2EMBA

Solution structure of the c2h2 type zinc finger (region 342-372) of human zinc finger protein 473
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGHTRKRYECSKCQATFNLRKHLIQHQKTHAAKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 473
publication title Solution structure of the C2H2 type zinc finger (region 342-372) of human Zinc finger protein 473
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2embA01
1NCSA 3MHHC 1G2FC 4GZNC 2DLKA 2HGHA 2ENHA 2EN3A 2ENCA 1ZU1A 2DGCA 3EPKA 2VRDA 4X9JA 1Z1BA 2EPRA 1KJKA 1UBDC 2NABA 2EM6A 2EM7A 4WSGA 2ELZA 1A1LA 2EMBA 2ENAA 2LO3A 1MEYC 2MKNA 1A1FA 1WJPA 2EMYA 1X6HA 2EL5A 3VHTB 2J7JA 3M99B 4R2EA 2LT7A 2EOHA 2YTFA 2RSIA 2EMKA 2DLQA 2EMZA 2YTNA 2BB8A 2ELYA 2MKDA 2EL4A 2EM3A 4FK5C 2EPPA 1A1KA 2EMAA 2EPAA 1LLMC 2DMIA 1A1GA 1BBOA 1UN6B 2GHFA 5KL2A 2WBUA 2EPXA 2LV2A 1ZR9A 2YTIA 5KL6A 1TF3A 2M9AA 1X5WA 2ADRA 2EQ1A 1A1HA 2EOEA 2EOYA 2LVHA 4F6NA 2YU8A 2I13A 2JPAA 2EM2A 2YTOA 2A25A 2EL6A 2GLIA 2EQ3A 2EMWA 1JK2A 1ZAAC 1F2IG 2EMCA 2EN2A 3UK3C 2EPUA 2LCEA 2WCC3 4IS1C 4R2RA 4IJDA 2RPCA 2R1FA 5KL5A 3EPJA 2EQ0A 2EN4A 1BB8A 1YUJA 2EM4A 2EORA 2YU5A 2PRTA 1YUIA 2YTPA 1X3CA 2EM0A 2EOIA 2EOFA 2JP9A 2EN1A 2CT1A 1B69A 2EE8A 1RMDA 2EPZA 2EOOA 2EMGA 2EOXA 3MHSC 2WBSA 1A1JA 4R2AA 1G2DC 5KL4A 4F2JC 1TF6A 2CSHA 2EM5A 2EM8A 2EP3A 2EOSA 4R2QA 2EOJA 4F6MA 2YSPA 1TN9A 2DRPA 4R2DA 2YSOA 2YRMA 2YRHA 1X6FA 2E72A 4R2PA 2YTGA 5KL7A 3EPLA 1DGCA 1YSAC 2CTDA 2YTQA 2EMFA 1JK1A 1P47A 1A1IA 2YTEA 2EN6A 5KL3A 4R2CA 2EN7A 2YRKA 2EN8A 2EMIA 2EMXA 2YTJA 4M9VC 2EM9A 1X6EA 2EOZA 2EOQA 1AAYA 2YTDA 2WBTA 2EMHA 3EPHA 2MDGA 2EMLA 4R2SA 2EJ4A 2EOMA 2EPCA 2D9HA
chains in the Genus database with same CATH superfamily
2UUBE 1UHZA 1G2FC 3VK6A 4LF4E 2EPOA 2HGHA 4J8ZA 2ENCA 2ODRD 4ZYDA 3LMLA 3EPKA 2VRDA 5AC4A 2KONA 3BBGA 4WSGA 2BBGA 2ELZA 2NUEA 2EMBA 1A1FA 2M1SA 2EL5A 2J7JA 3M99B 3KZZA 2EPKX 1SFEA 2YTFA 4DKKA 1IQOA 4P7DA 2EPMX 1PJTA 2YTNA 2JOBA 4BS9A 2EM3A 4DV2E 3ECRA 2UXDE 4FK5C 4DR1E 4LU9A 2G7HA 2EMAA 2EPAA 4KHPE 2B9DA 2V88A 3K6QA 2DMIA 4WXCA 1DQ3A 4BMJA 2EPLX 3THNA 2ODRC 2DB2A 4LF9E 1BBOA 4DR6E 1IBKE 2WBUA 2LV2A 4GKKE 2V85A 5KL6A 2M9AA 4RH8A 3T1HE 4M2ZA 1A1HA 1I94E 2KHXA 5A69A 4F54A 2EM2A 4B3ME 5AE2A 2EQ3A 2EMWA 1ZAAC 4JI3E 1AH5A 5A6BA 2N3GA 1L4SA 4MLQA 4MLVA 3EPJA 2YZTA 1YUJA 2EM4A 2YTPA 1X3CA 2EOIA 4HEIA 3J81C 2NUGA 1J26A 2EE8A 2EPZA 1ZBQA 5AE1A 4LF7E 4DUYE 3OTOE 1G2DC 4KZSA 4DV7E 4LFAE 1T38A 5CFFE 1EH6A 2DRPA 1YZ9A 4R2DA 2EWLA 2YRMA 2YRHA 4YY3E 4X8WA 1IBME 2LE2A 1YSAC 2YTQA 3C4BA 2UUAE 3F6GA 2EN6A 5KL3A 2RQLA 4R2CA 4L8NA 2EMXA 2EPNA 2FV4B 4BHBA 3L00A 1WXRA 5A6JA 1QNTA 3J80C 2EOQA 2YTDA 3HPZA 5AASA 2LUQA 2WBTA 3BGHA 2V87A 4R2SA 2EOMA 2VF1A 2D9HA 2RSMA 2V8QB 3MHHC 5AC5A 5LLQA 2EN3A 2L8TA 2DGCA 3AUZA 2F8BA 2HC5A 1UBDC 4TUGA 1BBGA 2EM7A 1MEYC 2V83A 2JVAA 2MKNA 2LMZA 1WHQA 4BC7A 2N3HA 1KYQA 4DR3E 2NUFA 3VHTB 2MC6A 4R2EA 5DNYA 3C4TA 2EMKA 2DLQA 2JWOA 2BB8A 4OX9E 4L5NC 1A1KA 5BR8E 1T39A 3ADIA 5LL6R 5AE3A 2GHFA 5F3WA 2EPXA 1YYOA 4DR7E 1TF3A 2EZ6A 2LJUA 3JAMC 3DF6A 4GEQB 2EQ1A 1HNWE 4JI1E 2EOEA 2JY9A 2I13A 4NXNE 2DMYA 1DI2A 2A25A 4BBYA 4JI0E 2VQEE 1JK2A 3VYXA 1EH7A 4M0VA 1F2IG 2E1MA 3ZOQB 4ZYEA 4IS1C 2LTRA 4IJDA 1N32E 2DSYA 2R1FA 2EQ0A 2UXBE 2EN4A 2YPNA 2YU5A 1YUIA 2EM0A 2EOFA 2EN1A 2CT1A 2JOXA 1B69A 5LMUE 4Q28A 4WPYA 4DV5E 2VE7C 4DV0E 1WHNA 3JU0A 5KL4A 1TF6A 2EM8A 4F9CB 2EP3A 3F6HA 2EOSA 4GKJE 2YSPA 3P1XA 2L33A 3KZYA 1IQSA 4I8OA 4DR5E 4TUIA 2B7TA 5KL7A 2CTDA 2EMFA 1YPNA 1P47A 1A1IA 4R8OA 3TQMA 4B3RE 2EN8A 1FJGE 2E5LE 2EMIA 4M9VC 1O0WA 1SR9A 1EH8A 2DIXA 1AAYA 2UUCE 4DR2E 1WRJA 3IWBA 4JYAE 1X6FA 5LMNE 2YWQA 4JI6E 3ADGA 4WSPA 1NCSA 1GZ6A 2DLKA 4P78A 1ZU1A 2HJJA 5T6JA 3HTXA 1J5EE 2EPRA 1KJKA 1PJSA 1YYWA 1A1LA 2LO3A 1XNQE 4NXME 1X6HA 4M30A 4JI4E 3J7Yp 4BCAA 2HHHE 2ELYA 2EL4A 4ZYGA 2N8XA 4LFBE 4WX9A 2I9IA 2L3JA 1A1GA 3ADLA 3EQ1A 4DMIA 2YT4A 2GPIA 5KL2A 1UN6B 4X65E 5A6KA 5IT9C 1NEIA 2YTIA 4WXDA 1X5WA 2LBSB 2MC5A 2EOYA 2LVHA 4F6NA 2JPAA 1EKZA 1X49A 2EMCA 3UK3C 2EPUA 2LCEA 2K4VA 4R2RA 1PJQA 3BF2A 1UILA 1BB8A 4BHCA 3C6KA 3MSWA 2UU9E 4ZYHA 2MDRA 2JP9A 4HTGA 1X48A 1RMDA 2EOOA 1A1JA 1MGTA 3HQ1A 2WBSA 3VYYA 4R2AA 1YYKA 4F2JC 2LUPB 2UXCE 4R2QA 2EOJA 2B3TB 4O5GA 1FKAE 2LRSA 2WZOA 2M4IA 2E72A 4RHBB 4DV6E 4K0KE 1JK1A 2CPNA 2ZM6E 4O43A 2YTEA 3C6MA 2RTXA 2EN7A 2H36X 4B3TE 4LTYA 5ADZA 2KOUA 2LTSA 1XMQE 2M7QA 2EOZA 1T4NA 3DJWA 5A2QC 3BIDA 2EMHA 3EPHA 2MDGA 1PKPA 2EJ4A 3THOB 1N36E 2JYAA 2RS6A 1GQEA 4GZNC 4WFTA 4O4KA 2ENHA 1HNZE 4NHRA 4X62E 1Z1BA 4X9JA 3H09A 2NABA 2EM6A 5A6AA 2ENAA 2IHR1 1XNRE 1WJPA 2EMYA 4O24A 5IXMB 1N3GA 3OMLA 2LT7A 2EOHA 2LJHA 3JTZA 4F9AB 2FGGA 2L2MA 2RSIA 2L2KB 2EMZA 2MKDA 2K7IA 2B7VA 2V89A 3LLHA 2EPPA 2L3CA 4X64E 2Q8UA 4DV4E 2V86A 1LLMC 1PDAA 1HR0E 2L92A 4LF8E 1ZR9A 1N33E 2ADRA 4Q35B 2F4VE 1GTKA 3AV0A 1T4LB 1ZBTA 4DV1E 2YU8A 4JI7E 2YTOA 2VQFE 4YHHE 2EL6A 2GLIA 4DR4E 4KWYA 1IBLE 1RC7A 2EN2A 2WCC3 2JR1A 4OOGC 2RPCA 5KL5A 3HPSA 4X66E 1T4OA 4N4RB 2EORA 1XMOE 2PRTA 5A6BD 4DUZE 4JV5E 3QG5C 3T1YE 1IMUA 4AQYE 2NA2A 1N34E 3J7AG 3ADJA 3HXLA 2L2NA 4JI5E 4WYQB 1X47A 5IV8B 2RS7A 1RQ0A 2EOXA 2EMGA 2JXPA 3MHSC 1STUA 2CSHA 2EM5A 4F6MA 4DV3E 1TN9A 3IWCA 4F9BB 5FLXC 2YSOA 4JI2E 3FIGA 3IWDA 4BC9A 2R76A 1YFHA 4R03A 4R2PA 2YTGA 1QU6A 3EPLA 1DGCA 3RMPA 4B3SE 4JI8E 2FTXB 4LFCE 2YRKA 2YTJA 2EM9A 1HNXE 5IWAE 1X6EA 3KWRA 5TSEA 2EMLA 4NZVA 4LF5E 2L6MA 4LF6E 2EPCA
chains in the Genus database with same CATH topology
1NCSA 3MHHC 1G2FC 4GZNC 2DLKA 2HGHA 2ENHA 2EN3A 2ENCA 1ZU1A 2DGCA 3EPKA 2VRDA 4X9JA 1Z1BA 2EPRA 1KJKA 1UBDC 2NABA 2EM6A 2EM7A 4WSGA 2ELZA 1A1LA 2EMBA 2ENAA 2LO3A 1MEYC 2MKNA 1A1FA 1WJPA 2EMYA 1X6HA 2EL5A 3VHTB 2J7JA 3M99B 4R2EA 2LT7A 2EOHA 2YTFA 2RSIA 2EMKA 2DLQA 2EMZA 2YTNA 2BB8A 2ELYA 2MKDA 2EL4A 2EM3A 4FK5C 2EPPA 1A1KA 2EMAA 2EPAA 1LLMC 2DMIA 1A1GA 1BBOA 1UN6B 2GHFA 5KL2A 2WBUA 2EPXA 2LV2A 1ZR9A 2YTIA 5KL6A 1TF3A 2M9AA 1X5WA 2ADRA 2EQ1A 1A1HA 2EOEA 2EOYA 2LVHA 4F6NA 2YU8A 2I13A 2JPAA 2EM2A 2YTOA 2A25A 2EL6A 2GLIA 2EQ3A 2EMWA 1JK2A 1ZAAC 1F2IG 2EMCA 2EN2A 3UK3C 2EPUA 2LCEA 2WCC3 4IS1C 4R2RA 4IJDA 2RPCA 2R1FA 5KL5A 3EPJA 2EQ0A 2EN4A 1BB8A 1YUJA 2EM4A 2EORA 2YU5A 2PRTA 1YUIA 2YTPA 1X3CA 2EM0A 2EOIA 2EOFA 2JP9A 2EN1A 2CT1A 1B69A 2EE8A 1RMDA 2EPZA 2EOOA 2EMGA 2EOXA 3MHSC 2WBSA 1A1JA 4R2AA 1G2DC 5KL4A 4F2JC 1TF6A 2CSHA 2EM5A 2EM8A 2EP3A 2EOSA 4R2QA 2EOJA 4F6MA 2YSPA 1TN9A 2DRPA 4R2DA 2YSOA 2YRMA 2YRHA 1X6FA 2E72A 4R2PA 2YTGA 5KL7A 3EPLA 1DGCA 1YSAC 2CTDA 2YTQA 2EMFA 1JK1A 1P47A 1A1IA 2YTEA 2EN6A 5KL3A 4R2CA 2EN7A 2YRKA 2EN8A 2EMIA 2EMXA 2YTJA 4M9VC 2EM9A 1X6EA 2EOZA 2EOQA 1AAYA 2YTDA 2WBTA 2EMHA 3EPHA 2MDGA 2EMLA 4R2SA 2EJ4A 2EOMA 2EPCA 2D9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCS A;  3MHH C;  1G2F C;  4GZN C;  2DLK A;  2HGH A;  2ENH A;  2EN3 A;  2ENC A;  1ZU1 A;  2DGC A;  3EPK A;  2VRD A;  4X9J A;  1Z1B A;  2EPR A;  1KJK A;  1UBD C;  2NAB A;  2EM6 A;  2EM7 A;  4WSG A;  2ELZ A;  1A1L A;  2EMB A;  2ENA A;  2LO3 A;  1MEY C;  2MKN A;  1A1F A;  1WJP A;  2EMY A;  1X6H A;  2EL5 A;  3VHT B;  2J7J A;  3M99 B;  4R2E A;  2LT7 A;  2EOH A;  2YTF A;  2RSI A;  2EMK A;  2DLQ A;  2EMZ A;  2YTN A;  2BB8 A;  2ELY A;  2MKD A;  2EL4 A;  2EM3 A;  4FK5 C;  2EPP A;  1A1K A;  2EMA A;  2EPA A;  1LLM C;  2DMI A;  1A1G A;  1BBO A;  1UN6 B;  2GHF A;  5KL2 A;  2WBU A;  2EPX A;  2LV2 A;  1ZR9 A;  2YTI A;  5KL6 A;  1TF3 A;  2M9A A;  1X5W A;  2ADR A;  2EQ1 A;  1A1H A;  2EOE A;  2EOY A;  2LVH A;  4F6N A;  2YU8 A;  2I13 A;  2JPA A;  2EM2 A;  2YTO A;  2A25 A;  2EL6 A;  2GLI A;  2EQ3 A;  2EMW A;  1JK2 A;  1ZAA C;  1F2I G;  2EMC A;  2EN2 A;  3UK3 C;  2EPU A;  2LCE A;  2WCC 3;  4IS1 C;  4R2R A;  4IJD A;  2RPC A;  2R1F A;  5KL5 A;  3EPJ A;  2EQ0 A;  2EN4 A;  1BB8 A;  1YUJ A;  2EM4 A;  2EOR A;  2YU5 A;  2PRT A;  1YUI A;  2YTP A;  1X3C A;  2EM0 A;  2EOI A;  2EOF A;  2JP9 A;  2EN1 A;  2CT1 A;  1B69 A;  2EE8 A;  1RMD A;  2EPZ A;  2EOO A;  2EMG A;  2EOX A;  3MHS C;  2WBS A;  1A1J A;  4R2A A;  1G2D C;  5KL4 A;  4F2J C;  1TF6 A;  2CSH A;  2EM5 A;  2EM8 A;  2EP3 A;  2EOS A;  4R2Q A;  2EOJ A;  4F6M A;  2YSP A;  1TN9 A;  2DRP A;  4R2D A;  2YSO A;  2YRM A;  2YRH A;  1X6F A;  2E72 A;  4R2P A;  2YTG A;  5KL7 A;  3EPL A;  1DGC A;  1YSA C;  2CTD A;  2YTQ A;  2EMF A;  1JK1 A;  1P47 A;  1A1I A;  2YTE A;  2EN6 A;  5KL3 A;  4R2C A;  2EN7 A;  2YRK A;  2EN8 A;  2EMI A;  2EMX A;  2YTJ A;  4M9V C;  2EM9 A;  1X6E A;  2EOZ A;  2EOQ A;  1AAY A;  2YTD A;  2WBT A;  2EMH A;  3EPH A;  2MDG A;  2EML A;  4R2S A;  2EJ4 A;  2EOM A;  2EPC A;  2D9H A; 
#chains in the Genus database with same CATH topology
 2UUB E;  1UHZ A;  1G2F C;  3VK6 A;  4LF4 E;  2EPO A;  2HGH A;  4J8Z A;  2ENC A;  2ODR D;  4ZYD A;  3LML A;  3EPK A;  2VRD A;  5AC4 A;  2KON A;  3BBG A;  4WSG A;  2BBG A;  2ELZ A;  2NUE A;  2EMB A;  1A1F A;  2M1S A;  2EL5 A;  2J7J A;  3M99 B;  3KZZ A;  2EPK X;  1SFE A;  2YTF A;  4DKK A;  1IQO A;  4P7D A;  2EPM X;  1PJT A;  2YTN A;  2JOB A;  4BS9 A;  2EM3 A;  4DV2 E;  3ECR A;  2UXD E;  4FK5 C;  4DR1 E;  4LU9 A;  2G7H A;  2EMA A;  2EPA A;  4KHP E;  2B9D A;  2V88 A;  3K6Q A;  2DMI A;  4WXC A;  1DQ3 A;  4BMJ A;  2EPL X;  3THN A;  2ODR C;  2DB2 A;  4LF9 E;  1BBO A;  4DR6 E;  1IBK E;  2WBU A;  2LV2 A;  4GKK E;  2V85 A;  5KL6 A;  2M9A A;  4RH8 A;  3T1H E;  4M2Z A;  1A1H A;  1I94 E;  2KHX A;  5A69 A;  4F54 A;  2EM2 A;  4B3M E;  5AE2 A;  2EQ3 A;  2EMW A;  1ZAA C;  4JI3 E;  1AH5 A;  5A6B A;  2N3G A;  1L4S A;  4MLQ A;  4MLV A;  3EPJ A;  2YZT A;  1YUJ A;  2EM4 A;  2YTP A;  1X3C A;  2EOI A;  4HEI A;  3J81 C;  2NUG A;  1J26 A;  2EE8 A;  2EPZ A;  1ZBQ A;  5AE1 A;  4LF7 E;  4DUY E;  3OTO E;  1G2D C;  4KZS A;  4DV7 E;  4LFA E;  1T38 A;  5CFF E;  1EH6 A;  2DRP A;  1YZ9 A;  4R2D A;  2EWL A;  2YRM A;  2YRH A;  4YY3 E;  4X8W A;  1IBM E;  2LE2 A;  1YSA C;  2YTQ A;  3C4B A;  2UUA E;  3F6G A;  2EN6 A;  5KL3 A;  2RQL A;  4R2C A;  4L8N A;  2EMX A;  2EPN A;  2FV4 B;  4BHB A;  3L00 A;  1WXR A;  5A6J A;  1QNT A;  3J80 C;  2EOQ A;  2YTD A;  3HPZ A;  5AAS A;  2LUQ A;  2WBT A;  3BGH A;  2V87 A;  4R2S A;  2EOM A;  2VF1 A;  2D9H A;  2RSM A;  2V8Q B;  3MHH C;  5AC5 A;  5LLQ A;  2EN3 A;  2L8T A;  2DGC A;  3AUZ A;  2F8B A;  2HC5 A;  1UBD C;  4TUG A;  1BBG A;  2EM7 A;  1MEY C;  2V83 A;  2JVA A;  2MKN A;  2LMZ A;  1WHQ A;  4BC7 A;  2N3H A;  1KYQ A;  4DR3 E;  2NUF A;  3VHT B;  2MC6 A;  4R2E A;  5DNY A;  3C4T A;  2EMK A;  2DLQ A;  2JWO A;  2BB8 A;  4OX9 E;  4L5N C;  1A1K A;  5BR8 E;  1T39 A;  3ADI A;  5LL6 R;  5AE3 A;  2GHF A;  5F3W A;  2EPX A;  1YYO A;  4DR7 E;  1TF3 A;  2EZ6 A;  2LJU A;  3JAM C;  3DF6 A;  4GEQ B;  2EQ1 A;  1HNW E;  4JI1 E;  2EOE A;  2JY9 A;  2I13 A;  4NXN E;  2DMY A;  1DI2 A;  2A25 A;  4BBY A;  4JI0 E;  2VQE E;  1JK2 A;  3VYX A;  1EH7 A;  4M0V A;  1F2I G;  2E1M A;  3ZOQ B;  4ZYE A;  4IS1 C;  2LTR A;  4IJD A;  1N32 E;  2DSY A;  2R1F A;  2EQ0 A;  2UXB E;  2EN4 A;  2YPN A;  2YU5 A;  1YUI A;  2EM0 A;  2EOF A;  2EN1 A;  2CT1 A;  2JOX A;  1B69 A;  5LMU E;  4Q28 A;  4WPY A;  4DV5 E;  2VE7 C;  4DV0 E;  1WHN A;  3JU0 A;  5KL4 A;  1TF6 A;  2EM8 A;  4F9C B;  2EP3 A;  3F6H A;  2EOS A;  4GKJ E;  2YSP A;  3P1X A;  2L33 A;  3KZY A;  1IQS A;  4I8O A;  4DR5 E;  4TUI A;  2B7T A;  5KL7 A;  2CTD A;  2EMF A;  1YPN A;  1P47 A;  1A1I A;  4R8O A;  3TQM A;  4B3R E;  2EN8 A;  1FJG E;  2E5L E;  2EMI A;  4M9V C;  1O0W A;  1SR9 A;  1EH8 A;  2DIX A;  1AAY A;  2UUC E;  4DR2 E;  1WRJ A;  3IWB A;  4JYA E;  1X6F A;  5LMN E;  2YWQ A;  4JI6 E;  3ADG A;  4WSP A;  1NCS A;  1GZ6 A;  2DLK A;  4P78 A;  1ZU1 A;  2HJJ A;  5T6J A;  3HTX A;  1J5E E;  2EPR A;  1KJK A;  1PJS A;  1YYW A;  1A1L A;  2LO3 A;  1XNQ E;  4NXM E;  1X6H A;  4M30 A;  4JI4 E;  3J7Y p;  4BCA A;  2HHH E;  2ELY A;  2EL4 A;  4ZYG A;  2N8X A;  4LFB E;  4WX9 A;  2I9I A;  2L3J A;  1A1G A;  3ADL A;  3EQ1 A;  4DMI A;  2YT4 A;  2GPI A;  5KL2 A;  1UN6 B;  4X65 E;  5A6K A;  5IT9 C;  1NEI A;  2YTI A;  4WXD A;  1X5W A;  2LBS B;  2MC5 A;  2EOY A;  2LVH A;  4F6N A;  2JPA A;  1EKZ A;  1X49 A;  2EMC A;  3UK3 C;  2EPU A;  2LCE A;  2K4V A;  4R2R A;  1PJQ A;  3BF2 A;  1UIL A;  1BB8 A;  4BHC A;  3C6K A;  3MSW A;  2UU9 E;  4ZYH A;  2MDR A;  2JP9 A;  4HTG A;  1X48 A;  1RMD A;  2EOO A;  1A1J A;  1MGT A;  3HQ1 A;  2WBS A;  3VYY A;  4R2A A;  1YYK A;  4F2J C;  2LUP B;  2UXC E;  4R2Q A;  2EOJ A;  2B3T B;  4O5G A;  1FKA E;  2LRS A;  2WZO A;  2M4I A;  2E72 A;  4RHB B;  4DV6 E;  4K0K E;  1JK1 A;  2CPN A;  2ZM6 E;  4O43 A;  2YTE A;  3C6M A;  2RTX A;  2EN7 A;  2H36 X;  4B3T E;  4LTY A;  5ADZ A;  2KOU A;  2LTS A;  1XMQ E;  2M7Q A;  2EOZ A;  1T4N A;  3DJW A;  5A2Q C;  3BID A;  2EMH A;  3EPH A;  2MDG A;  1PKP A;  2EJ4 A;  3THO B;  1N36 E;  2JYA A;  2RS6 A;  1GQE A;  4GZN C;  4WFT A;  4O4K A;  2ENH A;  1HNZ E;  4NHR A;  4X62 E;  1Z1B A;  4X9J A;  3H09 A;  2NAB A;  2EM6 A;  5A6A A;  2ENA A;  2IHR 1;  1XNR E;  1WJP A;  2EMY A;  4O24 A;  5IXM B;  1N3G A;  3OML A;  2LT7 A;  2EOH A;  2LJH A;  3JTZ A;  4F9A B;  2FGG A;  2L2M A;  2RSI A;  2L2K B;  2EMZ A;  2MKD A;  2K7I A;  2B7V A;  2V89 A;  3LLH A;  2EPP A;  2L3C A;  4X64 E;  2Q8U A;  4DV4 E;  2V86 A;  1LLM C;  1PDA A;  1HR0 E;  2L92 A;  4LF8 E;  1ZR9 A;  1N33 E;  2ADR A;  4Q35 B;  2F4V E;  1GTK A;  3AV0 A;  1T4L B;  1ZBT A;  4DV1 E;  2YU8 A;  4JI7 E;  2YTO A;  2VQF E;  4YHH E;  2EL6 A;  2GLI A;  4DR4 E;  4KWY A;  1IBL E;  1RC7 A;  2EN2 A;  2WCC 3;  2JR1 A;  4OOG C;  2RPC A;  5KL5 A;  3HPS A;  4X66 E;  1T4O A;  4N4R B;  2EOR A;  1XMO E;  2PRT A;  5A6B D;  4DUZ E;  4JV5 E;  3QG5 C;  3T1Y E;  1IMU A;  4AQY E;  2NA2 A;  1N34 E;  3J7A G;  3ADJ A;  3HXL A;  2L2N A;  4JI5 E;  4WYQ B;  1X47 A;  5IV8 B;  2RS7 A;  1RQ0 A;  2EOX A;  2EMG A;  2JXP A;  3MHS C;  1STU A;  2CSH A;  2EM5 A;  4F6M A;  4DV3 E;  1TN9 A;  3IWC A;  4F9B B;  5FLX C;  2YSO A;  4JI2 E;  3FIG A;  3IWD A;  4BC9 A;  2R76 A;  1YFH A;  4R03 A;  4R2P A;  2YTG A;  1QU6 A;  3EPL A;  1DGC A;  3RMP A;  4B3S E;  4JI8 E;  2FTX B;  4LFC E;  2YRK A;  2YTJ A;  2EM9 A;  1HNX E;  5IWA E;  1X6E A;  3KWR A;  5TSE A;  2EML A;  4NZV A;  4LF5 E;  2L6M A;  4LF6 E;  2EPC A; 
#chains in the Genus database with same CATH homology
 1NCS A;  3MHH C;  1G2F C;  4GZN C;  2DLK A;  2HGH A;  2ENH A;  2EN3 A;  2ENC A;  1ZU1 A;  2DGC A;  3EPK A;  2VRD A;  4X9J A;  1Z1B A;  2EPR A;  1KJK A;  1UBD C;  2NAB A;  2EM6 A;  2EM7 A;  4WSG A;  2ELZ A;  1A1L A;  2EMB A;  2ENA A;  2LO3 A;  1MEY C;  2MKN A;  1A1F A;  1WJP A;  2EMY A;  1X6H A;  2EL5 A;  3VHT B;  2J7J A;  3M99 B;  4R2E A;  2LT7 A;  2EOH A;  2YTF A;  2RSI A;  2EMK A;  2DLQ A;  2EMZ A;  2YTN A;  2BB8 A;  2ELY A;  2MKD A;  2EL4 A;  2EM3 A;  4FK5 C;  2EPP A;  1A1K A;  2EMA A;  2EPA A;  1LLM C;  2DMI A;  1A1G A;  1BBO A;  1UN6 B;  2GHF A;  5KL2 A;  2WBU A;  2EPX A;  2LV2 A;  1ZR9 A;  2YTI A;  5KL6 A;  1TF3 A;  2M9A A;  1X5W A;  2ADR A;  2EQ1 A;  1A1H A;  2EOE A;  2EOY A;  2LVH A;  4F6N A;  2YU8 A;  2I13 A;  2JPA A;  2EM2 A;  2YTO A;  2A25 A;  2EL6 A;  2GLI A;  2EQ3 A;  2EMW A;  1JK2 A;  1ZAA C;  1F2I G;  2EMC A;  2EN2 A;  3UK3 C;  2EPU A;  2LCE A;  2WCC 3;  4IS1 C;  4R2R A;  4IJD A;  2RPC A;  2R1F A;  5KL5 A;  3EPJ A;  2EQ0 A;  2EN4 A;  1BB8 A;  1YUJ A;  2EM4 A;  2EOR A;  2YU5 A;  2PRT A;  1YUI A;  2YTP A;  1X3C A;  2EM0 A;  2EOI A;  2EOF A;  2JP9 A;  2EN1 A;  2CT1 A;  1B69 A;  2EE8 A;  1RMD A;  2EPZ A;  2EOO A;  2EMG A;  2EOX A;  3MHS C;  2WBS A;  1A1J A;  4R2A A;  1G2D C;  5KL4 A;  4F2J C;  1TF6 A;  2CSH A;  2EM5 A;  2EM8 A;  2EP3 A;  2EOS A;  4R2Q A;  2EOJ A;  4F6M A;  2YSP A;  1TN9 A;  2DRP A;  4R2D A;  2YSO A;  2YRM A;  2YRH A;  1X6F A;  2E72 A;  4R2P A;  2YTG A;  5KL7 A;  3EPL A;  1DGC A;  1YSA C;  2CTD A;  2YTQ A;  2EMF A;  1JK1 A;  1P47 A;  1A1I A;  2YTE A;  2EN6 A;  5KL3 A;  4R2C A;  2EN7 A;  2YRK A;  2EN8 A;  2EMI A;  2EMX A;  2YTJ A;  4M9V C;  2EM9 A;  1X6E A;  2EOZ A;  2EOQ A;  1AAY A;  2YTD A;  2WBT A;  2EMH A;  3EPH A;  2MDG A;  2EML A;  4R2S A;  2EJ4 A;  2EOM A;  2EPC A;  2D9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...