3VYYA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase a (dhx9)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase A
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyyA00
2UUBE 4JI4E 2DB2A 4YY3E 2UXBE 1HR0E 1UILA 2VQEE 1DI2A 2RS7A 4OX9E 4X62E 4WYQB 3VYYA 1X48A 1X47A 4LF4E 2F4VE 4LFAE 1N34E 4DV5E 4JI6E 4DR3E 2LBSB 4LF7E 2IHR1 1T4LB 4GKKE 1YYKA 2N3HA 3J7Yp 4B3SE 1EKZA 2B3TB 1HNZE 4DV1E 2VQFE 4DUZE 1YYOA 4DV3E 4LFBE 2NUGA 4LF9E 1J5EE 1T4NA 1FJGE 2UXDE 4X8WA 4X65E 1YYWA 1J26A 2LUPB 3OTOE 2LRSA 4B3TE 4JI2E 2RTXA 4LFCE 1IBKE 1XNQE 1XMOE 2EZ6A 1UHZA 4JI3E 4NXME 1YZ9A 1PKPA 5LMUE 4JI0E 4K0KE 4DV7E 1RQ0A 2UXCE 2B7TA 2E5LE 1N33E 3ADJA 4DV0E 4AQYE 2L2MA 2UUAE 1XMQE 2LTRA 4DR4E 2LTSA 1STUA 4X64E 2HHHE 2UUCE 3HTXA 4JYAE 1O0WA 5IWAE 4OOGC 4M2ZA 4DKKA 3LLHA 4DR2E 4B3ME 2NUEA 2ZM6E 3T1HE 1XNRE 4JI1E 1X49A 1ZBTA 1WHQA 4WFTA 1IBLE 4DUYE 4JV5E 3ADIA 1I94E 2UU9E 4JI8E 4JI5E 1HNXE 4NXNE 1T4OA 3VYXA 2YT4A 2RSMA 3P1XA 1N32E 5LMNE 2DIXA 1IBME 5BR8E 2L2KB 3C4BA 4DV4E 4GKJE 1HNWE 2DMYA 2LJHA 4DV2E 2MDRA 4LF6E 4DR5E 2L3JA 2NA2A 4LF8E 4JI7E 1GQEA 2CPNA 2LUQA 3C4TA 4M30A 2JVAA 4B3RE 4KHPE 2L2NA 3ADGA 4X66E 2L3CA 2N3GA 4DR7E 4LF5E 3T1YE 4DV6E 2KHXA 1RC7A 2JY9A 4YHHE 2RS6A 1FKAE 2L33A 4DR1E 2B7VA 1WHNA 2NUFA 3ADLA 5CFFE 1N36E 4DR6E 1QU6A
chains in the Genus database with same CATH superfamily
3C6KA 2JOXA 2DB2A 2GHFA 1HR0E 1DI2A 3H09A 4OX9E 2WBUA 3EPKA 4N4RB 2F8BA 1X47A 3HQ1A 2EMFA 2F4VE 2ADRA 4LFAE 2YTFA 1NEIA 3VHTB 4O5GA 4JI6E 2R1FA 3OMLA 4DR3E 2ENHA 5A6BA 2LO3A 2LBSB 4LF7E 3BBGA 2IHR1 1T4LB 4GKKE 4WSPA 4F9AB 2EPMX 4ZYGA 1WXRA 1LLMC 1EKZA 2GLIA 2B3TB 4WPYA 5IV8B 4DUZE 3C6MA 2NUGA 2HC5A 2EQ3A 1T4NA 2E72A 4X65E 1UBDC 2LUPB 4TUGA 1X6EA 4JI2E 2LT7A 2DRPA 2K7IA 1PJSA 4LFCE 4WX9A 4NZVA 2EPNA 2EMIA 1XMOE 1T38A 1UHZA 3LMLA 1EH8A 5KL2A 2EMGA 1QNTA 1RQ0A 2YTDA 4KWYA 4L5NC 2B7TA 4R8OA 3EPJA 2FV4B 2EP3A 4DV0E 2YSPA 4AQYE 1A1IA 1XMQE 2EPUA 4IJDA 4DR4E 1G2DC 2YTEA 4BHBA 2CTDA 2KOUA 2HHHE 2WZOA 4HEIA 3HTXA 4JYAE 2M7QA 5IWAE 2VE7C 4LTYA 5A6KA 2YRMA 4R2RA 2DLKA 1A1GA 4DR2E 4B3ME 4O43A 3T1HE 1ZBTA 2GPIA 4WFTA 4BBYA 1A1FA 4BHCA 3L00A 1GZ6A 3UK3C 4ZYEA 5AC4A 4O24A 4JI8E 4JI5E 1HNXE 2EM6A 2WBSA 1N32E 5LMNE 5A6JA 2LVHA 2L2KB 4F6MA 1SFEA 4DV4E 4DV2E 2LMZA 4LF6E 3JU0A 3HPSA 1IMUA 2EPOA 1GQEA 3C4TA 5A6AA 4Q28A 2ELYA 2EN4A 1DQ3A 4FK5C 2KONA 5AE3A 1RC7A 2L33A 4DR1E 1WHNA 4BMJA 2EN7A 1ZU1A 2MC6A 4DR6E 4KZSA 4YY3E 2UXBE 2LV2A 3KZYA 3J80C 4X62E 4MLQA 2EOMA 4R2EA 5KL6A 1EH6A 2EOXA 4ZYDA 4R2PA 1X5WA 2EPZA 2JYAA 1PJTA 3HXLA 4Q35B 3THOB 2EPKX 2EMXA 2EPPA 2EMWA 2EM0A 4ZYHA 3J7Yp 2DLQA 1MEYC 2LE2A 2JOBA 1YYOA 4R03A 4DV3E 4MLVA 4LFBE 2YU8A 5ADZA 2EE8A 2YRHA 5KL4A 1YYWA 4WXCA 4B3TE 1L4SA 2D9HA 2RTXA 2B9DA 1DGCA 2I13A 1XNQE 2YTPA 1ZR9A 5F3WA 4GEQB 4JI3E 5AC5A 2V83A 5LMUE 2EM5A 2L92A 2V89A 2EQ1A 4M9VC 2L2MA 2EM2A 2UUAE 2LTRA 1TN9A 2UUCE 1BBOA 1JK1A 2JXPA 4OOGC 3TQMA 4M2ZA 2EL4A 3MHHC 3F6HA 2RPCA 2RQLA 1MGTA 2VRDA 3ZOQB 5KL5A 4DUYE 1IQSA 1I94E 2UU9E 1T4OA 2EOFA 4HTGA 2RSMA 3P1XA 2DIXA 5BR8E 2EPXA 4F54A 4GKJE 2ELZA 2MDRA 2M1SA 2EOOA 4R2SA 3J7AG 2CPNA 5KL3A 3HPZA 1BBGA 1X6FA 1YPNA 5IT9C 2JVAA 4KHPE 1ZBQA 4X66E 2N3GA 4DR7E 2RSIA 2EMBA 4DV6E 2KHXA 3MHSC 3F6GA 2JY9A 2RS6A 1FKAE 2EMHA 2PRTA 5CFFE 3KZZA 4R2AA 2WCC3 4P78A 1YSAC 1UILA 2H36X 2LJUA 2YTIA 5FLXC 2WBTA 4WYQB 4F2JC 3VYYA 1B69A 2JPAA 4F9BB 4LF4E 1F2IG 1N34E 2J7JA 5TSEA 2G7HA 2MDGA 3K6QA 3VK6A 1YYKA 2DGCA 3MSWA 2EN1A 2YTNA 4O4KA 4DV1E 4LF9E 2YPNA 4BS9A 3IWDA 2EOYA 2EOIA 1J26A 2A25A 3AV0A 2YSOA 3FIGA 1T39A 3BGHA 3AUZA 1IBKE 2ODRD 2EZ6A 2CSHA 4NXME 5KL7A 2L6MA 2EMAA 4K0KE 3BF2A 2EL6A 2ENCA 4DV7E 2UXCE 1N33E 3ADJA 2BBGA 2V88A 2ODRC 1KJKA 4NHRA 4P7DA 3DF6A 4X9JA 4RHBB 4J8ZA 1AAYA 1A1KA 5AE2A 2NUEA 1XNRE 1X49A 1IBLE 1WHQA 2JP9A 1SR9A 2V85A 1BB8A 2JWOA 3JAMC 2EPLX 4NXNE 1N3GA 2EMCA 1EH7A 3C4BA 2DMYA 2LJHA 1WJPA 2M9AA 2EM8A 1YFHA 2NA2A 4LF8E 2YWQA 5AASA 4JI7E 2EN3A 2E1MA 1IQOA 4M30A 2DSYA 2L2NA 4LF5E 2FTXB 2YTJA 4YHHE 3RMPA 4WSGA 4F9CB 4R2CA 2EOZA 1A1LA 3KWRA 2UUBE 3EPHA 5A69A 2M4IA 2YTQA 4JI4E 2EN8A 2VQEE 2MKDA 2RS7A 5IXMB 2EWLA 2JR1A 3J81C 3BIDA 1YUJA 2I9IA 1X48A 2EOEA 3THNA 5DNYA 2EN2A 4GZNC 1KYQA 1GTKA 2EPRA 2EMLA 2EQ0A 4DV5E 4R2DA 2YZTA 3IWCA 4I8OA 1PJQA 2YRKA 1RMDA 1X6HA 2EPCA 4WXDA 2L8TA 3EQ1A 4F6NA 2N3HA 4B3SE 2EMZA 2EORA 1HNZE 2VQFE 2HJJA 1J5EE 1FJGE 1G2FC 2UXDE 4X8WA 5LL6R 3OTOE 2EM4A 2LRSA 2EOHA 4DMIA 2NABA 2EMKA 1TF6A 1YUIA 5T6JA 2LCEA 1YZ9A 1PKPA 4BC7A 2EMYA 4JI0E 2Q8UA 3EPLA 5A2QC 2EOJA 2EOSA 1AH5A 2FGGA 4M0VA 2E5LE 1P47A 4RH8A 3IWBA 1WRJA 2LTSA 1UN6B 1STUA 4X64E 5A6BD 4BCAA 1O0WA 2YTGA 2ENAA 4TUIA 4DKKA 2MC5A 1JK2A 2EN6A 3LLHA 1X3CA 2ZM6E 4JI1E 2CT1A 2EPAA 2YU5A 2N8XA 4IS1C 4JV5E 3ADIA 2DMIA 1PDAA 4LU9A 1A1JA 1A1HA 2BB8A 2EOQA 2EM9A 2YT4A 3VYXA 2EM7A 1IBME 2MKNA 3ECRA 2HGHA 2V87A 4R2QA 1HNWE 4BC9A 5AE1A 2K4VA 1NCSA 4DR5E 3M99B 2EM3A 2L3JA 2LUQA 2V8QB 2EL5A 2YTOA 4B3RE 3ADGA 2L3CA 3DJWA 3T1YE 3QG5C 1TF3A 5LLQA 4L8NA 2VF1A 3JTZA 2B7VA 2EJ4A 1ZAAC 2NUFA 3ADLA 2V86A 1N36E 2R76A 1Z1BA 1QU6A
chains in the Genus database with same CATH topology
2UUBE 4KZSA 4P78A 2JOXA 2DB2A 2M4IA 4YY3E 4JI4E 1HR0E 1UILA 2H36X 2VQEE 5FLXC 1DI2A 2RS7A 2UXBE 3H09A 4OX9E 2EWLA 2JR1A 3J81C 3J80C 4X62E 4WYQB 3VYYA 1X48A 2F8BA 4F9BB 1X47A 4LF4E 5DNYA 3HQ1A 2F4VE 4LFAE 1N34E 4DV5E 4JI6E 3OMLA 2YZTA 4DR3E 2LBSB 2G7HA 4LF7E 3IWCA 4I8OA 2IHR1 3K6QA 3VK6A 3HXLA 1T4LB 2L8TA 4GKKE 1YYKA 4WSPA 2N3HA 4F9AB 1WXRA 3J7Yp 4B3SE 3MSWA 1EKZA 2LE2A 2B3TB 4WPYA 2JOBA 2VQFE 4DUZE 4R03A 4DV1E 4DV3E 1YYOA 1HNZE 4LFBE 2NUGA 4LF9E 5ADZA 1J5EE 1T4NA 1FJGE 4BS9A 3IWDA 2UXDE 4X8WA 4X65E 1YYWA 1J26A 2LUPB 5LL6R 3OTOE 4TUGA 2LRSA 3AV0A 4B3TE 4JI2E 2RTXA 3FIGA 2B9DA 4LFCE 3AUZA 1IBKE 4DMIA 1XNQE 5F3WA 1XMOE 2ODRD 4GEQB 5T6JA 1UHZA 2EZ6A 4JI3E 4NXME 3LMLA 1YZ9A 1PKPA 4BC7A 2V83A 5LMUE 2L6MA 4JI0E 4K0KE 5A2QC 2L92A 4DV7E 2FGGA 1RQ0A 2V89A 4L5NC 4M0VA 2UXCE 2B7TA 4R8OA 2FV4B 2E5LE 1N33E 3ADJA 4DV0E 4AQYE 2V88A 2L2MA 2ODRC 3IWBA 2UUAE 1XMQE 2LTRA 4DR4E 4P7DA 2LTSA 1STUA 3DF6A 2KOUA 4X64E 2HHHE 2WZOA 2UUCE 3HTXA 4JYAE 2M7QA 4BCAA 1O0WA 5IWAE 2VE7C 4LTYA 4J8ZA 4OOGC 4TUIA 4M2ZA 4DKKA 2MC5A 3LLHA 5AE2A 4DR2E 4B3ME 2NUEA 2ZM6E 3T1HE 1XNRE 4JI1E 1X49A 1ZBTA 1WHQA 4WFTA 3ZOQB 3F6HA 4BBYA 1IBLE 4DUYE 1SR9A 4JV5E 2V85A 3ADIA 1GZ6A 2JWOA 3JAMC 1I94E 2UU9E 4JI8E 4LU9A 1HNXE 4JI5E 1T4OA 4NXNE 3VYXA 2YT4A 2RSMA 3P1XA 1N32E 5LMNE 2DIXA 1IBME 5BR8E 2L2KB 2V87A 4F54A 3C4BA 4DV4E 4GKJE 1HNWE 2DMYA 4BC9A 2LJHA 2K4VA 5AE1A 4DV2E 2MDRA 2M1SA 2LMZA 4LF6E 4DR5E 3JU0A 3HPSA 2L3JA 2NA2A 4LF8E 5AASA 3J7AG 4JI7E 1GQEA 2CPNA 2LUQA 2V8QB 3C4TA 2E1MA 3HPZA 4Q28A 4M30A 5IT9C 1DQ3A 2DSYA 2JVAA 4B3RE 4KHPE 2L2NA 1ZBQA 3ADGA 4X66E 2L3CA 2N3GA 4DR7E 4LF5E 3DJWA 3T1YE 2FTXB 4DV6E 2KONA 2KHXA 4L8NA 3F6GA 2JY9A 5AE3A 2RS6A 4YHHE 3RMPA 1RC7A 2L33A 2VF1A 3JTZA 2B7VA 4DR1E 1FKAE 1WHNA 4BMJA 4F9CB 2MC6A 2NUFA 5CFFE 2V86A 1N36E 3ADLA 4DR6E 3KWRA 1QU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB E;  4JI4 E;  2DB2 A;  4YY3 E;  2UXB E;  1HR0 E;  1UIL A;  2VQE E;  1DI2 A;  2RS7 A;  4OX9 E;  4X62 E;  4WYQ B;  3VYY A;  1X48 A;  1X47 A;  4LF4 E;  2F4V E;  4LFA E;  1N34 E;  4DV5 E;  4JI6 E;  4DR3 E;  2LBS B;  4LF7 E;  2IHR 1;  1T4L B;  4GKK E;  1YYK A;  2N3H A;  3J7Y p;  4B3S E;  1EKZ A;  2B3T B;  1HNZ E;  4DV1 E;  2VQF E;  4DUZ E;  1YYO A;  4DV3 E;  4LFB E;  2NUG A;  4LF9 E;  1J5E E;  1T4N A;  1FJG E;  2UXD E;  4X8W A;  4X65 E;  1YYW A;  1J26 A;  2LUP B;  3OTO E;  2LRS A;  4B3T E;  4JI2 E;  2RTX A;  4LFC E;  1IBK E;  1XNQ E;  1XMO E;  2EZ6 A;  1UHZ A;  4JI3 E;  4NXM E;  1YZ9 A;  1PKP A;  5LMU E;  4JI0 E;  4K0K E;  4DV7 E;  1RQ0 A;  2UXC E;  2B7T A;  2E5L E;  1N33 E;  3ADJ A;  4DV0 E;  4AQY E;  2L2M A;  2UUA E;  1XMQ E;  2LTR A;  4DR4 E;  2LTS A;  1STU A;  4X64 E;  2HHH E;  2UUC E;  3HTX A;  4JYA E;  1O0W A;  5IWA E;  4OOG C;  4M2Z A;  4DKK A;  3LLH A;  4DR2 E;  4B3M E;  2NUE A;  2ZM6 E;  3T1H E;  1XNR E;  4JI1 E;  1X49 A;  1ZBT A;  1WHQ A;  4WFT A;  1IBL E;  4DUY E;  4JV5 E;  3ADI A;  1I94 E;  2UU9 E;  4JI8 E;  4JI5 E;  1HNX E;  4NXN E;  1T4O A;  3VYX A;  2YT4 A;  2RSM A;  3P1X A;  1N32 E;  5LMN E;  2DIX A;  1IBM E;  5BR8 E;  2L2K B;  3C4B A;  4DV4 E;  4GKJ E;  1HNW E;  2DMY A;  2LJH A;  4DV2 E;  2MDR A;  4LF6 E;  4DR5 E;  2L3J A;  2NA2 A;  4LF8 E;  4JI7 E;  1GQE A;  2CPN A;  2LUQ A;  3C4T A;  4M30 A;  2JVA A;  4B3R E;  4KHP E;  2L2N A;  3ADG A;  4X66 E;  2L3C A;  2N3G A;  4DR7 E;  4LF5 E;  3T1Y E;  4DV6 E;  2KHX A;  1RC7 A;  2JY9 A;  4YHH E;  2RS6 A;  1FKA E;  2L33 A;  4DR1 E;  2B7V A;  1WHN A;  2NUF A;  3ADL A;  5CFF E;  1N36 E;  4DR6 E;  1QU6 A; 
#chains in the Genus database with same CATH topology
 3C6K A;  2JOX A;  2DB2 A;  2GHF A;  1HR0 E;  1DI2 A;  3H09 A;  4OX9 E;  2WBU A;  3EPK A;  4N4R B;  2F8B A;  1X47 A;  3HQ1 A;  2EMF A;  2F4V E;  2ADR A;  4LFA E;  2YTF A;  1NEI A;  3VHT B;  4O5G A;  4JI6 E;  2R1F A;  3OML A;  4DR3 E;  2ENH A;  5A6B A;  2LO3 A;  2LBS B;  4LF7 E;  3BBG A;  2IHR 1;  1T4L B;  4GKK E;  4WSP A;  4F9A B;  2EPM X;  4ZYG A;  1WXR A;  1LLM C;  1EKZ A;  2GLI A;  2B3T B;  4WPY A;  5IV8 B;  4DUZ E;  3C6M A;  2NUG A;  2HC5 A;  2EQ3 A;  1T4N A;  2E72 A;  4X65 E;  1UBD C;  2LUP B;  4TUG A;  1X6E A;  4JI2 E;  2LT7 A;  2DRP A;  2K7I A;  1PJS A;  4LFC E;  4WX9 A;  4NZV A;  2EPN A;  2EMI A;  1XMO E;  1T38 A;  1UHZ A;  3LML A;  1EH8 A;  5KL2 A;  2EMG A;  1QNT A;  1RQ0 A;  2YTD A;  4KWY A;  4L5N C;  2B7T A;  4R8O A;  3EPJ A;  2FV4 B;  2EP3 A;  4DV0 E;  2YSP A;  4AQY E;  1A1I A;  1XMQ E;  2EPU A;  4IJD A;  4DR4 E;  1G2D C;  2YTE A;  4BHB A;  2CTD A;  2KOU A;  2HHH E;  2WZO A;  4HEI A;  3HTX A;  4JYA E;  2M7Q A;  5IWA E;  2VE7 C;  4LTY A;  5A6K A;  2YRM A;  4R2R A;  2DLK A;  1A1G A;  4DR2 E;  4B3M E;  4O43 A;  3T1H E;  1ZBT A;  2GPI A;  4WFT A;  4BBY A;  1A1F A;  4BHC A;  3L00 A;  1GZ6 A;  3UK3 C;  4ZYE A;  5AC4 A;  4O24 A;  4JI8 E;  4JI5 E;  1HNX E;  2EM6 A;  2WBS A;  1N32 E;  5LMN E;  5A6J A;  2LVH A;  2L2K B;  4F6M A;  1SFE A;  4DV4 E;  4DV2 E;  2LMZ A;  4LF6 E;  3JU0 A;  3HPS A;  1IMU A;  2EPO A;  1GQE A;  3C4T A;  5A6A A;  4Q28 A;  2ELY A;  2EN4 A;  1DQ3 A;  4FK5 C;  2KON A;  5AE3 A;  1RC7 A;  2L33 A;  4DR1 E;  1WHN A;  4BMJ A;  2EN7 A;  1ZU1 A;  2MC6 A;  4DR6 E;  4KZS A;  4YY3 E;  2UXB E;  2LV2 A;  3KZY A;  3J80 C;  4X62 E;  4MLQ A;  2EOM A;  4R2E A;  5KL6 A;  1EH6 A;  2EOX A;  4ZYD A;  4R2P A;  1X5W A;  2EPZ A;  2JYA A;  1PJT A;  3HXL A;  4Q35 B;  3THO B;  2EPK X;  2EMX A;  2EPP A;  2EMW A;  2EM0 A;  4ZYH A;  3J7Y p;  2DLQ A;  1MEY C;  2LE2 A;  2JOB A;  1YYO A;  4R03 A;  4DV3 E;  4MLV A;  4LFB E;  2YU8 A;  5ADZ A;  2EE8 A;  2YRH A;  5KL4 A;  1YYW A;  4WXC A;  4B3T E;  1L4S A;  2D9H A;  2RTX A;  2B9D A;  1DGC A;  2I13 A;  1XNQ E;  2YTP A;  1ZR9 A;  5F3W A;  4GEQ B;  4JI3 E;  5AC5 A;  2V83 A;  5LMU E;  2EM5 A;  2L92 A;  2V89 A;  2EQ1 A;  4M9V C;  2L2M A;  2EM2 A;  2UUA E;  2LTR A;  1TN9 A;  2UUC E;  1BBO A;  1JK1 A;  2JXP A;  4OOG C;  3TQM A;  4M2Z A;  2EL4 A;  3MHH C;  3F6H A;  2RPC A;  2RQL A;  1MGT A;  2VRD A;  3ZOQ B;  5KL5 A;  4DUY E;  1IQS A;  1I94 E;  2UU9 E;  1T4O A;  2EOF A;  4HTG A;  2RSM A;  3P1X A;  2DIX A;  5BR8 E;  2EPX A;  4F54 A;  4GKJ E;  2ELZ A;  2MDR A;  2M1S A;  2EOO A;  4R2S A;  3J7A G;  2CPN A;  5KL3 A;  3HPZ A;  1BBG A;  1X6F A;  1YPN A;  5IT9 C;  2JVA A;  4KHP E;  1ZBQ A;  4X66 E;  2N3G A;  4DR7 E;  2RSI A;  2EMB A;  4DV6 E;  2KHX A;  3MHS C;  3F6G A;  2JY9 A;  2RS6 A;  1FKA E;  2EMH A;  2PRT A;  5CFF E;  3KZZ A;  4R2A A;  2WCC 3;  4P78 A;  1YSA C;  1UIL A;  2H36 X;  2LJU A;  2YTI A;  5FLX C;  2WBT A;  4WYQ B;  4F2J C;  3VYY A;  1B69 A;  2JPA A;  4F9B B;  4LF4 E;  1F2I G;  1N34 E;  2J7J A;  5TSE A;  2G7H A;  2MDG A;  3K6Q A;  3VK6 A;  1YYK A;  2DGC A;  3MSW A;  2EN1 A;  2YTN A;  4O4K A;  4DV1 E;  4LF9 E;  2YPN A;  4BS9 A;  3IWD A;  2EOY A;  2EOI A;  1J26 A;  2A25 A;  3AV0 A;  2YSO A;  3FIG A;  1T39 A;  3BGH A;  3AUZ A;  1IBK E;  2ODR D;  2EZ6 A;  2CSH A;  4NXM E;  5KL7 A;  2L6M A;  2EMA A;  4K0K E;  3BF2 A;  2EL6 A;  2ENC A;  4DV7 E;  2UXC E;  1N33 E;  3ADJ A;  2BBG A;  2V88 A;  2ODR C;  1KJK A;  4NHR A;  4P7D A;  3DF6 A;  4X9J A;  4RHB B;  4J8Z A;  1AAY A;  1A1K A;  5AE2 A;  2NUE A;  1XNR E;  1X49 A;  1IBL E;  1WHQ A;  2JP9 A;  1SR9 A;  2V85 A;  1BB8 A;  2JWO A;  3JAM C;  2EPL X;  4NXN E;  1N3G A;  2EMC A;  1EH7 A;  3C4B A;  2DMY A;  2LJH A;  1WJP A;  2M9A A;  2EM8 A;  1YFH A;  2NA2 A;  4LF8 E;  2YWQ A;  5AAS A;  4JI7 E;  2EN3 A;  2E1M A;  1IQO A;  4M30 A;  2DSY A;  2L2N A;  4LF5 E;  2FTX B;  2YTJ A;  4YHH E;  3RMP A;  4WSG A;  4F9C B;  4R2C A;  2EOZ A;  1A1L A;  3KWR A;  2UUB E;  3EPH A;  5A69 A;  2M4I A;  2YTQ A;  4JI4 E;  2EN8 A;  2VQE E;  2MKD A;  2RS7 A;  5IXM B;  2EWL A;  2JR1 A;  3J81 C;  3BID A;  1YUJ A;  2I9I A;  1X48 A;  2EOE A;  3THN A;  5DNY A;  2EN2 A;  4GZN C;  1KYQ A;  1GTK A;  2EPR A;  2EML A;  2EQ0 A;  4DV5 E;  4R2D A;  2YZT A;  3IWC A;  4I8O A;  1PJQ A;  2YRK A;  1RMD A;  1X6H A;  2EPC A;  4WXD A;  2L8T A;  3EQ1 A;  4F6N A;  2N3H A;  4B3S E;  2EMZ A;  2EOR A;  1HNZ E;  2VQF E;  2HJJ A;  1J5E E;  1FJG E;  1G2F C;  2UXD E;  4X8W A;  5LL6 R;  3OTO E;  2EM4 A;  2LRS A;  2EOH A;  4DMI A;  2NAB A;  2EMK A;  1TF6 A;  1YUI A;  5T6J A;  2LCE A;  1YZ9 A;  1PKP A;  4BC7 A;  2EMY A;  4JI0 E;  2Q8U A;  3EPL A;  5A2Q C;  2EOJ A;  2EOS A;  1AH5 A;  2FGG A;  4M0V A;  2E5L E;  1P47 A;  4RH8 A;  3IWB A;  1WRJ A;  2LTS A;  1UN6 B;  1STU A;  4X64 E;  5A6B D;  4BCA A;  1O0W A;  2YTG A;  2ENA A;  4TUI A;  4DKK A;  2MC5 A;  1JK2 A;  2EN6 A;  3LLH A;  1X3C A;  2ZM6 E;  4JI1 E;  2CT1 A;  2EPA A;  2YU5 A;  2N8X A;  4IS1 C;  4JV5 E;  3ADI A;  2DMI A;  1PDA A;  4LU9 A;  1A1J A;  1A1H A;  2BB8 A;  2EOQ A;  2EM9 A;  2YT4 A;  3VYX A;  2EM7 A;  1IBM E;  2MKN A;  3ECR A;  2HGH A;  2V87 A;  4R2Q A;  1HNW E;  4BC9 A;  5AE1 A;  2K4V A;  1NCS A;  4DR5 E;  3M99 B;  2EM3 A;  2L3J A;  2LUQ A;  2V8Q B;  2EL5 A;  2YTO A;  4B3R E;  3ADG A;  2L3C A;  3DJW A;  3T1Y E;  3QG5 C;  1TF3 A;  5LLQ A;  4L8N A;  2VF1 A;  3JTZ A;  2B7V A;  2EJ4 A;  1ZAA C;  2NUF A;  3ADL A;  2V86 A;  1N36 E;  2R76 A;  1Z1B A;  1QU6 A; 
#chains in the Genus database with same CATH homology
 2UUB E;  4KZS A;  4P78 A;  2JOX A;  2DB2 A;  2M4I A;  4YY3 E;  4JI4 E;  1HR0 E;  1UIL A;  2H36 X;  2VQE E;  5FLX C;  1DI2 A;  2RS7 A;  2UXB E;  3H09 A;  4OX9 E;  2EWL A;  2JR1 A;  3J81 C;  3J80 C;  4X62 E;  4WYQ B;  3VYY A;  1X48 A;  2F8B A;  4F9B B;  1X47 A;  4LF4 E;  5DNY A;  3HQ1 A;  2F4V E;  4LFA E;  1N34 E;  4DV5 E;  4JI6 E;  3OML A;  2YZT A;  4DR3 E;  2LBS B;  2G7H A;  4LF7 E;  3IWC A;  4I8O A;  2IHR 1;  3K6Q A;  3VK6 A;  3HXL A;  1T4L B;  2L8T A;  4GKK E;  1YYK A;  4WSP A;  2N3H A;  4F9A B;  1WXR A;  3J7Y p;  4B3S E;  3MSW A;  1EKZ A;  2LE2 A;  2B3T B;  4WPY A;  2JOB A;  2VQF E;  4DUZ E;  4R03 A;  4DV1 E;  4DV3 E;  1YYO A;  1HNZ E;  4LFB E;  2NUG A;  4LF9 E;  5ADZ A;  1J5E E;  1T4N A;  1FJG E;  4BS9 A;  3IWD A;  2UXD E;  4X8W A;  4X65 E;  1YYW A;  1J26 A;  2LUP B;  5LL6 R;  3OTO E;  4TUG A;  2LRS A;  3AV0 A;  4B3T E;  4JI2 E;  2RTX A;  3FIG A;  2B9D A;  4LFC E;  3AUZ A;  1IBK E;  4DMI A;  1XNQ E;  5F3W A;  1XMO E;  2ODR D;  4GEQ B;  5T6J A;  1UHZ A;  2EZ6 A;  4JI3 E;  4NXM E;  3LML A;  1YZ9 A;  1PKP A;  4BC7 A;  2V83 A;  5LMU E;  2L6M A;  4JI0 E;  4K0K E;  5A2Q C;  2L92 A;  4DV7 E;  2FGG A;  1RQ0 A;  2V89 A;  4L5N C;  4M0V A;  2UXC E;  2B7T A;  4R8O A;  2FV4 B;  2E5L E;  1N33 E;  3ADJ A;  4DV0 E;  4AQY E;  2V88 A;  2L2M A;  2ODR C;  3IWB A;  2UUA E;  1XMQ E;  2LTR A;  4DR4 E;  4P7D A;  2LTS A;  1STU A;  3DF6 A;  2KOU A;  4X64 E;  2HHH E;  2WZO A;  2UUC E;  3HTX A;  4JYA E;  2M7Q A;  4BCA A;  1O0W A;  5IWA E;  2VE7 C;  4LTY A;  4J8Z A;  4OOG C;  4TUI A;  4M2Z A;  4DKK A;  2MC5 A;  3LLH A;  5AE2 A;  4DR2 E;  4B3M E;  2NUE A;  2ZM6 E;  3T1H E;  1XNR E;  4JI1 E;  1X49 A;  1ZBT A;  1WHQ A;  4WFT A;  3ZOQ B;  3F6H A;  4BBY A;  1IBL E;  4DUY E;  1SR9 A;  4JV5 E;  2V85 A;  3ADI A;  1GZ6 A;  2JWO A;  3JAM C;  1I94 E;  2UU9 E;  4JI8 E;  4LU9 A;  1HNX E;  4JI5 E;  1T4O A;  4NXN E;  3VYX A;  2YT4 A;  2RSM A;  3P1X A;  1N32 E;  5LMN E;  2DIX A;  1IBM E;  5BR8 E;  2L2K B;  2V87 A;  4F54 A;  3C4B A;  4DV4 E;  4GKJ E;  1HNW E;  2DMY A;  4BC9 A;  2LJH A;  2K4V A;  5AE1 A;  4DV2 E;  2MDR A;  2M1S A;  2LMZ A;  4LF6 E;  4DR5 E;  3JU0 A;  3HPS A;  2L3J A;  2NA2 A;  4LF8 E;  5AAS A;  3J7A G;  4JI7 E;  1GQE A;  2CPN A;  2LUQ A;  2V8Q B;  3C4T A;  2E1M A;  3HPZ A;  4Q28 A;  4M30 A;  5IT9 C;  1DQ3 A;  2DSY A;  2JVA A;  4B3R E;  4KHP E;  2L2N A;  1ZBQ A;  3ADG A;  4X66 E;  2L3C A;  2N3G A;  4DR7 E;  4LF5 E;  3DJW A;  3T1Y E;  2FTX B;  4DV6 E;  2KON A;  2KHX A;  4L8N A;  3F6G A;  2JY9 A;  5AE3 A;  2RS6 A;  4YHH E;  3RMP A;  1RC7 A;  2L33 A;  2VF1 A;  3JTZ A;  2B7V A;  4DR1 E;  1FKA E;  1WHN A;  4BMJ A;  4F9C B;  2MC6 A;  2NUF A;  5CFF E;  2V86 A;  1N36 E;  3ADL A;  4DR6 E;  3KWR A;  1QU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...