2EMBA

Solution structure of the c2h2 type zinc finger (region 342-372) of human zinc finger protein 473
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
GSSGSSGHTRKRYECSKCQATFNLRKHLIQHQKTHAAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 342-372) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2embA01
2MDGA 2EMGA 1X6FA 4R2AA 2EOSA 2GHFA 2WBTA 1AAYA 2EORA 2EOJA 2EOFA 2EPZA 2EMAA 2EMFA 5KL5A 1WJPA 2YRHA 2LT7A 2EN2A 2JP9A 2EMIA 3MHSC 2EMBA 2EOXA 3UK3C 1A1HA 1G2FC 2EM6A 2EN3A 2EL4A 1JK1A 5KL2A 2ELZA 1BB8A 2I13A 2CTDA 2EL6A 1ZU1A 2EOEA 4R2DA 1G2DC 2DGCA 2EM0A 4R2EA 2EPXA 4F6MA 2GLIA 2R1FA 4R2SA 1A1FA 1RMDA 1X6HA 1A1IA 2E72A 4M9VC 1ZAAC 2WBSA 1YUIA 2EQ0A 2YSPA 4GZNC 2RPCA 2EM9A 2YTPA 2EMWA 2EM4A 1Z1BA 2EPUA 2EMZA 2BB8A 1NCSA 2A25A 2EMCA 2YTOA 2YTJA 4R2RA 1F2IG 2EPAA 2EN1A 4FK5C 2ADRA 2YTQA 4R2CA 2EE8A 1X5WA 2EP3A 1BBOA 1TN9A 4X9JA 2YU8A 2EOHA 3EPLA 1YSAC 4F2JC 1JK2A 2YSOA 2EM7A 2EOIA 1TF3A 2NABA 1P47A 2PRTA 2EMKA 2ELYA 1UN6B 2EM8A 2EM5A 2YTDA 5KL3A 1LLMC 1UBDC 2LVHA 2EOOA 2YTIA 2EOZA 3MHHC 2YTGA 2EPPA 2EN4A 2EM3A 2LCEA 2EPCA 2WCC3 2EN7A 4R2PA 2RSIA 2VRDA 1A1JA 4IS1C 5KL7A 2CSHA 2YU5A 3EPJA 2DRPA 1KJKA 2D9HA 2JPAA 2M9AA 1YUJA 1TF6A 2ENHA 2LO3A 2LV2A 2EMLA 3M99B 4WSGA 1X6EA 2J7JA 2EJ4A 3VHTB 2EL5A 2EMYA 2CT1A 1A1KA 3EPHA 1B69A 2DLQA 2EN8A 2WBUA 2EMXA 2YTFA 2EOQA 2MKNA 4IJDA 1X3CA 3EPKA 5KL6A 1DGCA 2ENAA 2ENCA 2YRMA 4F6NA 2YRKA 5KL4A 4R2QA 1ZR9A 1A1GA 2HGHA 2DMIA 2MKDA 2YTEA 2EOYA 2EM2A 2EMHA 1MEYC 2EOMA 2EPRA 2DLKA 2EQ3A 2YTNA 2EQ1A 1A1LA 2EN6A
chains in the Genus database with same CATH superfamily
2RSMA 1X6FA 4O5GA 2GHFA 1N34E 2EOJA 3DJWA 1BBGA 2EMFA 2FV4B 3LLHA 5KL5A 5LMUE 1UHZA 2B7VA 2LE2A 2YRHA 1QNTA 2K7IA 1G2FC 2EM6A 2EN3A 2EL4A 2N3GA 1JK1A 2LTRA 2IHR1 1MGTA 3LMLA 3J80C 1BB8A 4LU9A 3RMPA 4ZYGA 2JY9A 2EPXA 3ECRA 1N36E 4HTGA 4LF9E 2R1FA 2JXPA 1A1FA 1RMDA 1X6HA 1A1IA 2NUFA 1IMUA 1YPNA 5IWAE 4RH8A 2M7QA 1XMQE 2RS7A 1YYOA 5AC5A 4WPYA 4Q28A 4ZYHA 1Z1BA 2RQLA 1J26A 2EMCA 2YTJA 1F2IG 4JI6E 4LF4E 2EE8A 4NXME 4B3RE 2EWLA 3EPLA 1T38A 1YFHA 1WHNA 2UUBE 4ZYDA 3HPZA 2EM8A 3THNA 2YTDA 4ZYEA 1LLMC 1PKPA 2LVHA 4F9BB 2EOOA 3K6QA 3MHHC 2RS6A 2NUEA 2B9DA 2EM3A 2DMYA 2LCEA 2WCC3 4WSPA 4NHRA 1T4LB 2E5LE 3IWCA 4WXDA 1O0WA 4M0VA 2ZM6E 2D9HA 2L33A 2M9AA 1YUJA 5A6KA 4BCAA 2LUPB 3F6GA 4DV2E 3VHTB 5IT9C 3BF2A 2CT1A 3J81C 1XNQE 2YTFA 2ODRC 2NUGA 2G7HA 4IJDA 2HHHE 3EPKA 4LF5E 2ENCA 5KL4A 1A1GA 3EQ1A 3ADGA 2DMIA 2K4VA 2UXDE 3IWDA 5A6BA 2E1MA 4KZSA 4DV3E 1MEYC 2EOMA 4F9CB 2DB2A 2NA2A 5A2QC 2VQFE 4BS9A 5A6JA 5TSEA 3ZOQB 2EPZA 4WX9A 3FIGA 3P1XA 3MSWA 2JP9A 3MHSC 4J8ZA 3OMLA 1RC7A 1HNWE 4M2ZA 4WXCA 5KL2A 2ELZA 2I13A 2EOEA 2EPOA 5LMNE 3AUZA 1YYWA 2LBSB 3TQMA 1SR9A 4DV4E 2B3TB 4OX9E 5A69A 2RTXA 1PDAA 1WHQA 1ZAAC 2YPNA 2F8BA 2DSYA 2EQ0A 2MC6A 2EM9A 4NXNE 2EM4A 2EPUA 2BB8A 5AASA 5AE1A 4BC9A 4JI8E 1ZBTA 1EH7A 4BMJA 2YU8A 2EOHA 2B7TA 1YSAC 4B3ME 2YT4A 1P47A 4O43A 2PRTA 4JI4E 2EMKA 2GPIA 4O24A 1PJQA 1SFEA 5LL6R 5KL3A 4DR6E 3BIDA 2FGGA 4AQYE 3VYXA 2YTGA 2EPPA 3C6KA 2M4IA 1T4OA 2EN7A 1EKZA 2RSIA 4X8WA 4DR5E 2DRPA 2N8XA 1TF6A 1X48A 2EMLA 4X65E 1X6EA 3VK6A 2EL5A 2EMYA 1NEIA 2KHXA 3QG5C 4K0KE 1B69A 2DLQA 2EMXA 3F6HA 1X3CA 1DGCA 5KL6A 2ENAA 2YRMA 1ZR9A 4L8NA 3JU0A 4HEIA 2EM2A 2EMHA 5FLXC 4DR7E 3HPSA 2DLKA 1STUA 2L6MA 2V8QB 5AE3A 3HTXA 2V85A 2EMGA 3L00A 2WBTA 1AAYA 2EORA 2EOFA 2LJUA 2EMAA 4NZVA 1WJPA 2V83A 2L92A 4DV6E 4JYAE 2EMIA 5CFFE 2EMBA 3UK3C 2EPNA 2UU9E 3VYYA 3DF6A 3JAMC 4TUGA 2CTDA 1ZU1A 2Q8UA 5AC4A 4R2DA 5IXMB 4MLQA 1G2DC 2DGCA 4DV1E 4F6MA 2GLIA 3H09A 2UUAE 1DQ3A 5AE2A 4F9AB 4R2SA 2JOBA 2WBSA 1PJTA 4GZNC 1ZBQA 2BBGA 2V86A 1X47A 1IBME 1YZ9A 4DR3E 2VE7C 3KZYA 2YTOA 2L2MA 1N32E 4FK5C 2ADRA 1HNXE 4LTYA 2EP3A 1BBOA 4LF8E 2CPNA 4X9JA 5F3WA 1JK2A 2EM7A 2EOIA 1TF3A 2MC5A 2NABA 3HXLA 4RHBB 4JI1E 1FJGE 1RQ0A 1J5EE 2WZOA 1IQSA 3J7AG 2JOXA 2EM5A 4JI2E 1IBKE 2JVAA 2L2NA 5IV8B 4DR1E 2I9IA 4M30A 2EN4A 3BGHA 4BHBA 3AV0A 2EPLX 1IQOA 4P7DA 1KYQA 1A1JA 3T1YE 4TUIA 2UUCE 1QU6A 1KJKA 2YZTA 4Q35B 5A6AA 2L8TA 1UILA 2L3JA 3M99B 1XNRE 4JI5E 1WXRA 4X62E 2LRSA 1IBLE 4JV5E 1A1KA 4LFBE 3EPHA 3ADJA 3C4TA 2WBUA 4R8OA 4L5NC 1GQEA 4X66E 2YRKA 4R2QA 2MKDA 2YTEA 4JI0E 1AH5A 2EOYA 1HR0E 1EH6A 2EQ3A 2YTNA 4GKJE 4KWYA 2EPKX 1A1LA 2MDGA 4BBYA 4R2AA 1FKAE 2LJHA 2EOSA 2ODRD 3J7Yp 3KWRA 2LT7A 2VF1A 2EN2A 5ADZA 1X49A 1PJSA 2EOXA 1A1HA 2JYAA 3KZZA 1GZ6A 1T4NA 4DUYE 2EL6A 4N4RB 1HNZE 3JTZA 2EM0A 4R2EA 1L4SA 2V89A 3C6MA 2L2KB 2H36X 2HC5A 2DIXA 4DR4E 2E72A 4M9VC 4YHHE 2EPMX 4DMIA 1YUIA 4GEQB 5DNYA 2F4VE 3HQ1A 4JI3E 4LFAE 2YSPA 2JR1A 2RPCA 1DI2A 2YTPA 2EMWA 4LFCE 2LTSA 2EMZA 2N3HA 4GKKE 4B3TE 1NCSA 2A25A 1N3GA 4I8OA 4R2RA 1EH8A 4KHPE 2EPAA 2EN1A 2YTQA 4R2CA 4BC7A 1X5WA 1TN9A 4F2JC 2YSOA 3IWBA 2FTXB 2JWOA 2KOUA 2ELYA 1UN6B 4MLVA 1UBDC 2UXBE 4DV5E 4DUZE 2V88A 4OOGC 2M1SA 2EOZA 2YTIA 4DV7E 4WFTA 3C4BA 2EPCA 5A6BD 2V87A 5BR8E 4R2PA 2VRDA 4IS1C 5KL7A 4LF6E 2CSHA 2YU5A 3THOB 5T6JA 2R76A 3EPJA 4DKKA 2JPAA 2UXCE 4X64E 2ENHA 4LF7E 3ADLA 2LMZA 2LO3A 2LV2A 5LLQA 3T1HE 4WSGA 2J7JA 4JI7E 4O4KA 4P78A 1WRJA 2EJ4A 1N33E 4B3SE 4DV0E 1XMOE 4WYQB 4DR2E 1I94E 1T39A 2L3CA 2EN8A 2EOQA 3OTOE 3BBGA 4YY3E 2MKNA 4F54A 2YWQA 1YYKA 2EZ6A 2VQEE 4F6NA 2HGHA 2MDRA 1GTKA 2LUQA 3ADIA 2KONA 2EPRA 2HJJA 4BHCA 2EQ1A 4R03A 2EN6A
chains in the Genus database with same CATH topology
2MDGA 2EMGA 1X6FA 4R2AA 2EOSA 2GHFA 2WBTA 1AAYA 2EORA 2EOJA 2EOFA 2EPZA 2EMAA 2EMFA 5KL5A 1WJPA 2YRHA 2LT7A 2EN2A 2JP9A 2EMIA 3MHSC 2EMBA 2EOXA 3UK3C 1A1HA 1G2FC 2EM6A 2EN3A 2EL4A 1JK1A 5KL2A 2ELZA 1BB8A 2I13A 2CTDA 2EL6A 1ZU1A 2EOEA 4R2DA 1G2DC 2DGCA 2EM0A 4R2EA 2EPXA 4F6MA 2GLIA 2R1FA 4R2SA 1A1FA 1RMDA 1X6HA 1A1IA 2E72A 4M9VC 1ZAAC 2WBSA 1YUIA 2EQ0A 2YSPA 4GZNC 2RPCA 2EM9A 2YTPA 2EMWA 2EM4A 1Z1BA 2EPUA 2EMZA 2BB8A 1NCSA 2A25A 2EMCA 2YTOA 2YTJA 4R2RA 1F2IG 2EPAA 2EN1A 4FK5C 2ADRA 2YTQA 4R2CA 2EE8A 1X5WA 2EP3A 1BBOA 1TN9A 4X9JA 2YU8A 2EOHA 3EPLA 1YSAC 4F2JC 1JK2A 2YSOA 2EM7A 2EOIA 1TF3A 2NABA 1P47A 2PRTA 2EMKA 2ELYA 1UN6B 2EM8A 2EM5A 2YTDA 5KL3A 1LLMC 1UBDC 2LVHA 2EOOA 2YTIA 2EOZA 3MHHC 2YTGA 2EPPA 2EN4A 2EM3A 2LCEA 2EPCA 2WCC3 2EN7A 4R2PA 2RSIA 2VRDA 1A1JA 4IS1C 5KL7A 2CSHA 2YU5A 3EPJA 2DRPA 1KJKA 2D9HA 2JPAA 2M9AA 1YUJA 1TF6A 2ENHA 2LO3A 2LV2A 2EMLA 3M99B 4WSGA 1X6EA 2J7JA 2EJ4A 3VHTB 2EL5A 2EMYA 2CT1A 1A1KA 3EPHA 1B69A 2DLQA 2EN8A 2WBUA 2EMXA 2YTFA 2EOQA 2MKNA 4IJDA 1X3CA 3EPKA 5KL6A 1DGCA 2ENAA 2ENCA 2YRMA 4F6NA 2YRKA 5KL4A 4R2QA 1ZR9A 1A1GA 2HGHA 2DMIA 2MKDA 2YTEA 2EOYA 2EM2A 2EMHA 1MEYC 2EOMA 2EPRA 2DLKA 2EQ3A 2YTNA 2EQ1A 1A1LA 2EN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDG A;  2EMG A;  1X6F A;  4R2A A;  2EOS A;  2GHF A;  2WBT A;  1AAY A;  2EOR A;  2EOJ A;  2EOF A;  2EPZ A;  2EMA A;  2EMF A;  5KL5 A;  1WJP A;  2YRH A;  2LT7 A;  2EN2 A;  2JP9 A;  2EMI A;  3MHS C;  2EMB A;  2EOX A;  3UK3 C;  1A1H A;  1G2F C;  2EM6 A;  2EN3 A;  2EL4 A;  1JK1 A;  5KL2 A;  2ELZ A;  1BB8 A;  2I13 A;  2CTD A;  2EL6 A;  1ZU1 A;  2EOE A;  4R2D A;  1G2D C;  2DGC A;  2EM0 A;  4R2E A;  2EPX A;  4F6M A;  2GLI A;  2R1F A;  4R2S A;  1A1F A;  1RMD A;  1X6H A;  1A1I A;  2E72 A;  4M9V C;  1ZAA C;  2WBS A;  1YUI A;  2EQ0 A;  2YSP A;  4GZN C;  2RPC A;  2EM9 A;  2YTP A;  2EMW A;  2EM4 A;  1Z1B A;  2EPU A;  2EMZ A;  2BB8 A;  1NCS A;  2A25 A;  2EMC A;  2YTO A;  2YTJ A;  4R2R A;  1F2I G;  2EPA A;  2EN1 A;  4FK5 C;  2ADR A;  2YTQ A;  4R2C A;  2EE8 A;  1X5W A;  2EP3 A;  1BBO A;  1TN9 A;  4X9J A;  2YU8 A;  2EOH A;  3EPL A;  1YSA C;  4F2J C;  1JK2 A;  2YSO A;  2EM7 A;  2EOI A;  1TF3 A;  2NAB A;  1P47 A;  2PRT A;  2EMK A;  2ELY A;  1UN6 B;  2EM8 A;  2EM5 A;  2YTD A;  5KL3 A;  1LLM C;  1UBD C;  2LVH A;  2EOO A;  2YTI A;  2EOZ A;  3MHH C;  2YTG A;  2EPP A;  2EN4 A;  2EM3 A;  2LCE A;  2EPC A;  2WCC 3;  2EN7 A;  4R2P A;  2RSI A;  2VRD A;  1A1J A;  4IS1 C;  5KL7 A;  2CSH A;  2YU5 A;  3EPJ A;  2DRP A;  1KJK A;  2D9H A;  2JPA A;  2M9A A;  1YUJ A;  1TF6 A;  2ENH A;  2LO3 A;  2LV2 A;  2EML A;  3M99 B;  4WSG A;  1X6E A;  2J7J A;  2EJ4 A;  3VHT B;  2EL5 A;  2EMY A;  2CT1 A;  1A1K A;  3EPH A;  1B69 A;  2DLQ A;  2EN8 A;  2WBU A;  2EMX A;  2YTF A;  2EOQ A;  2MKN A;  4IJD A;  1X3C A;  3EPK A;  5KL6 A;  1DGC A;  2ENA A;  2ENC A;  2YRM A;  4F6N A;  2YRK A;  5KL4 A;  4R2Q A;  1ZR9 A;  1A1G A;  2HGH A;  2DMI A;  2MKD A;  2YTE A;  2EOY A;  2EM2 A;  2EMH A;  1MEY C;  2EOM A;  2EPR A;  2DLK A;  2EQ3 A;  2YTN A;  2EQ1 A;  1A1L A;  2EN6 A; 
#chains in the Genus database with same CATH topology
 2RSM A;  1X6F A;  4O5G A;  2GHF A;  1N34 E;  2EOJ A;  3DJW A;  1BBG A;  2EMF A;  2FV4 B;  3LLH A;  5KL5 A;  5LMU E;  1UHZ A;  2B7V A;  2LE2 A;  2YRH A;  1QNT A;  2K7I A;  1G2F C;  2EM6 A;  2EN3 A;  2EL4 A;  2N3G A;  1JK1 A;  2LTR A;  2IHR 1;  1MGT A;  3LML A;  3J80 C;  1BB8 A;  4LU9 A;  3RMP A;  4ZYG A;  2JY9 A;  2EPX A;  3ECR A;  1N36 E;  4HTG A;  4LF9 E;  2R1F A;  2JXP A;  1A1F A;  1RMD A;  1X6H A;  1A1I A;  2NUF A;  1IMU A;  1YPN A;  5IWA E;  4RH8 A;  2M7Q A;  1XMQ E;  2RS7 A;  1YYO A;  5AC5 A;  4WPY A;  4Q28 A;  4ZYH A;  1Z1B A;  2RQL A;  1J26 A;  2EMC A;  2YTJ A;  1F2I G;  4JI6 E;  4LF4 E;  2EE8 A;  4NXM E;  4B3R E;  2EWL A;  3EPL A;  1T38 A;  1YFH A;  1WHN A;  2UUB E;  4ZYD A;  3HPZ A;  2EM8 A;  3THN A;  2YTD A;  4ZYE A;  1LLM C;  1PKP A;  2LVH A;  4F9B B;  2EOO A;  3K6Q A;  3MHH C;  2RS6 A;  2NUE A;  2B9D A;  2EM3 A;  2DMY A;  2LCE A;  2WCC 3;  4WSP A;  4NHR A;  1T4L B;  2E5L E;  3IWC A;  4WXD A;  1O0W A;  4M0V A;  2ZM6 E;  2D9H A;  2L33 A;  2M9A A;  1YUJ A;  5A6K A;  4BCA A;  2LUP B;  3F6G A;  4DV2 E;  3VHT B;  5IT9 C;  3BF2 A;  2CT1 A;  3J81 C;  1XNQ E;  2YTF A;  2ODR C;  2NUG A;  2G7H A;  4IJD A;  2HHH E;  3EPK A;  4LF5 E;  2ENC A;  5KL4 A;  1A1G A;  3EQ1 A;  3ADG A;  2DMI A;  2K4V A;  2UXD E;  3IWD A;  5A6B A;  2E1M A;  4KZS A;  4DV3 E;  1MEY C;  2EOM A;  4F9C B;  2DB2 A;  2NA2 A;  5A2Q C;  2VQF E;  4BS9 A;  5A6J A;  5TSE A;  3ZOQ B;  2EPZ A;  4WX9 A;  3FIG A;  3P1X A;  3MSW A;  2JP9 A;  3MHS C;  4J8Z A;  3OML A;  1RC7 A;  1HNW E;  4M2Z A;  4WXC A;  5KL2 A;  2ELZ A;  2I13 A;  2EOE A;  2EPO A;  5LMN E;  3AUZ A;  1YYW A;  2LBS B;  3TQM A;  1SR9 A;  4DV4 E;  2B3T B;  4OX9 E;  5A69 A;  2RTX A;  1PDA A;  1WHQ A;  1ZAA C;  2YPN A;  2F8B A;  2DSY A;  2EQ0 A;  2MC6 A;  2EM9 A;  4NXN E;  2EM4 A;  2EPU A;  2BB8 A;  5AAS A;  5AE1 A;  4BC9 A;  4JI8 E;  1ZBT A;  1EH7 A;  4BMJ A;  2YU8 A;  2EOH A;  2B7T A;  1YSA C;  4B3M E;  2YT4 A;  1P47 A;  4O43 A;  2PRT A;  4JI4 E;  2EMK A;  2GPI A;  4O24 A;  1PJQ A;  1SFE A;  5LL6 R;  5KL3 A;  4DR6 E;  3BID A;  2FGG A;  4AQY E;  3VYX A;  2YTG A;  2EPP A;  3C6K A;  2M4I A;  1T4O A;  2EN7 A;  1EKZ A;  2RSI A;  4X8W A;  4DR5 E;  2DRP A;  2N8X A;  1TF6 A;  1X48 A;  2EML A;  4X65 E;  1X6E A;  3VK6 A;  2EL5 A;  2EMY A;  1NEI A;  2KHX A;  3QG5 C;  4K0K E;  1B69 A;  2DLQ A;  2EMX A;  3F6H A;  1X3C A;  1DGC A;  5KL6 A;  2ENA A;  2YRM A;  1ZR9 A;  4L8N A;  3JU0 A;  4HEI A;  2EM2 A;  2EMH A;  5FLX C;  4DR7 E;  3HPS A;  2DLK A;  1STU A;  2L6M A;  2V8Q B;  5AE3 A;  3HTX A;  2V85 A;  2EMG A;  3L00 A;  2WBT A;  1AAY A;  2EOR A;  2EOF A;  2LJU A;  2EMA A;  4NZV A;  1WJP A;  2V83 A;  2L92 A;  4DV6 E;  4JYA E;  2EMI A;  5CFF E;  2EMB A;  3UK3 C;  2EPN A;  2UU9 E;  3VYY A;  3DF6 A;  3JAM C;  4TUG A;  2CTD A;  1ZU1 A;  2Q8U A;  5AC4 A;  4R2D A;  5IXM B;  4MLQ A;  1G2D C;  2DGC A;  4DV1 E;  4F6M A;  2GLI A;  3H09 A;  2UUA E;  1DQ3 A;  5AE2 A;  4F9A B;  4R2S A;  2JOB A;  2WBS A;  1PJT A;  4GZN C;  1ZBQ A;  2BBG A;  2V86 A;  1X47 A;  1IBM E;  1YZ9 A;  4DR3 E;  2VE7 C;  3KZY A;  2YTO A;  2L2M A;  1N32 E;  4FK5 C;  2ADR A;  1HNX E;  4LTY A;  2EP3 A;  1BBO A;  4LF8 E;  2CPN A;  4X9J A;  5F3W A;  1JK2 A;  2EM7 A;  2EOI A;  1TF3 A;  2MC5 A;  2NAB A;  3HXL A;  4RHB B;  4JI1 E;  1FJG E;  1RQ0 A;  1J5E E;  2WZO A;  1IQS A;  3J7A G;  2JOX A;  2EM5 A;  4JI2 E;  1IBK E;  2JVA A;  2L2N A;  5IV8 B;  4DR1 E;  2I9I A;  4M30 A;  2EN4 A;  3BGH A;  4BHB A;  3AV0 A;  2EPL X;  1IQO A;  4P7D A;  1KYQ A;  1A1J A;  3T1Y E;  4TUI A;  2UUC E;  1QU6 A;  1KJK A;  2YZT A;  4Q35 B;  5A6A A;  2L8T A;  1UIL A;  2L3J A;  3M99 B;  1XNR E;  4JI5 E;  1WXR A;  4X62 E;  2LRS A;  1IBL E;  4JV5 E;  1A1K A;  4LFB E;  3EPH A;  3ADJ A;  3C4T A;  2WBU A;  4R8O A;  4L5N C;  1GQE A;  4X66 E;  2YRK A;  4R2Q A;  2MKD A;  2YTE A;  4JI0 E;  1AH5 A;  2EOY A;  1HR0 E;  1EH6 A;  2EQ3 A;  2YTN A;  4GKJ E;  4KWY A;  2EPK X;  1A1L A;  2MDG A;  4BBY A;  4R2A A;  1FKA E;  2LJH A;  2EOS A;  2ODR D;  3J7Y p;  3KWR A;  2LT7 A;  2VF1 A;  2EN2 A;  5ADZ A;  1X49 A;  1PJS A;  2EOX A;  1A1H A;  2JYA A;  3KZZ A;  1GZ6 A;  1T4N A;  4DUY E;  2EL6 A;  4N4R B;  1HNZ E;  3JTZ A;  2EM0 A;  4R2E A;  1L4S A;  2V89 A;  3C6M A;  2L2K B;  2H36 X;  2HC5 A;  2DIX A;  4DR4 E;  2E72 A;  4M9V C;  4YHH E;  2EPM X;  4DMI A;  1YUI A;  4GEQ B;  5DNY A;  2F4V E;  3HQ1 A;  4JI3 E;  4LFA E;  2YSP A;  2JR1 A;  2RPC A;  1DI2 A;  2YTP A;  2EMW A;  4LFC E;  2LTS A;  2EMZ A;  2N3H A;  4GKK E;  4B3T E;  1NCS A;  2A25 A;  1N3G A;  4I8O A;  4R2R A;  1EH8 A;  4KHP E;  2EPA A;  2EN1 A;  2YTQ A;  4R2C A;  4BC7 A;  1X5W A;  1TN9 A;  4F2J C;  2YSO A;  3IWB A;  2FTX B;  2JWO A;  2KOU A;  2ELY A;  1UN6 B;  4MLV A;  1UBD C;  2UXB E;  4DV5 E;  4DUZ E;  2V88 A;  4OOG C;  2M1S A;  2EOZ A;  2YTI A;  4DV7 E;  4WFT A;  3C4B A;  2EPC A;  5A6B D;  2V87 A;  5BR8 E;  4R2P A;  2VRD A;  4IS1 C;  5KL7 A;  4LF6 E;  2CSH A;  2YU5 A;  3THO B;  5T6J A;  2R76 A;  3EPJ A;  4DKK A;  2JPA A;  2UXC E;  4X64 E;  2ENH A;  4LF7 E;  3ADL A;  2LMZ A;  2LO3 A;  2LV2 A;  5LLQ A;  3T1H E;  4WSG A;  2J7J A;  4JI7 E;  4O4K A;  4P78 A;  1WRJ A;  2EJ4 A;  1N33 E;  4B3S E;  4DV0 E;  1XMO E;  4WYQ B;  4DR2 E;  1I94 E;  1T39 A;  2L3C A;  2EN8 A;  2EOQ A;  3OTO E;  3BBG A;  4YY3 E;  2MKN A;  4F54 A;  2YWQ A;  1YYK A;  2EZ6 A;  2VQE E;  4F6N A;  2HGH A;  2MDR A;  1GTK A;  2LUQ A;  3ADI A;  2KON A;  2EPR A;  2HJJ A;  4BHC A;  2EQ1 A;  4R03 A;  2EN6 A; 
#chains in the Genus database with same CATH homology
 2MDG A;  2EMG A;  1X6F A;  4R2A A;  2EOS A;  2GHF A;  2WBT A;  1AAY A;  2EOR A;  2EOJ A;  2EOF A;  2EPZ A;  2EMA A;  2EMF A;  5KL5 A;  1WJP A;  2YRH A;  2LT7 A;  2EN2 A;  2JP9 A;  2EMI A;  3MHS C;  2EMB A;  2EOX A;  3UK3 C;  1A1H A;  1G2F C;  2EM6 A;  2EN3 A;  2EL4 A;  1JK1 A;  5KL2 A;  2ELZ A;  1BB8 A;  2I13 A;  2CTD A;  2EL6 A;  1ZU1 A;  2EOE A;  4R2D A;  1G2D C;  2DGC A;  2EM0 A;  4R2E A;  2EPX A;  4F6M A;  2GLI A;  2R1F A;  4R2S A;  1A1F A;  1RMD A;  1X6H A;  1A1I A;  2E72 A;  4M9V C;  1ZAA C;  2WBS A;  1YUI A;  2EQ0 A;  2YSP A;  4GZN C;  2RPC A;  2EM9 A;  2YTP A;  2EMW A;  2EM4 A;  1Z1B A;  2EPU A;  2EMZ A;  2BB8 A;  1NCS A;  2A25 A;  2EMC A;  2YTO A;  2YTJ A;  4R2R A;  1F2I G;  2EPA A;  2EN1 A;  4FK5 C;  2ADR A;  2YTQ A;  4R2C A;  2EE8 A;  1X5W A;  2EP3 A;  1BBO A;  1TN9 A;  4X9J A;  2YU8 A;  2EOH A;  3EPL A;  1YSA C;  4F2J C;  1JK2 A;  2YSO A;  2EM7 A;  2EOI A;  1TF3 A;  2NAB A;  1P47 A;  2PRT A;  2EMK A;  2ELY A;  1UN6 B;  2EM8 A;  2EM5 A;  2YTD A;  5KL3 A;  1LLM C;  1UBD C;  2LVH A;  2EOO A;  2YTI A;  2EOZ A;  3MHH C;  2YTG A;  2EPP A;  2EN4 A;  2EM3 A;  2LCE A;  2EPC A;  2WCC 3;  2EN7 A;  4R2P A;  2RSI A;  2VRD A;  1A1J A;  4IS1 C;  5KL7 A;  2CSH A;  2YU5 A;  3EPJ A;  2DRP A;  1KJK A;  2D9H A;  2JPA A;  2M9A A;  1YUJ A;  1TF6 A;  2ENH A;  2LO3 A;  2LV2 A;  2EML A;  3M99 B;  4WSG A;  1X6E A;  2J7J A;  2EJ4 A;  3VHT B;  2EL5 A;  2EMY A;  2CT1 A;  1A1K A;  3EPH A;  1B69 A;  2DLQ A;  2EN8 A;  2WBU A;  2EMX A;  2YTF A;  2EOQ A;  2MKN A;  4IJD A;  1X3C A;  3EPK A;  5KL6 A;  1DGC A;  2ENA A;  2ENC A;  2YRM A;  4F6N A;  2YRK A;  5KL4 A;  4R2Q A;  1ZR9 A;  1A1G A;  2HGH A;  2DMI A;  2MKD A;  2YTE A;  2EOY A;  2EM2 A;  2EMH A;  1MEY C;  2EOM A;  2EPR A;  2DLK A;  2EQ3 A;  2YTN A;  2EQ1 A;  1A1L A;  2EN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...