2F5CA 1MEYC 4I01A 3IUOA 3TMOA 4R8OA 4BQAA 1O7FA 3EPHA 2R5YA 1O3RA 4EGZA 1VTNC 1W4MA 4WXHA 3LA3A 4A3KJ 2E7XA 1KYWA 2LRSA 5HNHA 2E7WA 1K78A 1NCSA 1IO2A 5HLIA 3HOTA 4YG2F 2VLAA 1RUOA 4P9FA 3K1MA 2EORA 3OMLA 4NQWA 4XLCA 2EPUA 3QU6A 3HB9A 1ON2A 2CMPA 3JRCA 2EM4A 2L2NA 4JI2E 5TSEA 2RVCA 3HTSB 3SEZA 2KONA 1N32E 4IJAA 3I4MJ 5E3LA 4N4RB 1EKZA 1X1PA 2YTFA 4BEHB 3EUHC 4JX5A 1JTXA 2E5NA 3HM5A 5M3MJ 4LF9E 2H36X 4ZYDA 2C6YA 4UV9A 3DJWA 2EPXA 4JI5E 1YYOA 1IQOA 4WSPA 4A3GJ 2DYRH 4EATA 2CFXA 2OPTA 1VI0A 4B43A 2V89A 1LE8B 3J7Yp 4XICA 3MFKA 2LY1A 5DM7F 4WK8F 1OCPA 3ISPA 2PMZN 2LBFA 1VQ9I 3OIOA 1ZHFA 1WRJA 4CCMA 4WSGA 1KU2A 1WJ5A 2K4BA 2AHQA 1Z67A 3LOCA 4MHGA 2GHFA 1MD0A 5GPAA 3I71A 1J5EE 4XLFA 1X3UA 5FD5A 2EOYA 1KYZA 3UR3C 4DV5E 2MYSA 4X8WA 3RPUA 1G2FC 1ZYRF 5EEGA 5F0HA 2DI3A 2EPNA 3EPLA 1OJLA 3SZTA 4BC7A 5J4VA 2Y9ZA 4DGWB 5GP9A 4LB6B 2DOFA 3H5AA 4ESBA 5DV5A 3FKIJ 3AG4H 3GYHX 3Q9SA 2V9PA 4MTDA 1T38A 1U8RA 5KL3A 2DJNA 3JTHA 1W36C 5IWAE 2P5LC 2M5WA 4BUPA 3ZMDA 1IXSB 3HJEA 5L3GA 3DQVC 4HZFA 1J9IA 2DTRA 1UZCA 3HOSA 2QZ8A 4A3IJ 1I3AA 2UXNA 4XLNF 1MDMA 3HOYJ 1JUSA 1HW1A 1WJDA 1ACIA 3K4KA 2R5YB 1F36A 4U7DA 2LE2A 2ICWG 4BY7J 5H2FC 3L1PA 2RKHA 1K78B 2BBGA 4IRHA 4P1WA 4M71A 3FDYA 3HBLA 3H3VK 1XD7A 2LR8A 3IWZA 4NC6A 4FHTA 4B3RE 2UXBE 3BTIA 2BEOA 4FQGA 4D1QA 2HDCA 2A3SA 2DLLA 5D6EA 2BXZA 4HX7A 4WXCA 4DW6A 4Q4ZF 1ON1A 1N25A 4LIVA 3WGIA 2EMAA 1P92A 5J8CA 1FSHA 3CJRB 1T4LB 1UG0A 1IRFA 3BJ6A 2YTJA 2BY3A 3S8PA 3AG1H 1YUJA 5E1ZB 2WY8Q 5IY5H 2YSOA 1RUNA 3OYGA 4I2OA 1REPC 2CU7A 2R7WA 1PVEA 1IV8A 3NWSA 2DDAA 3V8KA 2HEOA 3V7RA 1BM9A 3IRRA 1OLTA 2XGCA 3Q0UA 5B1BH 4CDGA 5DTDA 2DQLA 1RC9A 1Y6IA 1IW7F 2EP3A 2PMUA 3IV5A 3SFZA 2V85A 4B4CA 4O3MA 1IDZA 3CUQC 3QODA 1OISA 2W84A 3J7AG 2MFZA 3A01A 3RKQA 4KIGA 1P4XA 1BBGA 2R7OA 5CJ9A 2JVHA 4HF2A 1VQKI 1XGSA 2ZM6E 3CO7C 4XK4A 3S2WA 1X49A 1TF6A 4DYRA 4A0YA 4JI4E 3OYNA 2EB7A 4WPYA 1J26A 4LGWA 1MBHA 4HEA2 2EPCA 5D8LB 1FBSA 4A12A 4KWYA 2EMFA 1XTAA 3E1SA 4YFXF 5A2QK 2DK5A 3CCEI 4EMSA 1L4SA 4QPQA 3WHBA 1E2XA 1EJ9A 1MNDA 1VQ6I 5K7HA 5FLMJ 3ASNH 2CFOA 1MDMB 3BJAA 4UY8I 3QP6A 2ELYA 1FIPA 4J00A 1X4OA 2TDXA 2PI0A 1R6RA 4EJTA 2EOQA 2V83A 2DMPA 4HPQA 2CG4A 3PM1A 5HLGA 2QA4I 1G3YA 5LL6R 5HDNA 2KLOA 3BTJA 4ZDLA 2VQHA 1SEUA 1B6AA 3HEFA 2E5LE 1JKOC 3I5UA 5LMNE 2HVQA 1OFCX 1YJ9I 4CSWA 1ZBTA 3LSKA 3ZP5A 3F6GA 4I6ZA 3W2AA 4F9CB 2LC2A 4HBLA 4O5GA 5E17F 3RPUD 2VQFE 4B47A 4AD9A 4FETA 5ILSA 4HF1A 2E1NA 2L7FP 2NS7A 3BLYA 4ZC3A 1R5HA 2GOXB 5F0CA 3GTMJ 3KPHA 2R1FA 4UUSA 3CC7I 1PP8F 1ZLKA 1NK3P 2AXTC 4DJAA 3GWZA 3TW6A 2KZGA 3SHFA 3WU2C 3F8NA 5IP7J 1S7AA 1SMTA 3ESWB 2ENCA 2RS7A 2HWVA 1TWHJ 4LK1F 1RKTA 2RC4A 4OINF 1PDAA 1YYKA 1ZG3A 2X0LA 1UG2A 2E1MA 1WCMJ 1VQNI 1LKXA 5E1XA 3HHGA 2EBIA 4M0VA 1JK1A 2VC0A 5KL4A 1S7EA 4DR1E 1OCZH 4JI0E 5FJ8J 4ESFA 4Y15A 3IHUA 3OSFA 1FYMA 3WTVC 2Y0MA 3TQNA 3DLLF 3B6AA 4AYBN 2CPNA 2EM3A 2VJ4A 4R2DA 1UFMA 5LMUE 3MVPA 2G0EA 4HAMA 2DMYA 1Y0NA 2EPRA 1JJ6C 5F27A 1A1LA 4PDKA 4F55A 2KIUA 3AAFA 1TW2A 2EH3A 3E97A 2EK5A 1WXRA 2YRKA 2E60A 1KONA 5EF6A 3CLQA 2OZUA 2WAFA 2ENAA 3FMQA 3KYDB 5CVRA 2JOXA 1A04A 5FLVA 3BG9A 1ETWA 4C2UA 2ZXWH 3GLLA 2L33A 4XOTA 1FC3A 5L3BA 2NNNA 3MHSC 1F2IG 4WFTA 1IAWA 2VIXA 2EA2A 2H8WA 4Q47A 3OYHA 2VE8A 3OYCA 2Q0OA 1USSA 2DA3A 2GLIA 4RM2A 3FBIB 2JWTA 1E3HA 2JN6A 3H3UA 5CVUA 3K4NA 4LLNA 5D8KB 3C7JA 4HYEA 3OYMA 1HBXG 3WTUC 4DR5E 2CW7A 2IA0A 3BTLA 4R2QA 3TP3A 1IF1A 2EN6A 2A69F 5DS9A 3PFYA 4B44A 2YU5A 3QWLA 1HXDA 2EIJH 5EG0A 3R0AA 3O2PE 5BOXA 2ENHA 3LSTA 4UVAA 3ECHA 2VQGA 4DYQA 2B9SA 3LWFA 4UUSB 2L7KA 2OCEA 3Q0WA 1BB8A 2HTJA 3C1DA 2D45A 2LOOA 1IG7A 3KX2A 1HSTA 3HC7A 2HKXA 3QPHA 4PSWA 4C3HJ 1EH7A 4BAYA 5EEAA 4IO9F 3I4NJ 5A6JA 1LFPA 4N4OB 1G59A 1BI1A 3A02A 3GZ6A 3SJMA 4R2RA 2XC7A 1SAUA 4V19K 3JCUC 2GXBA 2W57A 5D5WB 3K1PA 4ZZDA 4TV7A 4G94A 4OAZA 2Q1ZB 1E3OC 2HR3A 5AIQA 2EMYA 2EN4A 1MGTA 3VB2A 5AE1A 4ZTJA 2E1MB 1J7KA 2E1OA 4BBSJ 2ZJ2A 2DMIA 3DPUA 2DRPA 5A2QC 2CQQA 2K3PA 3SZGA 2XASA 1OCRH 2DA7A 1RI7A 2XF5A 3FMRA 1ETQA 2EZHA 1DP3A 1GVDA 5DUKA 5K7FA 3V7CA 5EYRA 4EGYA 3BIDA 4DUZE 4XKVA 1ZAOA 2EV0A 2M0MA 1IC8A 2V7FA 2K9LA 4DR3E 4KYWA 2CV0A 1Z7LA 3MEXA 3OYJA 1D0ZA 4RGXA 4KN7X 2LF7A 1HKTA 1X3CA 2EMGA 3R6SA 4A3EJ 1T98A 2EA4A 3L2RA 2MKNA 2HPMA 4P55A 2RS6A 2JSCA 3FIGA 2MA3A 2HU9A 2R7VA 4ZJZA 1UHSA 4C9YA 2R4GA 2K27A 4ZDOA 1LDDA 2YX4A 2I10A 4JBAA 2ZCWA 2V6EA 4LF4E 3C6MA 3NAUA 4IZZA 3H0DA 4II3A 1BJZA 4HOBA 1R36A 3U21A 1BIAA 1KA8A 5GAGJ 4UNOA 1TL8A 1XDUA 3AG3H 1HNXE 3GZ5A 4M74A 1K4SA 1DP7P 1BI2A 2VOOA 4IHXA 2NUEA 3DPLC 5M5WJ 1QA6A 4IX7A 2Q8UA 4MLVA 4AM3A 1DI2A 3HSEA 4B3AA 4S0HB 3GW2A 2Y2ZA 2DU9A 4X66E 1U0JA 2K4JA 2OQGA 2M4IA 2HDWA 1YW9A 5EG0B 3KP2A 2GM4A 3T1YE 4Q35B 4M3DA 5AC4A 1VQLI 3CJTB 4A3CJ 3GX4X 2V26A 1ERDA 2HGHA 5D5XB 2XSDC 2IRFG 1XGNA 1VZ0A 1N78A 2V1NA 1WPKA 3FZVA 5J3LA 5ILVA 1HDDC 4M6YA 1IBME 2WA0A 3CLOA 2LMZA 3EYYA 2MABA 1YRNB 2E35A 2A6EF 2TCTA 4KA4A 4B3SE 4N4NB 5KL2A 1LUJB 3KP4A 5FROA 2H1KA 4B1RA 1GLNA 2BY2A 2D1HA 1PJRA 2W00A 4L5JA 4A3BJ 4CYCB 3D5RC 1C0WA 5J6XA 2R7TA 4D7NA 2VT2A 2IGMA 5BNGA 1SD5A 5D4RA 1YPNA 1ETOA 2L4AA 1OCTC 2EZ6A 2HVRA 2LBSB 3L09A 4X0GA 2LDUA 2OQRA 2Z3YA 2MDRA 1X58A 2PLYA 3ELKA 1QVUA 3BBGA 3QOPA 2CGPA 1B69A 5JHUA 1P7JA 1SFOJ 4BKXA 5HODA 3VYUB 3G4SI 3BZKA 3P9KA 3LQQA 3ZQLA 1D1AA 5HS7A 3VFZA 2VN2A 3JR9A 3F8CA 2MW8A 2FOKA 2M8GX 2RV8A 3WU1B 3AUZA 3A4CA 5C3EJ 2IPQX 1POGA 1X1CA 5ICGA 3S3OA 2DODA 4JK1X 4BE2A 3CQZJ 2IGNA 1YS6A 1FKAE 3BY6A 3BDDA 3JRBA 1X4PA 1P9QC 4R2AA 1EA3A 4P5OA 5FKOA 1KGSA 3SDGA 2L0KA 3C3WA 4A0XA 3ZCOA 3IP4B 3CO6C 1UCRA 3TKYA 3JTGA 4C3IJ 2EMKA 3F8BA 1RNLA 2OTJI 2EN2A 1X2NA 3MKLA 4I0BA 4ZDPA 3DWLE 2FXAA 4BU2A 2E2IJ 1JK2A 2F2EA 5KAFC 5EJCA 4BNCA 1YG2A 4R8HA 3A1YA 1JXSA 1WHQA 2EOJA 3EUAA 2HJJA 4KZSA 2VBWA 2FJ1A 4JYKA 3K10A 3O8GA 4KT6A 1K83J 1J59A 1B8IB 1JGGA 3OS1A 5HVQC 1G3TA 2X51A 5TRDA 2DT5A 3GMEA 2EFNA 3GBGA 1QQIA 2BOLA 4R2CA 2EOXA 4EVIA 3IRQA 2GXAA 4LFBE 2XPUA 4CCNA 3W2WA 1ZR9A 1MH4A 3L7WA 1R4MB 4RAZA 3ZQCA 1SFEA 4IRIA 1SVOA 1V54H 3KP5A 1TLHB 2RSMA 4HDUA 2Y31A 2W24A 4A3DJ 2JUCA 3C6KA 1E17A 2MC6A 3VSKA 2ECBA 3DEWA 5KL7A 4ETSA 3KYLA 1V55H 1IUYA 2WWYA 4Q5SF 3G1MA 5F6FA 1WWXA 4Y3OA 3SQNA 3J80K 2YTNA 4I98B 3BR2A 5BR8E 2BXYA 2N3HA 3O3KA 1WJFA 2DXIA 1H9GA 5H6RA 1MSEC 3J7ZI 1XX5A 4LLGF 1I94E 4N9HA 1DUXC 4CUGA 3S2HJ 2ID6A 1DGRM 2JXPA 2E71A 2GIVA 1HCRA 1GUUA 4D7MA 5FFZA 3KP6A 2QEXI 5JLWA 4L5IA 2R3SA 1HW2A 2H6CA 4PJ0C 4YIRX 1G2DC 2WY7Q 1FOYA 2VQLA 2IA1A 3CF2A 2D5VA 3AKZA 3WTWC 2PJPA 3HSFA 1AAYA 1P2FA 3N4MA 2B63J 4ESJA 2EMZA 3K4MA 1P6RA 2FQ4A 1IN5A 1ZRFA 3LAJA 4UB6C 2IGOA 3IC7A 4OAYA 4LG0A 3IH3A 5KK1A 5E3NA 5GADJ 3OSGA 3RZDJ 2FGGA 4XN0A 2LT7A 2UXDE 2JA6J 2DOEA 3M1EA 2VQEE 3BZCA 1R9TJ 3KETA 4I99C 3CCRI 1JJ8C 2BBYA 4F52A 2M7BA 4HV5A 3WGHA 4A6EA 4KMFA 3J7AY 4EJVA 4F93B 5LGUA 2KOUA 2MH9A 3M7GA 3N05A 2R7QA 4MLOA 3P7NA 2DLKA 2MSYA 2PX9A 2DOAA 1DPUA 5B66C 1L0OC 2XF6A 3G3ZA 5F0FA 1SAXA 2G9WA 2BV6A 4G9YA 3BT9A 5DDGA 5J47A 3PIPF 5HS8A 2L3CA 4M3BA 1XN7A 5LRRA 5TJJA 4FASD 1BBYA 2PMZA 3DKWA 4DR2E 2ISZA 3H0GJ 2RSIA 2LUQA 2NVUB 1RESA 2IS4A 4LFUA 3HTUA 3CF5F 2HHHE 1OR7A 5LGNA 1F1ZA 4OWRB 2EMIA 1USTA 3ABUA 4DV6E 3C18A 5IT9Z 3QOEA 1HW5A 1FPQA 3QAHA 4CO8A 3CUQB 3K2ZA 3K4BA 4ZYEA 2NXNB 3CP2A 4FCYA 5KL6A 2JYAA 1Z1BA 3H9QA 4RLFA 2CSOA 1K61A 1ETYA 5K5RA 1JI8A 2WV1A 2LTSA 3L9FA 4DBQA 5JLXA 2VQCA 3I3LA 4NB5A 1JUMA 3HOVJ 2CRGA 2XGXA 4E7LA 3H92A 1RMDA 3LFKA 2RN7A 1WJCA 2VT3A 4QPOA 2EQRA 1U3EM 5K7ZA 4NHJA 5ERIA 4C3JJ 2YU3A 2VJJA 5JFRA 4IHWA 1W7PD 1D0XA 1E3PA 3LL7A 3VYYA 2EFPA 3A2KA 4I0AA 5KL5A 1BOBA 3GTKJ 1SFXA 1HDPA 2B7EA 3LSPA 2O0YA 4RGRA 2DA5A 2ZMEC 5LEKA 1FJLA 2MKDA 3K6QA 4J19A 2FBKA 4BDZA 2EE8A 1VQPI 1YYVA 3KEQA 4LG0B 1TT0A 1AU7A 4I8OA 3FK6A 2W82A 3I55I 3GTJJ 2DA4A 2FRHA 2UXXA 3E3VA 3ZQGA 3HPGA 1STZA 2I5UA 3GCMA 3C4BA 1XMAA 1T2KA 1LFUP 1JTYA 1BW6A 3QQAA 5CFFE 1G2HA 4YY3E 2L9NA 2VASA 2CQ7A 2DTZA 2YX7A 3OYFA 2P7CB 1VQ8I 4MNUA 3GTQJ 3ZMUA 2IS2A 2J5PA 2OZ6A 2P7VB 2JVAA 2CW0F 2RQQA 4E6KG 1B9NA 2DN0A 3M99B 4RB1A 2BYVE 4O4KA 3BP8A 5E8IA 2XRNA 2NABA 2AXLA 1DQUA 1X1DA 3HKZN 2DMTA 3WTXC 2K40A 2ZJQF 2YTQA 2UV1A 3RSNA 2WZOA 2UZKA 2XROA 1YFHA 3Q3SA 1I5ZA 3DPTA 3FMSA 2JRMA 3J80C 2UU9E 4TUGA 3PQKA 2EZKA 5LLQA 2F4VE 2V79A 3FXRA 5F04A 1IN4A 3VK6A 3H5NA 2VF1A 3BPXA 2XAUA 4XRFA 5J1YA 1WJAA 3P9CA 3K9TA 2RREA 3RQ4A 5FLXZ 2DDBA 1IMUA 1Y0UA 3DTEA 1T95A 2CTDA 2H94A 3PNYA 2LCEA 4JOMA 1XMXA 4E70A 4Y52J 3WE3A 2DT7B 2A61A 4KT5C 2ECCA 3BG7A 4PGHA 5J8FA 1Z6TA 4V2GA 1KQ8A 3J81Z 1DGCA 1K6OA 1V5FA 2NVXJ 1ZU1A 2FSWA 3M1CA 4KFCA 1EH6A 1R7JA 3E5XA 4DBRA 4JI3E 1U9OA 1X2MA 3N97A 1MBFA 3OIPA 3TEDA 2JA2A 2JA8J 4KIFA 1MIJA 4BH9A 2LKSA 4IPAA 1QHGA 4NZVA 2MC3A 1OKRA 2ELJA 4UHTA 3OYDA 5C4XJ 2EL6A 1A1FA 4Y7NJ 1A31A 2XB5A 2KHXA 2WV0A 2B0LA 3K6GA 2VJ5A 2OV7A 3BZ6A 3EYIA 2V1XA 3LQRA 1EF4A 5H20A 4YEJA 2ELHA 4HA8A 1M1EB 3OYBA 4AIJA 4DR4E 3LAPA 2EJ4A 3F6HA 3MD2A 3HRTA 1HLVA 3ZRGA 3F23A 3S16J 1WJBA 2P0WA 1YW8A 1T08B 2FD5A 4PFOA 3U2RA 1IJWC 1G3SA 5EZGA 3ERED 2YZTA 5FKKA 2PN6A 4WYQB 3WHCA 2QSGX 2B7TA 4M9XA 1ODDA 3K4LA 3W3CA 2KT0A 3DF6A 3J7AO 4AVPA 1MNMC 3OOPA 2JA5J 2CV1A 2WADA 1G3WA 2KPMA 2HTSA 3LSMA 3ML6A 3U1KA 4M6XA 5IYCJ 2H09A 1PJQA 4S04A 4LITA 3VDXA 3H9GA 2R7XA 4ENNA 1FP2A 3TP0A 1ETVA 3DFGA 4HTGA 5B5EC 2O5RA 4MLQA 2VXZA 3P9IA 4MIMA 4XKWA 2XKOA 2EJRA 4A0ZA 4CZZA 1SC7A 1BC8C 2KJBA 2ZXIA 1BL0A 3IWBA 3SYTA 1R1VA 1HF0A 1PP7U 3TW7A 1IN7A 2DMNA 4L8NA 1YX5A 4XBFA
chains in the Genus database with same CATH topology
1QZZA 1OYIA 3JAMZ 3ABTA 1D3YA 5F1RA 2IT0A 1XDSA 5BS6A 5DUIA 3ZPLA 3COAC 1TNSA 1RIOH 1I27A 2AS5F 3TO6A 2XKPA 5L3EA 3KZYA 2GXGA 3VOEA 2RQPA 3T8RA 4CYDA 2XVCA 1MJBA 1ONVA 1WKMA 1U5TC 2H27A 4HV6A 5LHGA 4IF4A 3M8FA 3ROUA 4M9SA 4DNCA 2PEXA 3EETA 1BJAA 5DCMA 3QRFF 4G8XA 3NQOA 4ZH4F 2HS5A 2DAOA 2FU4A 3JSOA 2F5EA 4U0VA 1HKQA 1JHHA 2L3DA 4U7BA 1XMKA 3D5LA 2HYFA 4R1HA 2CWEA 2YR2A 1U6GA 4OIOF 1GHCA 1XSVA 3RTRA 3EQLF 3IWFA 1SD6A 3MZYA 2JPCA 5JR3A 2F5FA 3BPVA 5DD8A 2GA1A 1ZREA 2JPBA 2PQ8A 1QGPA 3WTSC 4IHSA 2DO7A 1TQIA 1AOYA 1LJ9A 1Z6RA 1F5TA 1S6LA 3I0TA 3I58A 3SZPA 1LB2A 1ZRDA 1DPRA 2VE9A 5JVTA 1JHFA 2V9VA 4XSZF 1QZYA 3TDZC 3T1BA 2G7HA 2P5VA 5DCMB 3RIRA 2XAJA 1FT9A 3K0LA 2LNBA 3KE2A 4F7ZA 4EJWA 3BWGA 4UUVA 1FOKA 1BOAA 2KIFA 3D0SA 3RKYA 1QNTA 1CF7A 4Y13A 4CGZA 1H0MA 5FGMA 4RGUA 2FBIA 2RDPA 2M45A 2ZFWA 1Q1HA 3WG9A 2P4WA 4PGGA 2O6GE 4OMYA 1Z9CA 2ZMEA 4G7HF 1FZPB 1FX7A 2VC1A 1U2WA 3RYPA 1UHWA 3E6DA 2XAHA 3RPQA 1J0RA 2GWRA 1MJAA 3ECOA 3EUHA 3V8LA 4UXNA 5DEQA 1BI3A 2FF4A 3E5UA 1ZN2A 2Z99A 4YIIA 2HYGD 2XV4S 5FFXA 4CICA 1LDKB 4BHPA 1CGPA 3IKVA 4N9IA 2EFQA 1O7LA 2VBYA 4IRGA 2CYYA 2WC2A 3ZMVA 1DDNA 4LJZF 4EM1A 2GA2A 2QQBA 1Z1DA 1KU9A 2JTVA 2MLKA 4AWXB 3RDIA 4B09A 3T5XA 1L3LA 1CF7B 1V4RA 2ETHA 1SFUA 2PFBA 2ACJA 5D6FA 3ZMSA 4RB2C 2DPUA 2LSOA 4OU0A 1EV7A 2A07F 3HRMA 3GEZA 1YIOA 2JRTA 2ZMEB 4JQFA 4WCGA 1QBJA 4OIQF 4GCVA 5ICFA 2L4MA 2K86A 2MD5A 4A2UA 2CO5A 4XLPF 4MEXF 3IL2A 1OYWA 2EWNA 3O6BB 1R1UA 6PAXA 4HLXA 3B73A 3FXUA 1F9NA 1FWZA 2A6HF 1WSUA 3FWEA 3JW4A 3FF5A 1RZ4A 1MZBA 3DEUA 5LBQA 1D8JA 4WF2A 1QPMA 2P6TA 3WE2A 3CUQA 4WWCA 4LB5A 4ENMA 4YFKF 2QVOA 3WU0A 3HRUA 2HQRA 3ULQB 4M72A 1FSEA 2RGVA 3I59B 4L0ZB 5E18F 2HOEA 4HF0A 3U1DA 2IW5A 5BPDA 3GXOA 4GXOA 1BI0A 5ED4A 3DP7A 3ZN0A 3ZQ7A 2K02A 2EV5A 2ZO4A 4EV0A 3SXYA 1ZLJA 3NRVA 4GYIA 4DQ2A 3FM5A 4EM2A 4ZYGA 3HIFA 3HRSA 3E6CC 2FE3A 1H9TA 1XSDA 2R7FA 2IVMA 3PFIA 2NAZA 4LMYA 5L3DA 1LEBA 1ZRCA 2BGCA 4HQMA 2DQRA 5LHHA 1O3QA 3V8JA 3JSPA 4RS8A 1U78A 3LA7A 2ISYA 5D5UB 2LKPA 2QBYA 2COMA 2D1VA 1ZG1A 3L2CA 3GO5A 2Q8KA 2QLZA 4OMZA 4QLCU 2QWWA 1UB9A 4B8XA 3M9AA 2ADUA 2Y75A 4G6DA 3FXQA 5LRSA 4G7OF 4BXUA 3CTAA 3MWMA 4GO1A 3EDPA 4MGRA 5BPIA 4Y17A 1T0FA 2O8XA 1K7AA 4ON0A 1I6XA 4L18B 5CLSA 5E8GA 3V4GA 5ICEA 2P6SA 1YW7A 5BQTA 1Z91A 3QP5A 2DK8A 3R60A 3FM3A 3BJOA 4UVBA 1XSXA 2JZYA 2G7UA 3F72A 4R79A 1XGOA 1WQ2A 3K69A 4L0YB 2F5DA 4U0WA 2P5KA 1Z7UA 2FMYA 3F3XA 2EV6A 3TOBA 3I64A 1U5TB 3DXJF 3U9GA 1P4AA 1W5SA 5LGTA 1KQ9A 2M30A 3FHZA 1B59A 2QBYB 2L54A 3F22A 1J2XA 1B1BA 1GXPA 1FBQA 1SD7A 3GLXA 3VODA 1F4KA 3CDHA 3I4PA 4ZZLA 5L3FA 4RAYA 2EFOA 1T39A 2ZNZA 3HYIA 4HW0A 3L00A 1B9MA 5A2QZ 2QYOA 4HQEA 2Y48A 5IT9K 1ZGAA 2XAQA 3KEOA 4IVNA 4LD5A 1YLFA 2O3FA 2UWMA 3GFLA 2GAUA 1ZGJA 3WTYC 2NS0A 4KUMA 1FYLA 2PG4A 4XSXF 2KRFA 5FO5A 4FX4A 3FX3A 2QM3A 5HDGA 2E1CA 3F6OA 1R58A 1KU3A 5FB2A 4I02A 2PBIA 3TOAA 4BHCA 4AIKA 5K5OA 4UVCA 4K2EA 3WTZA 4GGGA 4M73A 3ZMZA 1BN5A 3WODF 3VEPA 2DPDA 5HLHA 1BC7C 1TBXA 5E1WA 3Q5FA 3MZHA 4HLYA 4KDPA 1HKSA 2XAGA 3F8MA 3BOQA 1G4DA 2HFHA 1PUEE 3T0YA 1J75A 4KMUX 2L02A 4N0BA 2BE5F 3MAJA 1R23A 3MCZA 4G6QA 5K1YA 3E6BA 4KNYA 5FLXK 1FLIA 2KJCA 5D5VB 1IZ1A 1GXQA 3BROA 3J81K 1JE8A 3RI4A 4G7ZF 3RYRA 1ZG5A 4U0YA 1ZARA 1SMYF 2ESHA 2DFIA 2RNJA 4YIFA 3GVAA 4MQVA 5D4SA 4I7HA 1XCVA 2V1UA 1OPCA 1FYKA 3KP7A 1SD4A 2XAFA 2QENA 1HSJA 2NYXA 2MLGA 4Z2YA 1S7OA 2FQ3A 5LEJA 2IP2A 5AIPA 2KKOA 2WTEA 2OU2A 2VOPA 2XHKA 2GZWA 3ZMTA 4RB3C 4KICA 1XB4A 3GF2A 1PDNC 2GQQA 1ZH5A 2KIMA 3IKTA 2STWA 2Q2EA 3F8FA 4L9NA 1IXRC 2FMLA 4A6DA 1R5GA 2P8TA 3HUGA 3GFMA 4U88A 3JAMK 3KFWX 1W5TA 1FNNA 2HGCA 3KLOA 2H6BA 3KCCA 1KQ0A 4QWQA 3QU3A 3REOA 1D8KA 2DBBA 1G6NA 5L3CA 2Z33A 3KZZA 5CVIA 4YFNF 5ICCA 4A5MA 5IT3A 2V1DA 1YS7A 3F21A 2FA5A 5E20A 2DW4A 1TNTA 3CUOA 1OMIA 2ZXJA 4LLLA 3DF8A 5FD6A 2M1BA 4KIBA 3NEUA 1LEAA 1BIBA 4PZJA 4RB0A 2FEZA 2LF8A 4ENKA 3GFIA 2Z9OA 3R61A 1R1TA 1O3SA 1MJ9A 2XIGA 4HDVA 5DYMA 1B4AA 3K1NA 3F6VA 3QPTA 1AWCA 2W25A 4MEYF 1TW3A 2QQ9A 3M8EA 1LQ1A 3RKWA 2O03A 5CVVA 1I1SA 1T6SA 1TQPA 2OAZA 2YPRA 4O5VA 2ZBKA 3HSRA 1MKMA 2QUFA 1OYYA 2M87A 3TO7A 3I53A 4CHUA 3GFJA 1K79A 5HS9A 3TDUC 1GVJA 3J80Z 1LDJA 4WXDA 3KP3A 1IN8A 3I59A 2O61A 1YQAA 1S29A 1Z05A 2X4HA 1O3TA 4EQQA 1TTYA 2HZTA 4MQ9F 1LNWA 2A68F 5H6QA 4GYGA 1NHAA 4ASNA 2D2WA 2W85A 1J5YA 3OV8A 2M8EA 3Q9VA 5AONA 3ZN1A 4HX4A 3TO9A 2VODA 5ILUA 5CVJA 4UV8A 1LVAA 1WI9A 1TQMA 5JI6A 4PCQA 2FNPA 2FBHA 1R00A 2IJLA 2MBFA 1XGMA 2ZNYA 1IRGA 3E5QA 2JT1A 3WGGA 4CXFA 3B02A 5DD4A 5DCFA 1W7PA 1HQCA 4OIPF 4IXAA 1V3FA 4D0PA 1EH8A 1S8NA 3RKXA 1FP1D 3RJPA 4EJUA 4ZYHA 2QQAA 5LHIA 2VBXA 4KN4X 1KU7A 2XUBA 4BYYA 1D5VA 2HQNA 3W6JB 3PQJA 4FT8A 5KVRA 2OA4A 4H0EA 4L9TA 1IXCA 5F64A 3T8TA 2FNAA 2V6CA 1S3JA 3R4KA 1UHMA 5BMZA 1P4WA 4M9ZA 4Q48A 4A5NA 2ZKZA 4L9JA 3I54A 2A5YB 5CYVA 2STTA 2Z5UA 3CJNA 1O57A 3G73A 3H3ZA 3GUDA 4IHTA 1U5TA 1YO5C 1R22A 1FBUA 2R7DA 4OIRF 1IN6A 4O6JA 4EJOA 2CQKA 3TGNA 3W6KB 4P9UA 4L9VA 2PMHA 4RGSA 2VBZA 3V7SA 2OD5A 4EM0B 4P96A 3WTTC 1W7PB 1YTYA 2K7LA 2ESNA 4HX8A 1ULYA 4S05A 3MQ0A 4LK0F 2YSRA 5HOOA 2IA2A 2VONA 2EFWA 2NNYA 4AIHA 2MH2A 5EEHA 1FY7A 4I09A 4ENJA 3HHHA 1XCBA 4OOIA 2HKOA 4BHBA 2J5OA 5K5QA 4WX9A 3R0JA 2L01A 3DV8A 1QO0D 3E6MA 2OBPA 1JGSA 3KLNA 4MTEA 1I1GA 5HDKA 2NRAC 3LA2A 4FX0A 2F5CA 4I01A 4BQAA 1O7FA 1O3RA 4EGZA 1VTNC 1W4MA 4WXHA 3LA3A 2E7XA 1KYWA 2E7WA 1K78A 5HLIA 3HOTA 4YG2F 1RUOA 4P9FA 3K1MA 4NQWA 3QU6A 1ON2A 2RVCA 3HTSB 4IJAA 4ZYDA 2C6YA 4UV9A 2CFXA 3MFKA 4WK8F 3ISPA 1ZHFA 1WRJA 1KU2A 2K4BA 4MHGA 1MD0A 3I71A 1X3UA 5FD5A 1KYZA 3RPUA 1ZYRF 5EEGA 2DI3A 3SZTA 4LB6B 4ESBA 5DV5A 3GYHX 3Q9SA 4MTDA 1T38A 1U8RA 3JTHA 2P5LC 2M5WA 3ZMDA 1IXSB 5L3GA 3DQVC 4HZFA 1J9IA 2DTRA 3HOSA 2QZ8A 2UXNA 4XLNF 1MDMA 1HW1A 4U7DA 2RKHA 1K78B 4IRHA 4M71A 1XD7A 3IWZA 4FHTA 2BEOA 2HDCA 2A3SA 2DLLA 5D6EA 4HX7A 4WXCA 4Q4ZF 1ON1A 3WGIA 1P92A 5J8CA 1FSHA 1IRFA 3BJ6A 5E1ZB 1RUNA 4I2OA 1REPC 2HEOA 3V8KA 3V7RA 1BM9A 3IRRA 4CDGA 2DQLA 1IW7F 2PMUA 3SFZA 4O3MA 3CUQC 2W84A 4KIGA 1P4XA 5CJ9A 4HF2A 1XGSA 3CO7C 3S2WA 4A0YA 2EB7A 4LGWA 5D8LB 1FBSA 4A12A 4YFXF 5A2QK 2DK5A 4EMSA 1E2XA 1MDMB 3BJAA 3QP6A 2TDXA 2PI0A 4EJTA 2CG4A 5HLGA 1G3YA 5HDNA 1B6AA 3I5UA 3ZP5A 4HBLA 5E17F 4AD9A 5ILSA 4HF1A 2E1NA 1R5HA 1PP8F 1ZLKA 3GWZA 3SHFA 3F8NA 1S7AA 1SMTA 2HWVA 4LK1F 2RC4A 4OINF 1ZG3A 2X0LA 5E1XA 3HHGA 2VC0A 4ESFA 4Y15A 3IHUA 1FYMA 3WTVC 2Y0MA 3TQNA 1UFMA 4HAMA 4PDKA 3AAFA 2KIUA 1TW2A 3E97A 2EK5A 2OZUA 3FMQA 5CVRA 1A04A 5L3BA 1FC3A 2NNNA 1IAWA 2EA2A 4Q47A 2VE8A 2Q0OA 1USSA 3H3UA 5CVUA 4LLNA 5D8KB 3C7JA 4HYEA 1HBXG 3WTUC 2IA0A 1IF1A 2A69F 1HXDA 3R0AA 3O2PE 5BOXA 3LSTA 4UVAA 3ECHA 3LWFA 2HTJA 3C1DA 2D45A 3QPHA 1HSTA 2HKXA 1EH7A 4BAYA 1BI1A 3GZ6A 2GXBA 2W57A 5D5WB 3K1PA 4ZZDA 4TV7A 4G94A 2HR3A 5AIQA 1MGTA 3VB2A 1J7KA 2ZJ2A 2XASA 3FMRA 1RI7A 5DUKA 3V7CA 4EGYA 1ZAOA 2EV0A 4KYWA 3MEXA 4RGXA 4KN7X 2LF7A 1HKTA 3R6SA 1T98A 2EA4A 4P55A 2JSCA 2MA3A 2K27A 1LDDA 2YX4A 4JBAA 2ZCWA 4HOBA 1R36A 1BIAA 1KA8A 4UNOA 1XDUA 3GZ5A 4M74A 1DP7P 1BI2A 2VOOA 3DPLC 3HSEA 3GW2A 2DU9A 2K4JA 2OQGA 1YW9A 3KP2A 3GX4X 5D5XB 2IRFG 1XGNA 3FZVA 5ILVA 4M6YA 3CLOA 3EYYA 2A6EF 4KA4A 3KP4A 2D1HA 4L5JA 1C0WA 5J6XA 2VT2A 1SD5A 5D4RA 2L4AA 3L09A 2LDUA 2OQRA 2Z3YA 2PLYA 3ELKA 3QOPA 2CGPA 5JHUA 3P9KA 3LQQA 5HS7A 3VFZA 2VN2A 3F8CA 2FOKA 2RV8A 3WU1B 2IPQX 5ICGA 4JK1X 1YS6A 3BY6A 3BDDA 4P5OA 1KGSA 3C3WA 4A0XA 3CO6C 1UCRA 3TKYA 3JTGA 3F8BA 1RNLA 4I0BA 2FXAA 2F2EA 4BNCA 1YG2A 4R8HA 1JXSA 2VBWA 1J59A 5HVQC 1G3TA 5TRDA 2DT5A 2EFNA 1QQIA 4EVIA 3IRQA 3L7WA 4RAZA 1SFEA 4IRIA 3KP5A 1TLHB 4HDUA 2W24A 1E17A 4ETSA 1IUYA 2WWYA 4Q5SF 5F6FA 1WWXA 3SQNA 3J80K 4I98B 3O3KA 1H9GA 5H6RA 4LLGF 4N9HA 1DUXC 2GIVA 5FFZA 3KP6A 4L5IA 2R3SA 1HW2A 2H6CA 2IA1A 3WTWC 2PJPA 3HSFA 1P2FA 3N4MA 4ESJA 1P6RA 1IN5A 1ZRFA 3LAJA 4LG0A 3IC7A 5KK1A 3M1EA 3KETA 2BBYA 4A6EA 4HV5A 3WGHA 4KMFA 4EJVA 5LGUA 2MH9A 3M7GA 3P7NA 1DPUA 1L0OC 3G3ZA 1SAXA 2G9WA 2BV6A 4G9YA 5DDGA 5HS8A 1XN7A 5LRRA 5TJJA 1BBYA 3DKWA 2ISZA 4LFUA 3HTUA 1OR7A 5LGNA 1F1ZA 1USTA 3ABUA 3C18A 5IT9Z 1HW5A 1FPQA 3QAHA 4CO8A 3CUQB 3K2ZA 4ZYEA 2CSOA 5K5RA 3L9FA 4NB5A 2XGXA 3H92A 3LFKA 2RN7A 2VT3A 1U3EM 4NHJA 5ERIA 2YU3A 5JFRA 1W7PD 2EFPA 4I0AA 1SFXA 2O0YA 4RGRA 5LEKA 2FBKA 1YYVA 3KEQA 4LG0B 2FRHA 2UXXA 3E3VA 1STZA 1XMAA 1T2KA 2YX7A 2P7CB 4MNUA 3ZMUA 2J5PA 2OZ6A 2P7VB 2CW0F 1B9NA 4RB1A 2BYVE 3BP8A 5E8IA 2XRNA 2AXLA 3WTXC 2UZKA 2XROA 1YFHA 1I5ZA 3DPTA 3FMSA 3PQKA 5LLQA 2V79A 3FXRA 1IN4A 3BPXA 4XRFA 3P9CA 3K9TA 5FLXZ 1Y0UA 2H94A 4E70A 3WE3A 4KT5C 2A61A 4PGHA 5J8FA 1Z6TA 1KQ8A 3J81Z 1K6OA 2FSWA 4KFCA 1EH6A 1R7JA 3E5XA 3N97A 4KIFA 4BH9A 4IPAA 2MC3A 1OKRA