2EMBA

Solution structure of the c2h2 type zinc finger (region 342-372) of human zinc finger protein 473
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
GSSGSSGHTRKRYECSKCQATFNLRKHLIQHQKTHAAKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 342-372) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2embA01
2A25A 2R1FA 2EM8A 2YTOA 2YTPA 2YU8A 1YSAC 4F6MA 2CTDA 2YTGA 2LT7A 2EMCA 1JK2A 2YTEA 1YUIA 2ELYA 1A1KA 2ENAA 3MHHC 1YUJA 2EM5A 2WBSA 4IJDA 2EOMA 2EMZA 2EE8A 2EN3A 5KL2A 2EMGA 2YTDA 4R2EA 1AAYA 2EMIA 2GHFA 2I13A 1JK1A 2ELZA 2EQ1A 2NABA 5KL3A 2LV2A 1A1LA 3EPJA 3VHTB 2YTQA 2EOJA 2YSPA 1A1GA 2WBTA 2YTIA 2E72A 1A1HA 4M9VC 2EP3A 2CSHA 2YTNA 2EPPA 1NCSA 1BBOA 2EPZA 4R2DA 2EL6A 1MEYC 1X6FA 2LCEA 2EOFA 2ENCA 2EN7A 3UK3C 4R2QA 2J7JA 1G2DC 2MDGA 2EMYA 1KJKA 2EPRA 3EPKA 2EPCA 2MKNA 2EMBA 4R2SA 4F2JC 1UN6B 1RMDA 1TF3A 2ADRA 2EOHA 2EN8A 2EOZA 2EMWA 4FK5C 2EPUA 1ZU1A 1X6HA 2RSIA 2BB8A 2DLQA 1DGCA 3EPHA 2YTFA 2PRTA 2EM3A 5KL4A 2EL4A 2WBUA 2EOEA 1ZR9A 2M9AA 2EN6A 2EOIA 4X9JA 4R2AA 2EM9A 2EQ0A 5KL7A 4R2CA 2DRPA 2EM0A 1X6EA 4IS1C 2EOSA 4R2RA 2EM4A 2EMFA 2EJ4A 2ENHA 1Z1BA 1G2FC 2EOYA 4GZNC 2YU5A 3MHSC 1B69A 2EMAA 1UBDC 2YRMA 1BB8A 2EN4A 1X5WA 2JP9A 2YRKA 1P47A 1A1IA 2CT1A 2EM6A 1TN9A 3M99B 2WCC3 2EMKA 2EPAA 2EM2A 2EPXA 3EPLA 2EORA 2VRDA 2YSOA 2EMXA 1A1JA 2EM7A 2EOXA 5KL6A 1ZAAC 2MKDA 2YRHA 1TF6A 2DLKA 5KL5A 2EN2A 2EN1A 2EMHA 1LLMC 2LO3A 2DMIA 4F6NA 2JPAA 2EMLA 2HGHA 1WJPA 1X3CA 2D9HA 4WSGA 2YTJA 2GLIA 2LVHA 2EL5A 2EQ3A 2DGCA 2EOOA 2RPCA 1F2IG 4R2PA 2EOQA 1A1FA
chains in the Genus database with same CATH superfamily
2A25A 2YU8A 3AUZA 2LT7A 2EMCA 2N3GA 2LJHA 2YTEA 2ELYA 4L8NA 3RMPA 1YUJA 2EM5A 4BMJA 2EE8A 2UU9E 3F6HA 2V88A 2DB2A 2F8BA 4R2EA 3JAMC 1XMQE 2EMIA 2GHFA 2L2NA 4X66E 2VQEE 2CPNA 2ELZA 1EH8A 3BIDA 2I13A 4WXCA 4DV6E 4DR7E 2NUGA 2E72A 4TUIA 4P78A 2YTNA 2ODRC 1BBOA 4B3ME 4M2ZA 2L6MA 2LCEA 2ENCA 2E1MA 1GTKA 2ODRD 2HJJA 1RMDA 1TF3A 4O24A 4RH8A 4B3SE 2ADRA 1HNXE 4WFTA 2L92A 2M7QA 3KWRA 3C6KA 5LMNE 4F9BB 2DLQA 1O0WA 4WXDA 1J5EE 4JI6E 2PRTA 1N33E 4TUGA 2EN6A 4NHRA 4BC7A 4HTGA 4R2AA 4KZSA 1XNRE 2JWOA 2NA2A 4DR3E 2DRPA 2EM0A 4IS1C 2EOSA 4R2RA 3KZYA 4DR6E 2B7TA 5T6JA 1YPNA 4JI0E 4DV5E 4BS9A 2YRKA 3J7Yp 1A1IA 1TN9A 3M99B 2F4VE 1N32E 4MLQA 4I8OA 2EM2A 3ADIA 2N3HA 1EKZA 1N34E 2EMXA 2MC6A 2YT4A 2MKDA 3C4BA 4BC9A 1TF6A 2DLKA 2EN1A 1T4LB 2KONA 3HXLA 4Q35B 1LLMC 2JOBA 4F6NA 4R03A 2D9HA 2YTJA 4LU9A 5TSEA 2EWLA 2DGCA 3QG5C 2EPOA 2RPCA 4WX9A 2R1FA 3KZZA 2YTOA 3IWBA 3LLHA 4JI2E 2CTDA 2EZ6A 3P1XA 2EPLX 2YTGA 4GKJE 3MSWA 1JK2A 1T38A 1PJTA 2B9DA 4DR4E 4DMIA 4IJDA 1WXRA 2EOMA 2EMZA 2EN3A 4F54A 2EMGA 1AH5A 5A6JA 4M0VA 4JI4E 1J26A 1SFEA 2IHR1 2HC5A 1JK1A 2EQ1A 1A1LA 3VYXA 3EPJA 4LF7E 1HNWE 2JVAA 1NEIA 2WBTA 2N8XA 1N3GA 2EP3A 5AC5A 3K6QA 2EPPA 1NCSA 2EPZA 1MEYC 2RS7A 5AASA 4YY3E 2EOFA 3UK3C 1G2DC 1KJKA 2EPRA 3EPKA 2EPCA 1WHQA 2KOUA 3C6MA 1RQ0A 3IWCA 4K0KE 1STUA 2B3TB 3BF2A 4B3TE 4LFBE 4OX9E 2EPUA 4JI3E 4LF6E 2YTFA 2EM3A 1T4OA 1IBKE 2YWQA 1ZR9A 2RQLA 4LF5E 1DQ3A 1UILA 4BHBA 4LTYA 1QNTA 5AE2A 2EM9A 2L3CA 4DV1E 5A6KA 2ZM6E 4MLVA 4R2CA 1YYWA 1XNQE 2EM4A 4DKKA 2KHXA 1G2FC 2UUBE 2EOYA 2BBGA 3ADGA 1HR0E 2FGGA 2V85A 3HPZA 1B69A 2K7IA 2EN4A 2UUCE 4NXNE 1IBME 3THNA 2V83A 2L2KB 1IQOA 1SR9A 2JY9A 3HQ1A 2LTSA 4J8ZA 1PKPA 3EPLA 1L4SA 2EOXA 3IWDA 3ZOQB 1ZAAC 4AQYE 3FIGA 2EMLA 2HGHA 1X3CA 4X62E 3HTXA 2LVHA 3ADJA 3EQ1A 1PJQA 1GQEA 2EQ3A 2DIXA 2EOOA 3HPSA 2EOQA 5IXMB 1A1GA 2V8QB 1I94E 4LF4E 4F9CB 3ECRA 4X64E 1IMUA 1WRJA 4LF8E 1A1KA 2ENAA 3OMLA 1N36E 1BBGA 2HHHE 5KL2A 2GPIA 5LL6R 4O5GA 4NZVA 4DUYE 2NABA 5AE1A 1HNZE 1T4NA 2YTQA 4DR1E 4BHCA 2YTIA 4NXME 2LTRA 4M9VC 4ZYHA 1X47A 4P7DA 4F9AB 3LMLA 5FLXC 2EL6A 1X6FA 1UHZA 3OTOE 2EN7A 3BGHA 4O4KA 2L3JA 2J7JA 3F6GA 5LMUE 2MKNA 1FKAE 2EMBA 4R2SA 2L8TA 1IQSA 4LF9E 4GEQB 2EOHA 4JI5E 2EOZA 4KWYA 2EMWA 1PDAA 2JR1A 1X6HA 2FV4B 2RSIA 1XMOE 1DGCA 3EPHA 5KL4A 2VQFE 2EL4A 3T1YE 2LUQA 2WBUA 2EOEA 2JYAA 2YZTA 3J7AG 4X9JA 1X48A 5DNYA 5A6BA 2UXDE 2L2MA 4R8OA 4JI7E 2RS6A 2EJ4A 2ENHA 4JI8E 4WPYA 4GZNC 4LFCE 3C4TA 2YU5A 4X65E 3MHSC 1UBDC 2G7HA 4DV2E 1BB8A 2Q8UA 2YPNA 2JP9A 4DV3E 5IWAE 2EM6A 4YHHE 2LUPB 4HEIA 1WHNA 2EMKA 1YZ9A 4LFAE 2K4VA 2UUAE 2UXBE 4JV5E 2YSOA 1A1JA 2YRHA 5LLQA 1DI2A 5KL5A 3ADLA 2EN2A 5IV8B 4KHPE 2DSYA 2EMHA 2M4IA 4WSPA 4BCAA 4B3RE 1YYOA 2FTXB 1PJSA 4RHBB 4DR5E 4DV0E 2UXCE 1YYKA 1A1FA 2EM8A 2YTPA 4DV7E 1YSAC 2V87A 4O43A 4F6MA 1ZBTA 2EPNA 1YUIA 3MHHC 4GKKE 3DF6A 2RSMA 2WBSA 2I9IA 2LRSA 4X8WA 2YTDA 1AAYA 5A2QC 3J80C 3VYYA 5KL3A 2LV2A 3THOB 4JYAE 2LE2A 3VHTB 2EPMX 5CFFE 2R76A 2EOJA 2YSPA 2L33A 1A1HA 2CSHA 2JXPA 5A69A 4R2DA 2MC5A 2RTXA 1T39A 3JTZA 2V89A 4R2QA 4OOGC 2MDGA 2EMYA 2WZOA 5F3WA 2NUEA 4BBYA 4DUZE 3DJWA 4F2JC 1EH7A 2VE7C 4DR2E 2MDRA 1UN6B 3L00A 4DV4E 3VK6A 2EN8A 4M30A 2DMYA 2LBSB 4FK5C 1MGTA 1GZ6A 1ZU1A 4N4RB 1YFHA 2BB8A 2NUFA 4Q28A 2M9AA 4WYQB 2EOIA 4JI1E 2EQ0A 1IBLE 2LMZA 2M1SA 5KL7A 1ZBQA 1X6EA 1KYQA 2EMFA 1Z1BA 5IT9C 1X49A 3TQMA 3T1HE 2EMAA 5A6BD 3H09A 2YRMA 4ZYGA 1X5WA 1FJGE 1QU6A 2VF1A 4ZYDA 3J81C 1RC7A 2JOXA 2V86A 1P47A 2CT1A 2WCC3 2EPAA 2EPXA 2EORA 2VRDA 2EM7A 5KL6A 3BBGA 3AV0A 4ZYEA 5BR8E 5AC4A 2LO3A 2DMIA 2E5LE 2H36X 5A6AA 2JPAA 2LJUA 1WJPA 4L5NC 4WSGA 2GLIA 1EH6A 2EPKX 3JU0A 2EL5A 5ADZA 1F2IG 4R2PA 2B7VA 5AE3A
chains in the Genus database with same CATH topology
2A25A 2R1FA 2EM8A 2YTOA 2YTPA 2YU8A 1YSAC 4F6MA 2CTDA 2YTGA 2LT7A 2EMCA 1JK2A 2YTEA 1YUIA 2ELYA 1A1KA 2ENAA 3MHHC 1YUJA 2EM5A 2WBSA 4IJDA 2EOMA 2EMZA 2EE8A 2EN3A 5KL2A 2EMGA 2YTDA 4R2EA 1AAYA 2EMIA 2GHFA 2I13A 1JK1A 2ELZA 2EQ1A 2NABA 5KL3A 2LV2A 1A1LA 3EPJA 3VHTB 2YTQA 2EOJA 2YSPA 1A1GA 2WBTA 2YTIA 2E72A 1A1HA 4M9VC 2EP3A 2CSHA 2YTNA 2EPPA 1NCSA 1BBOA 2EPZA 4R2DA 2EL6A 1MEYC 1X6FA 2LCEA 2EOFA 2ENCA 2EN7A 3UK3C 4R2QA 2J7JA 1G2DC 2MDGA 2EMYA 1KJKA 2EPRA 3EPKA 2EPCA 2MKNA 2EMBA 4R2SA 4F2JC 1UN6B 1RMDA 1TF3A 2ADRA 2EOHA 2EN8A 2EOZA 2EMWA 4FK5C 2EPUA 1ZU1A 1X6HA 2RSIA 2BB8A 2DLQA 1DGCA 3EPHA 2YTFA 2PRTA 2EM3A 5KL4A 2EL4A 2WBUA 2EOEA 1ZR9A 2M9AA 2EN6A 2EOIA 4X9JA 4R2AA 2EM9A 2EQ0A 5KL7A 4R2CA 2DRPA 2EM0A 1X6EA 4IS1C 2EOSA 4R2RA 2EM4A 2EMFA 2EJ4A 2ENHA 1Z1BA 1G2FC 2EOYA 4GZNC 2YU5A 3MHSC 1B69A 2EMAA 1UBDC 2YRMA 1BB8A 2EN4A 1X5WA 2JP9A 2YRKA 1P47A 1A1IA 2CT1A 2EM6A 1TN9A 3M99B 2WCC3 2EMKA 2EPAA 2EM2A 2EPXA 3EPLA 2EORA 2VRDA 2YSOA 2EMXA 1A1JA 2EM7A 2EOXA 5KL6A 1ZAAC 2MKDA 2YRHA 1TF6A 2DLKA 5KL5A 2EN2A 2EN1A 2EMHA 1LLMC 2LO3A 2DMIA 4F6NA 2JPAA 2EMLA 2HGHA 1WJPA 1X3CA 2D9HA 4WSGA 2YTJA 2GLIA 2LVHA 2EL5A 2EQ3A 2DGCA 2EOOA 2RPCA 1F2IG 4R2PA 2EOQA 1A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A25 A;  2R1F A;  2EM8 A;  2YTO A;  2YTP A;  2YU8 A;  1YSA C;  4F6M A;  2CTD A;  2YTG A;  2LT7 A;  2EMC A;  1JK2 A;  2YTE A;  1YUI A;  2ELY A;  1A1K A;  2ENA A;  3MHH C;  1YUJ A;  2EM5 A;  2WBS A;  4IJD A;  2EOM A;  2EMZ A;  2EE8 A;  2EN3 A;  5KL2 A;  2EMG A;  2YTD A;  4R2E A;  1AAY A;  2EMI A;  2GHF A;  2I13 A;  1JK1 A;  2ELZ A;  2EQ1 A;  2NAB A;  5KL3 A;  2LV2 A;  1A1L A;  3EPJ A;  3VHT B;  2YTQ A;  2EOJ A;  2YSP A;  1A1G A;  2WBT A;  2YTI A;  2E72 A;  1A1H A;  4M9V C;  2EP3 A;  2CSH A;  2YTN A;  2EPP A;  1NCS A;  1BBO A;  2EPZ A;  4R2D A;  2EL6 A;  1MEY C;  1X6F A;  2LCE A;  2EOF A;  2ENC A;  2EN7 A;  3UK3 C;  4R2Q A;  2J7J A;  1G2D C;  2MDG A;  2EMY A;  1KJK A;  2EPR A;  3EPK A;  2EPC A;  2MKN A;  2EMB A;  4R2S A;  4F2J C;  1UN6 B;  1RMD A;  1TF3 A;  2ADR A;  2EOH A;  2EN8 A;  2EOZ A;  2EMW A;  4FK5 C;  2EPU A;  1ZU1 A;  1X6H A;  2RSI A;  2BB8 A;  2DLQ A;  1DGC A;  3EPH A;  2YTF A;  2PRT A;  2EM3 A;  5KL4 A;  2EL4 A;  2WBU A;  2EOE A;  1ZR9 A;  2M9A A;  2EN6 A;  2EOI A;  4X9J A;  4R2A A;  2EM9 A;  2EQ0 A;  5KL7 A;  4R2C A;  2DRP A;  2EM0 A;  1X6E A;  4IS1 C;  2EOS A;  4R2R A;  2EM4 A;  2EMF A;  2EJ4 A;  2ENH A;  1Z1B A;  1G2F C;  2EOY A;  4GZN C;  2YU5 A;  3MHS C;  1B69 A;  2EMA A;  1UBD C;  2YRM A;  1BB8 A;  2EN4 A;  1X5W A;  2JP9 A;  2YRK A;  1P47 A;  1A1I A;  2CT1 A;  2EM6 A;  1TN9 A;  3M99 B;  2WCC 3;  2EMK A;  2EPA A;  2EM2 A;  2EPX A;  3EPL A;  2EOR A;  2VRD A;  2YSO A;  2EMX A;  1A1J A;  2EM7 A;  2EOX A;  5KL6 A;  1ZAA C;  2MKD A;  2YRH A;  1TF6 A;  2DLK A;  5KL5 A;  2EN2 A;  2EN1 A;  2EMH A;  1LLM C;  2LO3 A;  2DMI A;  4F6N A;  2JPA A;  2EML A;  2HGH A;  1WJP A;  1X3C A;  2D9H A;  4WSG A;  2YTJ A;  2GLI A;  2LVH A;  2EL5 A;  2EQ3 A;  2DGC A;  2EOO A;  2RPC A;  1F2I G;  4R2P A;  2EOQ A;  1A1F A; 
#chains in the Genus database with same CATH topology
 2A25 A;  2YU8 A;  3AUZ A;  2LT7 A;  2EMC A;  2N3G A;  2LJH A;  2YTE A;  2ELY A;  4L8N A;  3RMP A;  1YUJ A;  2EM5 A;  4BMJ A;  2EE8 A;  2UU9 E;  3F6H A;  2V88 A;  2DB2 A;  2F8B A;  4R2E A;  3JAM C;  1XMQ E;  2EMI A;  2GHF A;  2L2N A;  4X66 E;  2VQE E;  2CPN A;  2ELZ A;  1EH8 A;  3BID A;  2I13 A;  4WXC A;  4DV6 E;  4DR7 E;  2NUG A;  2E72 A;  4TUI A;  4P78 A;  2YTN A;  2ODR C;  1BBO A;  4B3M E;  4M2Z A;  2L6M A;  2LCE A;  2ENC A;  2E1M A;  1GTK A;  2ODR D;  2HJJ A;  1RMD A;  1TF3 A;  4O24 A;  4RH8 A;  4B3S E;  2ADR A;  1HNX E;  4WFT A;  2L92 A;  2M7Q A;  3KWR A;  3C6K A;  5LMN E;  4F9B B;  2DLQ A;  1O0W A;  4WXD A;  1J5E E;  4JI6 E;  2PRT A;  1N33 E;  4TUG A;  2EN6 A;  4NHR A;  4BC7 A;  4HTG A;  4R2A A;  4KZS A;  1XNR E;  2JWO A;  2NA2 A;  4DR3 E;  2DRP A;  2EM0 A;  4IS1 C;  2EOS A;  4R2R A;  3KZY A;  4DR6 E;  2B7T A;  5T6J A;  1YPN A;  4JI0 E;  4DV5 E;  4BS9 A;  2YRK A;  3J7Y p;  1A1I A;  1TN9 A;  3M99 B;  2F4V E;  1N32 E;  4MLQ A;  4I8O A;  2EM2 A;  3ADI A;  2N3H A;  1EKZ A;  1N34 E;  2EMX A;  2MC6 A;  2YT4 A;  2MKD A;  3C4B A;  4BC9 A;  1TF6 A;  2DLK A;  2EN1 A;  1T4L B;  2KON A;  3HXL A;  4Q35 B;  1LLM C;  2JOB A;  4F6N A;  4R03 A;  2D9H A;  2YTJ A;  4LU9 A;  5TSE A;  2EWL A;  2DGC A;  3QG5 C;  2EPO A;  2RPC A;  4WX9 A;  2R1F A;  3KZZ A;  2YTO A;  3IWB A;  3LLH A;  4JI2 E;  2CTD A;  2EZ6 A;  3P1X A;  2EPL X;  2YTG A;  4GKJ E;  3MSW A;  1JK2 A;  1T38 A;  1PJT A;  2B9D A;  4DR4 E;  4DMI A;  4IJD A;  1WXR A;  2EOM A;  2EMZ A;  2EN3 A;  4F54 A;  2EMG A;  1AH5 A;  5A6J A;  4M0V A;  4JI4 E;  1J26 A;  1SFE A;  2IHR 1;  2HC5 A;  1JK1 A;  2EQ1 A;  1A1L A;  3VYX A;  3EPJ A;  4LF7 E;  1HNW E;  2JVA A;  1NEI A;  2WBT A;  2N8X A;  1N3G A;  2EP3 A;  5AC5 A;  3K6Q A;  2EPP A;  1NCS A;  2EPZ A;  1MEY C;  2RS7 A;  5AAS A;  4YY3 E;  2EOF A;  3UK3 C;  1G2D C;  1KJK A;  2EPR A;  3EPK A;  2EPC A;  1WHQ A;  2KOU A;  3C6M A;  1RQ0 A;  3IWC A;  4K0K E;  1STU A;  2B3T B;  3BF2 A;  4B3T E;  4LFB E;  4OX9 E;  2EPU A;  4JI3 E;  4LF6 E;  2YTF A;  2EM3 A;  1T4O A;  1IBK E;  2YWQ A;  1ZR9 A;  2RQL A;  4LF5 E;  1DQ3 A;  1UIL A;  4BHB A;  4LTY A;  1QNT A;  5AE2 A;  2EM9 A;  2L3C A;  4DV1 E;  5A6K A;  2ZM6 E;  4MLV A;  4R2C A;  1YYW A;  1XNQ E;  2EM4 A;  4DKK A;  2KHX A;  1G2F C;  2UUB E;  2EOY A;  2BBG A;  3ADG A;  1HR0 E;  2FGG A;  2V85 A;  3HPZ A;  1B69 A;  2K7I A;  2EN4 A;  2UUC E;  4NXN E;  1IBM E;  3THN A;  2V83 A;  2L2K B;  1IQO A;  1SR9 A;  2JY9 A;  3HQ1 A;  2LTS A;  4J8Z A;  1PKP A;  3EPL A;  1L4S A;  2EOX A;  3IWD A;  3ZOQ B;  1ZAA C;  4AQY E;  3FIG A;  2EML A;  2HGH A;  1X3C A;  4X62 E;  3HTX A;  2LVH A;  3ADJ A;  3EQ1 A;  1PJQ A;  1GQE A;  2EQ3 A;  2DIX A;  2EOO A;  3HPS A;  2EOQ A;  5IXM B;  1A1G A;  2V8Q B;  1I94 E;  4LF4 E;  4F9C B;  3ECR A;  4X64 E;  1IMU A;  1WRJ A;  4LF8 E;  1A1K A;  2ENA A;  3OML A;  1N36 E;  1BBG A;  2HHH E;  5KL2 A;  2GPI A;  5LL6 R;  4O5G A;  4NZV A;  4DUY E;  2NAB A;  5AE1 A;  1HNZ E;  1T4N A;  2YTQ A;  4DR1 E;  4BHC A;  2YTI A;  4NXM E;  2LTR A;  4M9V C;  4ZYH A;  1X47 A;  4P7D A;  4F9A B;  3LML A;  5FLX C;  2EL6 A;  1X6F A;  1UHZ A;  3OTO E;  2EN7 A;  3BGH A;  4O4K A;  2L3J A;  2J7J A;  3F6G A;  5LMU E;  2MKN A;  1FKA E;  2EMB A;  4R2S A;  2L8T A;  1IQS A;  4LF9 E;  4GEQ B;  2EOH A;  4JI5 E;  2EOZ A;  4KWY A;  2EMW A;  1PDA A;  2JR1 A;  1X6H A;  2FV4 B;  2RSI A;  1XMO E;  1DGC A;  3EPH A;  5KL4 A;  2VQF E;  2EL4 A;  3T1Y E;  2LUQ A;  2WBU A;  2EOE A;  2JYA A;  2YZT A;  3J7A G;  4X9J A;  1X48 A;  5DNY A;  5A6B A;  2UXD E;  2L2M A;  4R8O A;  4JI7 E;  2RS6 A;  2EJ4 A;  2ENH A;  4JI8 E;  4WPY A;  4GZN C;  4LFC E;  3C4T A;  2YU5 A;  4X65 E;  3MHS C;  1UBD C;  2G7H A;  4DV2 E;  1BB8 A;  2Q8U A;  2YPN A;  2JP9 A;  4DV3 E;  5IWA E;  2EM6 A;  4YHH E;  2LUP B;  4HEI A;  1WHN A;  2EMK A;  1YZ9 A;  4LFA E;  2K4V A;  2UUA E;  2UXB E;  4JV5 E;  2YSO A;  1A1J A;  2YRH A;  5LLQ A;  1DI2 A;  5KL5 A;  3ADL A;  2EN2 A;  5IV8 B;  4KHP E;  2DSY A;  2EMH A;  2M4I A;  4WSP A;  4BCA A;  4B3R E;  1YYO A;  2FTX B;  1PJS A;  4RHB B;  4DR5 E;  4DV0 E;  2UXC E;  1YYK A;  1A1F A;  2EM8 A;  2YTP A;  4DV7 E;  1YSA C;  2V87 A;  4O43 A;  4F6M A;  1ZBT A;  2EPN A;  1YUI A;  3MHH C;  4GKK E;  3DF6 A;  2RSM A;  2WBS A;  2I9I A;  2LRS A;  4X8W A;  2YTD A;  1AAY A;  5A2Q C;  3J80 C;  3VYY A;  5KL3 A;  2LV2 A;  3THO B;  4JYA E;  2LE2 A;  3VHT B;  2EPM X;  5CFF E;  2R76 A;  2EOJ A;  2YSP A;  2L33 A;  1A1H A;  2CSH A;  2JXP A;  5A69 A;  4R2D A;  2MC5 A;  2RTX A;  1T39 A;  3JTZ A;  2V89 A;  4R2Q A;  4OOG C;  2MDG A;  2EMY A;  2WZO A;  5F3W A;  2NUE A;  4BBY A;  4DUZ E;  3DJW A;  4F2J C;  1EH7 A;  2VE7 C;  4DR2 E;  2MDR A;  1UN6 B;  3L00 A;  4DV4 E;  3VK6 A;  2EN8 A;  4M30 A;  2DMY A;  2LBS B;  4FK5 C;  1MGT A;  1GZ6 A;  1ZU1 A;  4N4R B;  1YFH A;  2BB8 A;  2NUF A;  4Q28 A;  2M9A A;  4WYQ B;  2EOI A;  4JI1 E;  2EQ0 A;  1IBL E;  2LMZ A;  2M1S A;  5KL7 A;  1ZBQ A;  1X6E A;  1KYQ A;  2EMF A;  1Z1B A;  5IT9 C;  1X49 A;  3TQM A;  3T1H E;  2EMA A;  5A6B D;  3H09 A;  2YRM A;  4ZYG A;  1X5W A;  1FJG E;  1QU6 A;  2VF1 A;  4ZYD A;  3J81 C;  1RC7 A;  2JOX A;  2V86 A;  1P47 A;  2CT1 A;  2WCC 3;  2EPA A;  2EPX A;  2EOR A;  2VRD A;  2EM7 A;  5KL6 A;  3BBG A;  3AV0 A;  4ZYE A;  5BR8 E;  5AC4 A;  2LO3 A;  2DMI A;  2E5L E;  2H36 X;  5A6A A;  2JPA A;  2LJU A;  1WJP A;  4L5N C;  4WSG A;  2GLI A;  1EH6 A;  2EPK X;  3JU0 A;  2EL5 A;  5ADZ A;  1F2I G;  4R2P A;  2B7V A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 2A25 A;  2R1F A;  2EM8 A;  2YTO A;  2YTP A;  2YU8 A;  1YSA C;  4F6M A;  2CTD A;  2YTG A;  2LT7 A;  2EMC A;  1JK2 A;  2YTE A;  1YUI A;  2ELY A;  1A1K A;  2ENA A;  3MHH C;  1YUJ A;  2EM5 A;  2WBS A;  4IJD A;  2EOM A;  2EMZ A;  2EE8 A;  2EN3 A;  5KL2 A;  2EMG A;  2YTD A;  4R2E A;  1AAY A;  2EMI A;  2GHF A;  2I13 A;  1JK1 A;  2ELZ A;  2EQ1 A;  2NAB A;  5KL3 A;  2LV2 A;  1A1L A;  3EPJ A;  3VHT B;  2YTQ A;  2EOJ A;  2YSP A;  1A1G A;  2WBT A;  2YTI A;  2E72 A;  1A1H A;  4M9V C;  2EP3 A;  2CSH A;  2YTN A;  2EPP A;  1NCS A;  1BBO A;  2EPZ A;  4R2D A;  2EL6 A;  1MEY C;  1X6F A;  2LCE A;  2EOF A;  2ENC A;  2EN7 A;  3UK3 C;  4R2Q A;  2J7J A;  1G2D C;  2MDG A;  2EMY A;  1KJK A;  2EPR A;  3EPK A;  2EPC A;  2MKN A;  2EMB A;  4R2S A;  4F2J C;  1UN6 B;  1RMD A;  1TF3 A;  2ADR A;  2EOH A;  2EN8 A;  2EOZ A;  2EMW A;  4FK5 C;  2EPU A;  1ZU1 A;  1X6H A;  2RSI A;  2BB8 A;  2DLQ A;  1DGC A;  3EPH A;  2YTF A;  2PRT A;  2EM3 A;  5KL4 A;  2EL4 A;  2WBU A;  2EOE A;  1ZR9 A;  2M9A A;  2EN6 A;  2EOI A;  4X9J A;  4R2A A;  2EM9 A;  2EQ0 A;  5KL7 A;  4R2C A;  2DRP A;  2EM0 A;  1X6E A;  4IS1 C;  2EOS A;  4R2R A;  2EM4 A;  2EMF A;  2EJ4 A;  2ENH A;  1Z1B A;  1G2F C;  2EOY A;  4GZN C;  2YU5 A;  3MHS C;  1B69 A;  2EMA A;  1UBD C;  2YRM A;  1BB8 A;  2EN4 A;  1X5W A;  2JP9 A;  2YRK A;  1P47 A;  1A1I A;  2CT1 A;  2EM6 A;  1TN9 A;  3M99 B;  2WCC 3;  2EMK A;  2EPA A;  2EM2 A;  2EPX A;  3EPL A;  2EOR A;  2VRD A;  2YSO A;  2EMX A;  1A1J A;  2EM7 A;  2EOX A;  5KL6 A;  1ZAA C;  2MKD A;  2YRH A;  1TF6 A;  2DLK A;  5KL5 A;  2EN2 A;  2EN1 A;  2EMH A;  1LLM C;  2LO3 A;  2DMI A;  4F6N A;  2JPA A;  2EML A;  2HGH A;  1WJP A;  1X3C A;  2D9H A;  4WSG A;  2YTJ A;  2GLI A;  2LVH A;  2EL5 A;  2EQ3 A;  2DGC A;  2EOO A;  2RPC A;  1F2I G;  4R2P A;  2EOQ A;  1A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...