3VYYA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase a (dhx9)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase A
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyyA00
3OTOE 4LF6E 1UILA 3C4BA 4DR3E 4X64E 3VYXA 2LTRA 2UXBE 2NA2A 1X48A 4LFCE 2L3CA 4JI2E 2UXCE 1J5EE 4YHHE 2B7VA 2CPNA 1XNRE 2RSMA 2RS7A 4B3ME 3HTXA 4B3TE 4K0KE 1T4OA 4DV3E 2LRSA 4DV1E 4LF9E 3ADGA 4DV7E 4DUYE 2N3HA 4X66E 4YY3E 4B3RE 2UU9E 4NXNE 3ADJA 1N36E 2YT4A 5BR8E 2JVAA 1HNZE 2NUEA 1HNWE 2L2KB 2VQEE 1XNQE 5IWAE 5CFFE 1X49A 5LMUE 4JI0E 4LF4E 4DV0E 2HHHE 2KHXA 2L2MA 1XMQE 1N32E 4DUZE 2B7TA 1I94E 1FJGE 1ZBTA 2IHR1 2UUBE 1YZ9A 4WFTA 4GKKE 3LLHA 1UHZA 1PKPA 2L2NA 2F4VE 4JV5E 4JI7E 4DR6E 5LMNE 4NXME 4KHPE 1N33E 4X8WA 4B3SE 2UUCE 4DV4E 1WHNA 2E5LE 2DMYA 3VYYA 3C4TA 2LBSB 2UXDE 1T4LB 2LUPB 3T1HE 4DV2E 2L33A 2LJHA 4X62E 2NUFA 4LFBE 4LF5E 1O0WA 4JI4E 2LTSA 1IBME 2MDRA 4M2ZA 2NUGA 2B3TB 2L3JA 4JI6E 1J26A 1DI2A 4LF8E 1IBLE 1GQEA 4JYAE 2UUAE 2ZM6E 4LFAE 1RC7A 4JI3E 4DR7E 1YYWA 2RS6A 3ADLA 3T1YE 4DR2E 4JI5E 4DKKA 2JY9A 1X47A 1IBKE 1QU6A 2N3GA 4X65E 4AQYE 2EZ6A 1YYOA 2RTXA 4DR1E 3ADIA 4DV5E 3J7Yp 1RQ0A 1YYKA 2DIXA 4OOGC 2LUQA 2DB2A 4DV6E 4JI1E 2VQFE 4JI8E 1N34E 1WHQA 4WYQB 1HNXE 4M30A 1T4NA 1HR0E 4GKJE 4DR4E 1EKZA 1FKAE 1XMOE 4OX9E 3P1XA 4DR5E 4LF7E 1STUA
chains in the Genus database with same CATH superfamily
2EMFA 2DMIA 4TUGA 4DR3E 2EOIA 4X64E 1TF6A 3VYXA 2LTRA 2UXBE 2LO3A 1X48A 2A25A 2L3CA 2N8XA 2G7HA 2JP9A 4B3ME 4Q35B 4R2RA 5T6JA 1T4OA 4BHCA 1PJTA 3J7AG 1BBGA 2V89A 1UN6B 2JWOA 2RPCA 1TN9A 2L6MA 1IMUA 4F6NA 2EMXA 1N36E 2LMZA 5KL5A 4R2PA 1XNQE 1GTKA 3F6GA 2JOXA 4JI0E 4MLVA 2YSPA 4HTGA 4DUZE 2B7TA 1I94E 5KL2A 2EPXA 4BBYA 3EPJA 3IWBA 2M7QA 1UHZA 1PKPA 2EOOA 4WPYA 5FLXC 2DSYA 1X6HA 2F4VE 1N33E 2YZTA 4O5GA 3BIDA 2UUCE 2EJ4A 1A1IA 3JTZA 3VYYA 2ENHA 2UXDE 2CT1A 4BC7A 1Z1BA 2EOZA 2LUPB 3T1HE 2L33A 2LJHA 3EPHA 5A6AA 5DNYA 4LF5E 4O24A 2B3TB 3L00A 2WZOA 4JI6E 2VE7C 4J8ZA 1PJQA 4BMJA 1IBLE 2EOJA 4JYAE 2EL4A 2ZM6E 2J7JA 4LFAE 1EH6A 3FIGA 1RC7A 2LCEA 2EMZA 4L5NC 2KOUA 4P78A 1IBKE 4X65E 2EN6A 1ZAAC 2V88A 2EMBA 2F8BA 4WX9A 3ADIA 3J7Yp 3J81C 1YSAC 2DIXA 5AE2A 3BF2A 2EN4A 3LMLA 2MKDA 2EPMX 2V86A 4BS9A 2EOFA 2ADRA 5IV8B 1HR0E 1DGCA 1EKZA 2EOEA 3MSWA 2EOYA 2CTDA 4R2AA 4BHBA 1A1FA 4LF6E 1WRJA 3C4BA 2PRTA 2EPOA 2FTXB 2M1SA 1T38A 2EN8A 1WJPA 2NA2A 4LFCE 3QG5C 2JR1A 2YRHA 2YSOA 2ODRD 5AE3A 1JK1A 4JI2E 1F2IG 1A1LA 3HTXA 2YTPA 4B3TE 2DLQA 2EPNA 3EPLA 3ADGA 4DV7E 2N3HA 4X66E 2I9IA 2WCC3 3IWDA 2MDGA 1AAYA 4YY3E 1A1JA 3KWRA 2UU9E 1NEIA 3J80C 2JVAA 5TSEA 2VQEE 1X49A 5LMUE 4LF4E 5AE1A 2HHHE 4KWYA 2KHXA 2L2MA 1MGTA 2EOMA 4RHBB 1YUIA 1FJGE 2V87A 2IHR1 3EPKA 4R2QA 2L92A 4WFTA 2EMIA 1IQSA 4M9VC 4DMIA 3DJWA 2EN7A 2YTDA 2L2NA 4JI7E 4DR6E 5LMNE 4KHPE 2EM6A 1PJSA 1TF3A 4DV4E 1G2DC 3RMPA 2DMYA 2LT7A 3C4TA 2LBSB 1T4LB 3M99B 4LFBE 4DV2E 5KL7A 1T39A 1O0WA 4M2ZA 2NABA 3H09A 2NUGA 1A1KA 2L3JA 3VHTB 4F54A 2DGCA 4WSPA 5LL6R 2E72A 2JXPA 2VRDA 4R8OA 2EOQA 4I8OA 4WXDA 4JI3E 2DLKA 4DR2E 3VK6A 3C6KA 2EWLA 1LLMC 2JY9A 5IT9C 2MKNA 1ZU1A 2EPRA 4DR1E 5A69A 5KL4A 1EH7A 3TQMA 1JK2A 2EPUA 1B69A 1HNXE 2LJUA 3BGHA 4GKJE 2K4VA 1A1HA 5A6BA 3P1XA 2EM0A 1YYWA 4R2EA 2YRKA 1GZ6A 2EM5A 2GPIA 3ZOQB 2WBUA 4ZYGA 5KL6A 3UK3C 1YPNA 2EQ3A 4F2JC 4WSGA 1SR9A 2UXCE 4YHHE 2B7VA 4F9BB 2CPNA 2EPKX 2RS7A 3KZZA 1UBDC 2JYAA 4K0KE 1RMDA 2Q8UA 4BC9A 4DV3E 1SFEA 4DV1E 2LE2A 4LF9E 1BB8A 4DUYE 3OMLA 2YTNA 2MC6A 4B3RE 4P7DA 5LLQA 3ADJA 3AV0A 2YT4A 1HNZE 1HNWE 2NUEA 2EQ0A 2EOXA 2HC5A 5IWAE 1QNTA 4R2CA 2EMAA 4DV0E 3C6MA 2ENAA 2YU5A 1YFHA 5IXMB 2YTIA 2GHFA 3EQ1A 2UUBE 1YZ9A 1WXRA 4GKKE 4JV5E 4IJDA 4R2SA 4X8WA 4ZYEA 4B3SE 2YPNA 2MC5A 2R76A 5ADZA 2RQLA 2DRPA 4F9AB 1WHNA 1ZR9A 2EPPA 2M4IA 3HPZA 3HQ1A 2HGHA 4GEQB 1KYQA 2EM7A 2RSIA 4NZVA 4JI4E 2LTSA 3MHSC 2MDRA 2B9DA 2V85A 4IS1C 2EMLA 2HJJA 3JAMC 1DI2A 1YUJA 2EL6A 4LF8E 1ZBQA 2EM2A 2UUAE 1X5WA 1X6EA 2JPAA 2EPCA 2V83A 4DR7E 4X9JA 2RS6A 3T1YE 2D9HA 2EMYA 1PDAA 2EN2A 4DKKA 2FV4B 3BBGA 1QU6A 2EMCA 3DF6A 1YYOA 2RTXA 4DV5E 1RQ0A 4LTYA 5AC5A 3JU0A 1YYKA 3IWCA 4OOGC 5A2QC 1A1GA 4DV6E 4TUIA 2VQFE 1AH5A 2JOBA 4L8NA 2M9AA 1N34E 1T4NA 4O43A 3THNA 1EH8A 1FKAE 4OX9E 4O4KA 2ELYA 1STUA 1UILA 4ZYDA 3OTOE 1X3CA 2EPZA 5AASA 4LU9A 2EOHA 2CSHA 1DQ3A 1L4SA 2YTOA 4HEIA 1IQOA 2YTJA 2EE8A 2LVHA 1J5EE 2EMGA 1KJKA 2YTEA 1XNRE 2RSMA 1MEYC 3ECRA 1P47A 4WXCA 2YU8A 2EM8A 2EM4A 2WBTA 2EP3A 2LRSA 5A6BD 1X6FA 1N3GA 3F6HA 2EPAA 2EN3A 3THOB 4NXNE 3HPSA 5BR8E 4KZSA 2L2KB 5A6JA 5CFFE 3AUZA 3MHHC 4FK5C 4ZYHA 1G2FC 1XMQE 1N32E 2YTFA 2I13A 2GLIA 2YTQA 1ZBTA 1BBOA 2EMKA 2YWQA 3LLHA 2ENCA 2YTGA 4NXME 2V8QB 5KL3A 4BCAA 2EN1A 2YRMA 2E5LE 4F6MA 2LV2A 4NHRA 2NUFA 4X62E 1NCSA 2EM3A 1IBME 4R03A 3KZYA 2R1FA 2K7IA 1J26A 4M0VA 1GQEA 5AC4A 2ODRC 4Q28A 2WBSA 3K6QA 2EQ1A 4N4RB 2VF1A 3ADLA 2EM9A 2EPLX 4JI5E 5A6KA 2L8TA 2EMHA 1X47A 2EMWA 2N3GA 4AQYE 5F3WA 2EZ6A 3HXLA 2EOSA 4GZNC 2ELZA 2EL5A 2LUQA 2DB2A 4JI1E 4JI8E 2EORA 2E1MA 2H36X 2KONA 2FGGA 1WHQA 4R2DA 4WYQB 4M30A 2BBGA 4F9CB 4DR4E 4MLQA 4RH8A 1XMOE 4DR5E 4LF7E 2BB8A
chains in the Genus database with same CATH topology
3OTOE 4LF6E 5AASA 4LU9A 1UILA 3C4BA 3ZOQB 4TUGA 4DR3E 1DQ3A 4X64E 2FTXB 2M1SA 3VYXA 2LTRA 2UXBE 2NA2A 1X48A 4LFCE 2JR1A 2L3CA 2ODRD 5AE3A 4JI2E 2G7HA 2NUGA 1SR9A 1J5EE 2UXCE 4YHHE 2B7VA 4F9BB 2CPNA 1XNRE 2RSMA 2RS7A 4B3ME 3HTXA 5T6JA 4B3TE 4K0KE 1T4OA 4BC9A 4DV3E 2LRSA 4DV1E 2LE2A 3ADGA 4DV7E 4DUYE 4LF9E 2N3HA 4X66E 3J7AG 2V89A 4M2ZA 2JWOA 2L6MA 3IWDA 3F6HA 3OMLA 2MC6A 4YY3E 4B3RE 3KWRA 4P7DA 2UU9E 3ADJA 4NXNE 1N36E 3AV0A 3HPSA 2YT4A 2LMZA 2JVAA 5BR8E 3J80C 1HNZE 2NUEA 1HNWE 4KZSA 2L2KB 2VQEE 1XNQE 3F6GA 5IWAE 5CFFE 1X49A 5LMUE 3AUZA 2JOXA 4JI0E 4LF4E 5AE1A 4DV0E 2HHHE 2KHXA 2L2MA 1XMQE 1N32E 4DUZE 2B7TA 1I94E 1FJGE 1ZBTA 2IHR1 2V87A 2L92A 2UUBE 1YZ9A 1WXRA 4WFTA 4BBYA 4GKKE 3IWBA 3LLHA 4DMIA 3DJWA 2M7QA 1UHZA 1PKPA 2L2NA 4WPYA 5FLXC 2DSYA 2F4VE 4JI7E 4DR6E 5LMNE 4NXME 4KHPE 4JV5E 4X8WA 4B3SE 1N33E 2V8QB 2YZTA 2MC5A 4BCAA 2UUCE 5ADZA 4DV4E 4F9AB 1WHNA 3JTZA 3RMPA 2E5LE 2DMYA 2M4IA 3VYYA 3C4TA 3HPZA 3HQ1A 2LBSB 4BC7A 1T4LB 2UXDE 4GEQB 2LUPB 3T1HE 4DV2E 2L33A 2LJHA 4X62E 2NUFA 4LFBE 5DNYA 4LF5E 1O0WA 4JI4E 2LTSA 3H09A 2MDRA 2B9DA 2V85A 2B3TB 4R03A 2L3JA 1IBME 2WZOA 4F54A 4JI6E 1J26A 3JAMC 2VE7C 4J8ZA 4BMJA 4WSPA 1ZBQA 4LF8E 1DI2A 1IBLE 5LL6R 4M0VA 1GQEA 4JYAE 2UUAE 2ZM6E 2ODRC 4Q28A 4LFAE 3FIGA 4R8OA 1RC7A 3K6QA 2V83A 4I8OA 4JI3E 4DR7E 2VF1A 1YYWA 2RS6A 3ADLA 3T1YE 4DR2E 4JI5E 4DKKA 3VK6A 2EWLA 2FV4B 2JY9A 2KOUA 2L8TA 1X47A 4L5NC 4P78A 5IT9C 1IBKE 1QU6A 2N3GA 4X65E 3DF6A 4AQYE 2V88A 5F3WA 3HXLA 2F8BA 2EZ6A 1YYOA 2RTXA 4DR1E 3ADIA 4DV5E 3J7Yp 1RQ0A 3J81C 4LTYA 3JU0A 1YYKA 2DIXA 3IWCA 4OOGC 2LUQA 5AE2A 2DB2A 5A2QC 4DV6E 4TUIA 4JI1E 2VQFE 4JI8E 2JOBA 3LMLA 2E1MA 2H36X 2KONA 2FGGA 2V86A 4L8NA 4BS9A 1WHQA 1N34E 4WYQB 1HNXE 4M30A 1T4NA 1HR0E 4F9CB 4GKJE 2K4VA 1EKZA 3MSWA 4DR4E 1FKAE 1XMOE 4OX9E 3P1XA 4DR5E 4LF7E 1STUA 1GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO E;  4LF6 E;  1UIL A;  3C4B A;  4DR3 E;  4X64 E;  3VYX A;  2LTR A;  2UXB E;  2NA2 A;  1X48 A;  4LFC E;  2L3C A;  4JI2 E;  2UXC E;  1J5E E;  4YHH E;  2B7V A;  2CPN A;  1XNR E;  2RSM A;  2RS7 A;  4B3M E;  3HTX A;  4B3T E;  4K0K E;  1T4O A;  4DV3 E;  2LRS A;  4DV1 E;  4LF9 E;  3ADG A;  4DV7 E;  4DUY E;  2N3H A;  4X66 E;  4YY3 E;  4B3R E;  2UU9 E;  4NXN E;  3ADJ A;  1N36 E;  2YT4 A;  5BR8 E;  2JVA A;  1HNZ E;  2NUE A;  1HNW E;  2L2K B;  2VQE E;  1XNQ E;  5IWA E;  5CFF E;  1X49 A;  5LMU E;  4JI0 E;  4LF4 E;  4DV0 E;  2HHH E;  2KHX A;  2L2M A;  1XMQ E;  1N32 E;  4DUZ E;  2B7T A;  1I94 E;  1FJG E;  1ZBT A;  2IHR 1;  2UUB E;  1YZ9 A;  4WFT A;  4GKK E;  3LLH A;  1UHZ A;  1PKP A;  2L2N A;  2F4V E;  4JV5 E;  4JI7 E;  4DR6 E;  5LMN E;  4NXM E;  4KHP E;  1N33 E;  4X8W A;  4B3S E;  2UUC E;  4DV4 E;  1WHN A;  2E5L E;  2DMY A;  3VYY A;  3C4T A;  2LBS B;  2UXD E;  1T4L B;  2LUP B;  3T1H E;  4DV2 E;  2L33 A;  2LJH A;  4X62 E;  2NUF A;  4LFB E;  4LF5 E;  1O0W A;  4JI4 E;  2LTS A;  1IBM E;  2MDR A;  4M2Z A;  2NUG A;  2B3T B;  2L3J A;  4JI6 E;  1J26 A;  1DI2 A;  4LF8 E;  1IBL E;  1GQE A;  4JYA E;  2UUA E;  2ZM6 E;  4LFA E;  1RC7 A;  4JI3 E;  4DR7 E;  1YYW A;  2RS6 A;  3ADL A;  3T1Y E;  4DR2 E;  4JI5 E;  4DKK A;  2JY9 A;  1X47 A;  1IBK E;  1QU6 A;  2N3G A;  4X65 E;  4AQY E;  2EZ6 A;  1YYO A;  2RTX A;  4DR1 E;  3ADI A;  4DV5 E;  3J7Y p;  1RQ0 A;  1YYK A;  2DIX A;  4OOG C;  2LUQ A;  2DB2 A;  4DV6 E;  4JI1 E;  2VQF E;  4JI8 E;  1N34 E;  1WHQ A;  4WYQ B;  1HNX E;  4M30 A;  1T4N A;  1HR0 E;  4GKJ E;  4DR4 E;  1EKZ A;  1FKA E;  1XMO E;  4OX9 E;  3P1X A;  4DR5 E;  4LF7 E;  1STU A; 
#chains in the Genus database with same CATH topology
 2EMF A;  2DMI A;  4TUG A;  4DR3 E;  2EOI A;  4X64 E;  1TF6 A;  3VYX A;  2LTR A;  2UXB E;  2LO3 A;  1X48 A;  2A25 A;  2L3C A;  2N8X A;  2G7H A;  2JP9 A;  4B3M E;  4Q35 B;  4R2R A;  5T6J A;  1T4O A;  4BHC A;  1PJT A;  3J7A G;  1BBG A;  2V89 A;  1UN6 B;  2JWO A;  2RPC A;  1TN9 A;  2L6M A;  1IMU A;  4F6N A;  2EMX A;  1N36 E;  2LMZ A;  5KL5 A;  4R2P A;  1XNQ E;  1GTK A;  3F6G A;  2JOX A;  4JI0 E;  4MLV A;  2YSP A;  4HTG A;  4DUZ E;  2B7T A;  1I94 E;  5KL2 A;  2EPX A;  4BBY A;  3EPJ A;  3IWB A;  2M7Q A;  1UHZ A;  1PKP A;  2EOO A;  4WPY A;  5FLX C;  2DSY A;  1X6H A;  2F4V E;  1N33 E;  2YZT A;  4O5G A;  3BID A;  2UUC E;  2EJ4 A;  1A1I A;  3JTZ A;  3VYY A;  2ENH A;  2UXD E;  2CT1 A;  4BC7 A;  1Z1B A;  2EOZ A;  2LUP B;  3T1H E;  2L33 A;  2LJH A;  3EPH A;  5A6A A;  5DNY A;  4LF5 E;  4O24 A;  2B3T B;  3L00 A;  2WZO A;  4JI6 E;  2VE7 C;  4J8Z A;  1PJQ A;  4BMJ A;  1IBL E;  2EOJ A;  4JYA E;  2EL4 A;  2ZM6 E;  2J7J A;  4LFA E;  1EH6 A;  3FIG A;  1RC7 A;  2LCE A;  2EMZ A;  4L5N C;  2KOU A;  4P78 A;  1IBK E;  4X65 E;  2EN6 A;  1ZAA C;  2V88 A;  2EMB A;  2F8B A;  4WX9 A;  3ADI A;  3J7Y p;  3J81 C;  1YSA C;  2DIX A;  5AE2 A;  3BF2 A;  2EN4 A;  3LML A;  2MKD A;  2EPM X;  2V86 A;  4BS9 A;  2EOF A;  2ADR A;  5IV8 B;  1HR0 E;  1DGC A;  1EKZ A;  2EOE A;  3MSW A;  2EOY A;  2CTD A;  4R2A A;  4BHB A;  1A1F A;  4LF6 E;  1WRJ A;  3C4B A;  2PRT A;  2EPO A;  2FTX B;  2M1S A;  1T38 A;  2EN8 A;  1WJP A;  2NA2 A;  4LFC E;  3QG5 C;  2JR1 A;  2YRH A;  2YSO A;  2ODR D;  5AE3 A;  1JK1 A;  4JI2 E;  1F2I G;  1A1L A;  3HTX A;  2YTP A;  4B3T E;  2DLQ A;  2EPN A;  3EPL A;  3ADG A;  4DV7 E;  2N3H A;  4X66 E;  2I9I A;  2WCC 3;  3IWD A;  2MDG A;  1AAY A;  4YY3 E;  1A1J A;  3KWR A;  2UU9 E;  1NEI A;  3J80 C;  2JVA A;  5TSE A;  2VQE E;  1X49 A;  5LMU E;  4LF4 E;  5AE1 A;  2HHH E;  4KWY A;  2KHX A;  2L2M A;  1MGT A;  2EOM A;  4RHB B;  1YUI A;  1FJG E;  2V87 A;  2IHR 1;  3EPK A;  4R2Q A;  2L92 A;  4WFT A;  2EMI A;  1IQS A;  4M9V C;  4DMI A;  3DJW A;  2EN7 A;  2YTD A;  2L2N A;  4JI7 E;  4DR6 E;  5LMN E;  4KHP E;  2EM6 A;  1PJS A;  1TF3 A;  4DV4 E;  1G2D C;  3RMP A;  2DMY A;  2LT7 A;  3C4T A;  2LBS B;  1T4L B;  3M99 B;  4LFB E;  4DV2 E;  5KL7 A;  1T39 A;  1O0W A;  4M2Z A;  2NAB A;  3H09 A;  2NUG A;  1A1K A;  2L3J A;  3VHT B;  4F54 A;  2DGC A;  4WSP A;  5LL6 R;  2E72 A;  2JXP A;  2VRD A;  4R8O A;  2EOQ A;  4I8O A;  4WXD A;  4JI3 E;  2DLK A;  4DR2 E;  3VK6 A;  3C6K A;  2EWL A;  1LLM C;  2JY9 A;  5IT9 C;  2MKN A;  1ZU1 A;  2EPR A;  4DR1 E;  5A69 A;  5KL4 A;  1EH7 A;  3TQM A;  1JK2 A;  2EPU A;  1B69 A;  1HNX E;  2LJU A;  3BGH A;  4GKJ E;  2K4V A;  1A1H A;  5A6B A;  3P1X A;  2EM0 A;  1YYW A;  4R2E A;  2YRK A;  1GZ6 A;  2EM5 A;  2GPI A;  3ZOQ B;  2WBU A;  4ZYG A;  5KL6 A;  3UK3 C;  1YPN A;  2EQ3 A;  4F2J C;  4WSG A;  1SR9 A;  2UXC E;  4YHH E;  2B7V A;  4F9B B;  2CPN A;  2EPK X;  2RS7 A;  3KZZ A;  1UBD C;  2JYA A;  4K0K E;  1RMD A;  2Q8U A;  4BC9 A;  4DV3 E;  1SFE A;  4DV1 E;  2LE2 A;  4LF9 E;  1BB8 A;  4DUY E;  3OML A;  2YTN A;  2MC6 A;  4B3R E;  4P7D A;  5LLQ A;  3ADJ A;  3AV0 A;  2YT4 A;  1HNZ E;  1HNW E;  2NUE A;  2EQ0 A;  2EOX A;  2HC5 A;  5IWA E;  1QNT A;  4R2C A;  2EMA A;  4DV0 E;  3C6M A;  2ENA A;  2YU5 A;  1YFH A;  5IXM B;  2YTI A;  2GHF A;  3EQ1 A;  2UUB E;  1YZ9 A;  1WXR A;  4GKK E;  4JV5 E;  4IJD A;  4R2S A;  4X8W A;  4ZYE A;  4B3S E;  2YPN A;  2MC5 A;  2R76 A;  5ADZ A;  2RQL A;  2DRP A;  4F9A B;  1WHN A;  1ZR9 A;  2EPP A;  2M4I A;  3HPZ A;  3HQ1 A;  2HGH A;  4GEQ B;  1KYQ A;  2EM7 A;  2RSI A;  4NZV A;  4JI4 E;  2LTS A;  3MHS C;  2MDR A;  2B9D A;  2V85 A;  4IS1 C;  2EML A;  2HJJ A;  3JAM C;  1DI2 A;  1YUJ A;  2EL6 A;  4LF8 E;  1ZBQ A;  2EM2 A;  2UUA E;  1X5W A;  1X6E A;  2JPA A;  2EPC A;  2V83 A;  4DR7 E;  4X9J A;  2RS6 A;  3T1Y E;  2D9H A;  2EMY A;  1PDA A;  2EN2 A;  4DKK A;  2FV4 B;  3BBG A;  1QU6 A;  2EMC A;  3DF6 A;  1YYO A;  2RTX A;  4DV5 E;  1RQ0 A;  4LTY A;  5AC5 A;  3JU0 A;  1YYK A;  3IWC A;  4OOG C;  5A2Q C;  1A1G A;  4DV6 E;  4TUI A;  2VQF E;  1AH5 A;  2JOB A;  4L8N A;  2M9A A;  1N34 E;  1T4N A;  4O43 A;  3THN A;  1EH8 A;  1FKA E;  4OX9 E;  4O4K A;  2ELY A;  1STU A;  1UIL A;  4ZYD A;  3OTO E;  1X3C A;  2EPZ A;  5AAS A;  4LU9 A;  2EOH A;  2CSH A;  1DQ3 A;  1L4S A;  2YTO A;  4HEI A;  1IQO A;  2YTJ A;  2EE8 A;  2LVH A;  1J5E E;  2EMG A;  1KJK A;  2YTE A;  1XNR E;  2RSM A;  1MEY C;  3ECR A;  1P47 A;  4WXC A;  2YU8 A;  2EM8 A;  2EM4 A;  2WBT A;  2EP3 A;  2LRS A;  5A6B D;  1X6F A;  1N3G A;  3F6H A;  2EPA A;  2EN3 A;  3THO B;  4NXN E;  3HPS A;  5BR8 E;  4KZS A;  2L2K B;  5A6J A;  5CFF E;  3AUZ A;  3MHH C;  4FK5 C;  4ZYH A;  1G2F C;  1XMQ E;  1N32 E;  2YTF A;  2I13 A;  2GLI A;  2YTQ A;  1ZBT A;  1BBO A;  2EMK A;  2YWQ A;  3LLH A;  2ENC A;  2YTG A;  4NXM E;  2V8Q B;  5KL3 A;  4BCA A;  2EN1 A;  2YRM A;  2E5L E;  4F6M A;  2LV2 A;  4NHR A;  2NUF A;  4X62 E;  1NCS A;  2EM3 A;  1IBM E;  4R03 A;  3KZY A;  2R1F A;  2K7I A;  1J26 A;  4M0V A;  1GQE A;  5AC4 A;  2ODR C;  4Q28 A;  2WBS A;  3K6Q A;  2EQ1 A;  4N4R B;  2VF1 A;  3ADL A;  2EM9 A;  2EPL X;  4JI5 E;  5A6K A;  2L8T A;  2EMH A;  1X47 A;  2EMW A;  2N3G A;  4AQY E;  5F3W A;  2EZ6 A;  3HXL A;  2EOS A;  4GZN C;  2ELZ A;  2EL5 A;  2LUQ A;  2DB2 A;  4JI1 E;  4JI8 E;  2EOR A;  2E1M A;  2H36 X;  2KON A;  2FGG A;  1WHQ A;  4R2D A;  4WYQ B;  4M30 A;  2BBG A;  4F9C B;  4DR4 E;  4MLQ A;  4RH8 A;  1XMO E;  4DR5 E;  4LF7 E;  2BB8 A; 
#chains in the Genus database with same CATH homology
 3OTO E;  4LF6 E;  5AAS A;  4LU9 A;  1UIL A;  3C4B A;  3ZOQ B;  4TUG A;  4DR3 E;  1DQ3 A;  4X64 E;  2FTX B;  2M1S A;  3VYX A;  2LTR A;  2UXB E;  2NA2 A;  1X48 A;  4LFC E;  2JR1 A;  2L3C A;  2ODR D;  5AE3 A;  4JI2 E;  2G7H A;  2NUG A;  1SR9 A;  1J5E E;  2UXC E;  4YHH E;  2B7V A;  4F9B B;  2CPN A;  1XNR E;  2RSM A;  2RS7 A;  4B3M E;  3HTX A;  5T6J A;  4B3T E;  4K0K E;  1T4O A;  4BC9 A;  4DV3 E;  2LRS A;  4DV1 E;  2LE2 A;  3ADG A;  4DV7 E;  4DUY E;  4LF9 E;  2N3H A;  4X66 E;  3J7A G;  2V89 A;  4M2Z A;  2JWO A;  2L6M A;  3IWD A;  3F6H A;  3OML A;  2MC6 A;  4YY3 E;  4B3R E;  3KWR A;  4P7D A;  2UU9 E;  3ADJ A;  4NXN E;  1N36 E;  3AV0 A;  3HPS A;  2YT4 A;  2LMZ A;  2JVA A;  5BR8 E;  3J80 C;  1HNZ E;  2NUE A;  1HNW E;  4KZS A;  2L2K B;  2VQE E;  1XNQ E;  3F6G A;  5IWA E;  5CFF E;  1X49 A;  5LMU E;  3AUZ A;  2JOX A;  4JI0 E;  4LF4 E;  5AE1 A;  4DV0 E;  2HHH E;  2KHX A;  2L2M A;  1XMQ E;  1N32 E;  4DUZ E;  2B7T A;  1I94 E;  1FJG E;  1ZBT A;  2IHR 1;  2V87 A;  2L92 A;  2UUB E;  1YZ9 A;  1WXR A;  4WFT A;  4BBY A;  4GKK E;  3IWB A;  3LLH A;  4DMI A;  3DJW A;  2M7Q A;  1UHZ A;  1PKP A;  2L2N A;  4WPY A;  5FLX C;  2DSY A;  2F4V E;  4JI7 E;  4DR6 E;  5LMN E;  4NXM E;  4KHP E;  4JV5 E;  4X8W A;  4B3S E;  1N33 E;  2V8Q B;  2YZT A;  2MC5 A;  4BCA A;  2UUC E;  5ADZ A;  4DV4 E;  4F9A B;  1WHN A;  3JTZ A;  3RMP A;  2E5L E;  2DMY A;  2M4I A;  3VYY A;  3C4T A;  3HPZ A;  3HQ1 A;  2LBS B;  4BC7 A;  1T4L B;  2UXD E;  4GEQ B;  2LUP B;  3T1H E;  4DV2 E;  2L33 A;  2LJH A;  4X62 E;  2NUF A;  4LFB E;  5DNY A;  4LF5 E;  1O0W A;  4JI4 E;  2LTS A;  3H09 A;  2MDR A;  2B9D A;  2V85 A;  2B3T B;  4R03 A;  2L3J A;  1IBM E;  2WZO A;  4F54 A;  4JI6 E;  1J26 A;  3JAM C;  2VE7 C;  4J8Z A;  4BMJ A;  4WSP A;  1ZBQ A;  4LF8 E;  1DI2 A;  1IBL E;  5LL6 R;  4M0V A;  1GQE A;  4JYA E;  2UUA E;  2ZM6 E;  2ODR C;  4Q28 A;  4LFA E;  3FIG A;  4R8O A;  1RC7 A;  3K6Q A;  2V83 A;  4I8O A;  4JI3 E;  4DR7 E;  2VF1 A;  1YYW A;  2RS6 A;  3ADL A;  3T1Y E;  4DR2 E;  4JI5 E;  4DKK A;  3VK6 A;  2EWL A;  2FV4 B;  2JY9 A;  2KOU A;  2L8T A;  1X47 A;  4L5N C;  4P78 A;  5IT9 C;  1IBK E;  1QU6 A;  2N3G A;  4X65 E;  3DF6 A;  4AQY E;  2V88 A;  5F3W A;  3HXL A;  2F8B A;  2EZ6 A;  1YYO A;  2RTX A;  4DR1 E;  3ADI A;  4DV5 E;  3J7Y p;  1RQ0 A;  3J81 C;  4LTY A;  3JU0 A;  1YYK A;  2DIX A;  3IWC A;  4OOG C;  2LUQ A;  5AE2 A;  2DB2 A;  5A2Q C;  4DV6 E;  4TUI A;  4JI1 E;  2VQF E;  4JI8 E;  2JOB A;  3LML A;  2E1M A;  2H36 X;  2KON A;  2FGG A;  2V86 A;  4L8N A;  4BS9 A;  1WHQ A;  1N34 E;  4WYQ B;  1HNX E;  4M30 A;  1T4N A;  1HR0 E;  4F9C B;  4GKJ E;  2K4V A;  1EKZ A;  3MSW A;  4DR4 E;  1FKA E;  1XMO E;  4OX9 E;  3P1X A;  4DR5 E;  4LF7 E;  1STU A;  1GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...