3VYYA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase a (dhx9)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
b'MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase A
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyyA00
4JYAE 3T1YE 4LF9E 1FKAE 1XMOE 1IBLE 4DR5E 1YYKA 4DR3E 4JI0E 4KHPE 4JV5E 4DUZE 1N36E 2B7VA 2VQFE 1I94E 4OOGC 1ZBTA 4B3TE 1N33E 4LF4E 2L2KB 4WYQB 3P1XA 4WFTA 4X66E 1EKZA 2UXDE 2KHXA 4M30A 2B3TB 5LMUE 1HR0E 4JI1E 3T1HE 2DMYA 4X65E 3LLHA 2RS7A 2LTSA 4DR4E 2NA2A 1UHZA 2LBSB 4DR6E 1HNWE 4DR1E 4NXME 4OX9E 5IWAE 2UUBE 4NXNE 4DUYE 1YYWA 4DV6E 4DV7E 2JVAA 2VQEE 2UUCE 2NUFA 3C4BA 4JI6E 2LJHA 1GQEA 2UU9E 4DV3E 4JI5E 1RC7A 4JI2E 4DKKA 2DB2A 2L2NA 2LUQA 3J7Yp 4GKJE 2JY9A 1O0WA 3ADIA 4JI4E 2RTXA 1HNZE 4JI8E 4GKKE 1WHNA 5BR8E 4DV0E 2LUPB 5CFFE 5LMNE 4DV4E 2UUAE 2NUEA 1QU6A 4JI7E 2HHHE 3ADGA 4LF7E 3VYXA 4LF6E 4DV1E 2N3HA 4DR2E 1IBKE 3VYYA 2UXCE 2UXBE 1RQ0A 4X64E 4B3ME 4B3SE 2NUGA 1STUA 1XNQE 3HTXA 2E5LE 2B7TA 1IBME 2RSMA 4LFCE 2F4VE 4K0KE 3C4TA 4DV5E 1HNXE 2RS6A 1YZ9A 4DR7E 4LF8E 1X49A 2N3GA 3ADLA 2YT4A 1N34E 4B3RE 4DV2E 2L3CA 2L2MA 4YHHE 1J5EE 2LRSA 1N32E 4LFBE 2CPNA 1WHQA 1UILA 4YY3E 2MDRA 1T4NA 1XMQE 1X47A 4LF5E 1FJGE 4X8WA 1DI2A 4LFAE 1T4LB 4M2ZA 4X62E 1PKPA 2LTRA 2IHR1 2ZM6E 1J26A 2L3JA 1XNRE 1X48A 1T4OA 3OTOE 1YYOA 4JI3E 3ADJA 2DIXA 4AQYE 2EZ6A 2L33A
chains in the Genus database with same CATH superfamily
3RMPA 2EPAA 2FV4B 2YSOA 2EN1A 2V87A 1P47A 4DR5E 2CSHA 4HEIA 1IMUA 2M7QA 2YWQA 1EH8A 2B7VA 1YUIA 3C6MA 2I13A 2EM5A 3THOB 4MLVA 1PJTA 1N3GA 3P1XA 4X66E 2UXDE 3J81C 5AASA 2YPNA 2JP9A 4M30A 2B3TB 3T1HE 1UN6B 3LLHA 4BC7A 2EM7A 2PRTA 2LTSA 2LBSB 4NXME 4R2CA 3IWDA 2MC5A 4NXNE 4DUYE 2EOSA 1YYWA 4DV7E 2VQEE 2UUCE 1IQSA 4GZNC 2EMWA 2LCEA 4DV3E 2YRHA 3L00A 2R1FA 2YRMA 4WPYA 2JY9A 3VK6A 1B69A 1WXRA 4ZYEA 2RTXA 2V8QB 4GKKE 3EPLA 2YTJA 4KZSA 1X6EA 2EMIA 3BF2A 1JK2A 4LF7E 5KL6A 4X64E 1X6HA 4L5NC 2G7HA 2E5LE 2LO3A 2EOIA 2RSMA 3C4TA 3BIDA 3KZZA 2ADRA 1PJQA 4R2EA 5A6BA 2YT4A 3KZYA 2JPAA 4F9CB 3C6KA 1N34E 4B3RE 4IJDA 2YTEA 3EPKA 1J5EE 1RMDA 5KL7A 1A1KA 2KONA 2E1MA 3EPHA 3FIGA 3KWRA 1NCSA 2MDRA 1SFEA 1YPNA 2EOEA 3BBGA 1EH6A 2EM8A 1PDAA 2DGCA 1PKPA 3J7AG 4WXDA 1J26A 2EPMX 5KL5A 2EMZA 1T4OA 2V85A 3IWBA 2L6MA 2EL6A 2F8BA 3QG5C 4R2PA 2EZ6A 2YU8A 4JYAE 3T1YE 4LF9E 2YTFA 1XMOE 2KOUA 1IBLE 5AC5A 5AC4A 4DR3E 4KHPE 1A1IA 1KJKA 1G2DC 4F54A 2YZTA 1A1JA 1N36E 2EM6A 1UBDC 1N33E 2L2KB 2FTXB 2EM4A 4WFTA 1EKZA 5KL2A 2EM2A 4NHRA 2VE7C 3M99B 4JI1E 5AE1A 2DMYA 2YTNA 1DQ3A 4BBYA 4O5GA 4DR6E 2UUBE 2EM0A 4DV6E 5IT9C 2JYAA 2LJHA 3OMLA 1GQEA 2EL5A 4ZYDA 2YTDA 2DMIA 2EN7A 3LMLA 4DKKA 2DB2A 3J7Yp 2EMKA 4BC9A 1X3CA 2R76A 1ZBQA 4R2QA 4J8ZA 1GTKA 4JI4E 2FGGA 3H09A 2JOXA 1WHNA 5BR8E 2LUPB 2EOHA 5CFFE 2VRDA 5LMNE 5IXMB 2ODRD 1QU6A 4RH8A 2HC5A 3VYXA 2EORA 4LF6E 2N3HA 2JOBA 5AE2A 4WX9A 4DR2E 2UXCE 2EMFA 4O24A 2UXBE 4P78A 2H36X 4B3SE 1STUA 5ADZA 5F3WA 3AUZA 1XNQE 4LTYA 2NABA 3ZOQB 2F4VE 4DV5E 1YFHA 2BB8A 5A6AA 1HNXE 2EPKX 3HPSA 3JAMC 4LF8E 4F6NA 1X49A 4LU9A 2EOYA 3ADLA 2V86A 2EMYA 2EP3A 4BHCA 2BBGA 2MKNA 3AV0A 4YHHE 2EPRA 2EOZA 1UILA 4ZYGA 4YY3E 2D9HA 4ZYHA 2JWOA 2EMXA 2EQ3A 2YTQA 3K6QA 4LF5E 2EPXA 1DI2A 4LFAE 4Q35B 4R2DA 2ELYA 4F9BB 2J7JA 2LE2A 2EOXA 5A2QC 1XNRE 3F6GA 2CT1A 2B9DA 4NZVA 2L33A 1FKAE 4JI0E 4BMJA 2EOMA 3VHTB 5KL4A 4DUZE 4BS9A 4OOGC 4M9VC 4B3TE 2EMBA 4BCAA 3EPJA 1G2FC 1AH5A 4LF4E 2I9IA 5KL3A 4F2JC 2RSIA 4WYQB 2YRKA 2MKDA 1SR9A 1MEYC 2KHXA 2EMAA 3UK3C 2JR1A 1DGCA 1IQOA 4X9JA 1KYQA 1HR0E 2JXPA 4X65E 4FK5C 2RS7A 2EMHA 2YSPA 2DSYA 2EJ4A 2NA2A 1UHZA 1HNWE 4DR1E 5A6KA 4P7DA 4GEQB 2EN8A 2LMZA 5LLQA 2EM3A 3HQ1A 2EWLA 4M0VA 3C4BA 1A1LA 2UU9E 4GKJE 5FLXC 4F6MA 3HXLA 1YSAC 3BGHA 4I8OA 1HNZE 4JI8E 1X5WA 2K7IA 1AAYA 1BBGA 1BBOA 2EL4A 2MC6A 4O4KA 2EN4A 5TSEA 2UUAE 2NUEA 2DLQA 4JI7E 2DRPA 2EPUA 2EOFA 4DV1E 3THNA 1IBKE 3VYYA 2EPNA 2YTIA 2NUGA 5AE3A 1A1FA 1JK1A 4DMIA 3HTXA 1GZ6A 2B7TA 2ELZA 4K0KE 2Q8UA 2EMGA 2EN2A 1PJSA 4R2SA 4DR7E 2N3GA 2RPCA 2L3CA 2L2MA 4F9AB 4KWYA 2LRSA 1N32E 5T6JA 1WHQA 4BHBA 3MSWA 3ECRA 1T4NA 2CTDA 2EMCA 4IS1C 1X47A 1FJGE 3JTZA 2EOOA 1TN9A 1X48A 2YTGA 1NEIA 2A25A 2EM9A 2LV2A 1YYOA 3ADJA 1T38A 2DIXA 4AQYE 1TF6A 4JI3E 1L4SA 1ZAAC 5DNYA 4R8OA 2EN3A 2K4VA 2EE8A 2EPOA 2LT7A 1YYKA 1WRJA 4TUGA 4R03A 4JV5E 2EPLX 3J80C 2VQFE 1I94E 1ZBTA 2WZOA 2EOQA 3F6HA 5LL6R 2WCC3 1EH7A 2HJJA 2E72A 4MLQA 2EQ0A 1LLMC 2MDGA 2ENHA 5LMUE 2ENAA 2L8TA 2ENCA 2M4IA 4RHBB 5A69A 5A6BD 4DR4E 4N4RB 2GLIA 4OX9E 5IWAE 2WBUA 5A6JA 2EQ1A 2JVAA 2NUFA 4JI6E 1A1GA 1YUJA 4WSPA 1Z1BA 3MHSC 5IV8B 4JI5E 1RC7A 4JI2E 2LVHA 2L2NA 2LUQA 3MHHC 2ODRC 4Q28A 1O0WA 1BB8A 3ADIA 1WJPA 4TUIA 2N8XA 4DV0E 3DJWA 2EPPA 4DV4E 2HGHA 1MGTA 2EPZA 1ZR9A 1F2IG 2HHHE 3ADGA 3IWCA 1X6FA 3EQ1A 1RQ0A 4B3ME 2V83A 4HTGA 1ZU1A 2L92A 4LFCE 1IBME 1T39A 4O43A 1A1HA 4WSGA 2RS6A 2WBTA 2M1SA 1YZ9A 2GHFA 4R2AA 1TF3A 4DV2E 3TQMA 4LFBE 2CPNA 4WXCA 2VF1A 2DLKA 2LJUA 2M9AA 4R2RA 2WBSA 2V89A 2V88A 2YU5A 1QNTA 1XMQE 2EOJA 3DF6A 4X8WA 1T4LB 4M2ZA 4X62E 2YTPA 2LTRA 2EMLA 2EN6A 2IHR1 2ZM6E 3JU0A 2L3JA 2YTOA 3HPZA 2GPIA 4L8NA 2EPCA 2RQLA 3OTOE
chains in the Genus database with same CATH topology
3RMPA 2FV4B 4JYAE 5DNYA 4R8OA 3T1YE 4LF9E 2V87A 1FKAE 1XMOE 2KOUA 1IBLE 2K4VA 4DR5E 1YYKA 4DR3E 4JI0E 4BMJA 4KHPE 4TUGA 4F54A 4R03A 2YZTA 4JV5E 4DUZE 2M7QA 3J80C 1N36E 2B7VA 4BS9A 2VQFE 1I94E 4OOGC 1ZBTA 4B3TE 4BCAA 1N33E 2WZOA 3F6HA 5LL6R 4LF4E 2L2KB 2FTXB 4WYQB 3P1XA 4WFTA 4X66E 1EKZA 1SR9A 2UXDE 2KHXA 2VE7C 3J81C 2JR1A 5AASA 2NUGA 4M30A 2B3TB 5LMUE 5AE1A 1HR0E 2L8TA 3T1HE 4JI1E 2DMYA 4X65E 2M4IA 3LLHA 4BC7A 2RS7A 1DQ3A 4BBYA 2DSYA 2LTSA 4DR4E 2NA2A 1UHZA 2LBSB 4DR6E 1HNWE 4DR1E 4NXME 4OX9E 4P7DA 4GEQB 3IWDA 2MC5A 2LMZA 5IWAE 2UUBE 4NXNE 4DUYE 3HQ1A 2EWLA 1YYWA 4DV6E 4DV7E 4M0VA 2JVAA 2VQEE 5IT9C 2NUFA 3C4BA 2UUCE 4B3ME 4JI6E 2LJHA 3OMLA 1GQEA 4WSPA 2UU9E 4DV3E 4JI5E 1RC7A 4JI2E 3LMLA 4DKKA 2DB2A 2L2NA 2LUQA 3J7Yp 4GKJE 4BC9A 4WPYA 2ODRC 5FLXC 2JY9A 4Q28A 3VK6A 1O0WA 1WXRA 1ZBQA 3HXLA 4J8ZA 3ADIA 4JI4E 2FGGA 2RTXA 3H09A 4I8OA 2V8QB 4JI8E 1HNZE 4GKKE 2JOXA 4KZSA 1WHNA 5BR8E 4TUIA 4DV0E 2LUPB 5CFFE 2MC6A 3DJWA 5LMNE 4DV4E 2UUAE 2NUEA 2ODRD 1QU6A 4JI7E 2HHHE 3ADGA 4LF7E 3VYXA 4LF6E 3IWCA 4DV1E 2N3HA 2JOBA 5AE2A 4DR2E 1IBKE 3VYYA 2UXCE 2UXBE 1RQ0A 4P78A 5AE3A 2H36X 4X64E 4B3SE 2V83A 1STUA 4DMIA 4L5NC 5ADZA 5F3WA 2G7HA 3AUZA 4LTYA 2L92A 1XNQE 1GZ6A 2B7TA 3ZOQB 2RSMA 1IBME 2E5LE 4LFCE 3HTXA 2F4VE 4K0KE 3C4TA 4DV5E 1HNXE 2RS6A 2M1SA 3HPSA 3JAMC 1YZ9A 4DR7E 4LF8E 1X49A 2N3GA 4LU9A 3ADLA 2V86A 2YT4A 4F9CB 1N34E 4B3RE 4DV2E 2L3CA 3AV0A 2L2MA 4F9AB 4YHHE 2LRSA 1J5EE 1YYOA 1N32E 5T6JA 4LFBE 2KONA 2CPNA 2E1MA 1WHQA 1UILA 2VF1A 3FIGA 4YY3E 3KWRA 2JWOA 2MDRA 2V89A 3MSWA 2V88A 1T4NA 3K6QA 1XMQE 1X47A 3DF6A 4LF5E 4X8WA 1FJGE 1DI2A 4LFAE 1T4LB 3JTZA 4X62E 4M2ZA 1PKPA 3J7AG 2LTRA 2IHR1 4F9BB 2ZM6E 3JU0A 1J26A 2LE2A 5A2QC 2L3JA 1XNRE 1X48A 3F6GA 3HPZA 1T4OA 2B9DA 2V85A 3IWBA 2L6MA 2F8BA 2DIXA 3ADJA 4L8NA 3OTOE 4AQYE 4JI3E 2EZ6A 2L33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA E;  3T1Y E;  4LF9 E;  1FKA E;  1XMO E;  1IBL E;  4DR5 E;  1YYK A;  4DR3 E;  4JI0 E;  4KHP E;  4JV5 E;  4DUZ E;  1N36 E;  2B7V A;  2VQF E;  1I94 E;  4OOG C;  1ZBT A;  4B3T E;  1N33 E;  4LF4 E;  2L2K B;  4WYQ B;  3P1X A;  4WFT A;  4X66 E;  1EKZ A;  2UXD E;  2KHX A;  4M30 A;  2B3T B;  5LMU E;  1HR0 E;  4JI1 E;  3T1H E;  2DMY A;  4X65 E;  3LLH A;  2RS7 A;  2LTS A;  4DR4 E;  2NA2 A;  1UHZ A;  2LBS B;  4DR6 E;  1HNW E;  4DR1 E;  4NXM E;  4OX9 E;  5IWA E;  2UUB E;  4NXN E;  4DUY E;  1YYW A;  4DV6 E;  4DV7 E;  2JVA A;  2VQE E;  2UUC E;  2NUF A;  3C4B A;  4JI6 E;  2LJH A;  1GQE A;  2UU9 E;  4DV3 E;  4JI5 E;  1RC7 A;  4JI2 E;  4DKK A;  2DB2 A;  2L2N A;  2LUQ A;  3J7Y p;  4GKJ E;  2JY9 A;  1O0W A;  3ADI A;  4JI4 E;  2RTX A;  1HNZ E;  4JI8 E;  4GKK E;  1WHN A;  5BR8 E;  4DV0 E;  2LUP B;  5CFF E;  5LMN E;  4DV4 E;  2UUA E;  2NUE A;  1QU6 A;  4JI7 E;  2HHH E;  3ADG A;  4LF7 E;  3VYX A;  4LF6 E;  4DV1 E;  2N3H A;  4DR2 E;  1IBK E;  3VYY A;  2UXC E;  2UXB E;  1RQ0 A;  4X64 E;  4B3M E;  4B3S E;  2NUG A;  1STU A;  1XNQ E;  3HTX A;  2E5L E;  2B7T A;  1IBM E;  2RSM A;  4LFC E;  2F4V E;  4K0K E;  3C4T A;  4DV5 E;  1HNX E;  2RS6 A;  1YZ9 A;  4DR7 E;  4LF8 E;  1X49 A;  2N3G A;  3ADL A;  2YT4 A;  1N34 E;  4B3R E;  4DV2 E;  2L3C A;  2L2M A;  4YHH E;  1J5E E;  2LRS A;  1N32 E;  4LFB E;  2CPN A;  1WHQ A;  1UIL A;  4YY3 E;  2MDR A;  1T4N A;  1XMQ E;  1X47 A;  4LF5 E;  1FJG E;  4X8W A;  1DI2 A;  4LFA E;  1T4L B;  4M2Z A;  4X62 E;  1PKP A;  2LTR A;  2IHR 1;  2ZM6 E;  1J26 A;  2L3J A;  1XNR E;  1X48 A;  1T4O A;  3OTO E;  1YYO A;  4JI3 E;  3ADJ A;  2DIX A;  4AQY E;  2EZ6 A;  2L33 A; 
#chains in the Genus database with same CATH topology
 3RMP A;  2EPA A;  2FV4 B;  2YSO A;  2EN1 A;  2V87 A;  1P47 A;  4DR5 E;  2CSH A;  4HEI A;  1IMU A;  2M7Q A;  2YWQ A;  1EH8 A;  2B7V A;  1YUI A;  3C6M A;  2I13 A;  2EM5 A;  3THO B;  4MLV A;  1PJT A;  1N3G A;  3P1X A;  4X66 E;  2UXD E;  3J81 C;  5AAS A;  2YPN A;  2JP9 A;  4M30 A;  2B3T B;  3T1H E;  1UN6 B;  3LLH A;  4BC7 A;  2EM7 A;  2PRT A;  2LTS A;  2LBS B;  4NXM E;  4R2C A;  3IWD A;  2MC5 A;  4NXN E;  4DUY E;  2EOS A;  1YYW A;  4DV7 E;  2VQE E;  2UUC E;  1IQS A;  4GZN C;  2EMW A;  2LCE A;  4DV3 E;  2YRH A;  3L00 A;  2R1F A;  2YRM A;  4WPY A;  2JY9 A;  3VK6 A;  1B69 A;  1WXR A;  4ZYE A;  2RTX A;  2V8Q B;  4GKK E;  3EPL A;  2YTJ A;  4KZS A;  1X6E A;  2EMI A;  3BF2 A;  1JK2 A;  4LF7 E;  5KL6 A;  4X64 E;  1X6H A;  4L5N C;  2G7H A;  2E5L E;  2LO3 A;  2EOI A;  2RSM A;  3C4T A;  3BID A;  3KZZ A;  2ADR A;  1PJQ A;  4R2E A;  5A6B A;  2YT4 A;  3KZY A;  2JPA A;  4F9C B;  3C6K A;  1N34 E;  4B3R E;  4IJD A;  2YTE A;  3EPK A;  1J5E E;  1RMD A;  5KL7 A;  1A1K A;  2KON A;  2E1M A;  3EPH A;  3FIG A;  3KWR A;  1NCS A;  2MDR A;  1SFE A;  1YPN A;  2EOE A;  3BBG A;  1EH6 A;  2EM8 A;  1PDA A;  2DGC A;  1PKP A;  3J7A G;  4WXD A;  1J26 A;  2EPM X;  5KL5 A;  2EMZ A;  1T4O A;  2V85 A;  3IWB A;  2L6M A;  2EL6 A;  2F8B A;  3QG5 C;  4R2P A;  2EZ6 A;  2YU8 A;  4JYA E;  3T1Y E;  4LF9 E;  2YTF A;  1XMO E;  2KOU A;  1IBL E;  5AC5 A;  5AC4 A;  4DR3 E;  4KHP E;  1A1I A;  1KJK A;  1G2D C;  4F54 A;  2YZT A;  1A1J A;  1N36 E;  2EM6 A;  1UBD C;  1N33 E;  2L2K B;  2FTX B;  2EM4 A;  4WFT A;  1EKZ A;  5KL2 A;  2EM2 A;  4NHR A;  2VE7 C;  3M99 B;  4JI1 E;  5AE1 A;  2DMY A;  2YTN A;  1DQ3 A;  4BBY A;  4O5G A;  4DR6 E;  2UUB E;  2EM0 A;  4DV6 E;  5IT9 C;  2JYA A;  2LJH A;  3OML A;  1GQE A;  2EL5 A;  4ZYD A;  2YTD A;  2DMI A;  2EN7 A;  3LML A;  4DKK A;  2DB2 A;  3J7Y p;  2EMK A;  4BC9 A;  1X3C A;  2R76 A;  1ZBQ A;  4R2Q A;  4J8Z A;  1GTK A;  4JI4 E;  2FGG A;  3H09 A;  2JOX A;  1WHN A;  5BR8 E;  2LUP B;  2EOH A;  5CFF E;  2VRD A;  5LMN E;  5IXM B;  2ODR D;  1QU6 A;  4RH8 A;  2HC5 A;  3VYX A;  2EOR A;  4LF6 E;  2N3H A;  2JOB A;  5AE2 A;  4WX9 A;  4DR2 E;  2UXC E;  2EMF A;  4O24 A;  2UXB E;  4P78 A;  2H36 X;  4B3S E;  1STU A;  5ADZ A;  5F3W A;  3AUZ A;  1XNQ E;  4LTY A;  2NAB A;  3ZOQ B;  2F4V E;  4DV5 E;  1YFH A;  2BB8 A;  5A6A A;  1HNX E;  2EPK X;  3HPS A;  3JAM C;  4LF8 E;  4F6N A;  1X49 A;  4LU9 A;  2EOY A;  3ADL A;  2V86 A;  2EMY A;  2EP3 A;  4BHC A;  2BBG A;  2MKN A;  3AV0 A;  4YHH E;  2EPR A;  2EOZ A;  1UIL A;  4ZYG A;  4YY3 E;  2D9H A;  4ZYH A;  2JWO A;  2EMX A;  2EQ3 A;  2YTQ A;  3K6Q A;  4LF5 E;  2EPX A;  1DI2 A;  4LFA E;  4Q35 B;  4R2D A;  2ELY A;  4F9B B;  2J7J A;  2LE2 A;  2EOX A;  5A2Q C;  1XNR E;  3F6G A;  2CT1 A;  2B9D A;  4NZV A;  2L33 A;  1FKA E;  4JI0 E;  4BMJ A;  2EOM A;  3VHT B;  5KL4 A;  4DUZ E;  4BS9 A;  4OOG C;  4M9V C;  4B3T E;  2EMB A;  4BCA A;  3EPJ A;  1G2F C;  1AH5 A;  4LF4 E;  2I9I A;  5KL3 A;  4F2J C;  2RSI A;  4WYQ B;  2YRK A;  2MKD A;  1SR9 A;  1MEY C;  2KHX A;  2EMA A;  3UK3 C;  2JR1 A;  1DGC A;  1IQO A;  4X9J A;  1KYQ A;  1HR0 E;  2JXP A;  4X65 E;  4FK5 C;  2RS7 A;  2EMH A;  2YSP A;  2DSY A;  2EJ4 A;  2NA2 A;  1UHZ A;  1HNW E;  4DR1 E;  5A6K A;  4P7D A;  4GEQ B;  2EN8 A;  2LMZ A;  5LLQ A;  2EM3 A;  3HQ1 A;  2EWL A;  4M0V A;  3C4B A;  1A1L A;  2UU9 E;  4GKJ E;  5FLX C;  4F6M A;  3HXL A;  1YSA C;  3BGH A;  4I8O A;  1HNZ E;  4JI8 E;  1X5W A;  2K7I A;  1AAY A;  1BBG A;  1BBO A;  2EL4 A;  2MC6 A;  4O4K A;  2EN4 A;  5TSE A;  2UUA E;  2NUE A;  2DLQ A;  4JI7 E;  2DRP A;  2EPU A;  2EOF A;  4DV1 E;  3THN A;  1IBK E;  3VYY A;  2EPN A;  2YTI A;  2NUG A;  5AE3 A;  1A1F A;  1JK1 A;  4DMI A;  3HTX A;  1GZ6 A;  2B7T A;  2ELZ A;  4K0K E;  2Q8U A;  2EMG A;  2EN2 A;  1PJS A;  4R2S A;  4DR7 E;  2N3G A;  2RPC A;  2L3C A;  2L2M A;  4F9A B;  4KWY A;  2LRS A;  1N32 E;  5T6J A;  1WHQ A;  4BHB A;  3MSW A;  3ECR A;  1T4N A;  2CTD A;  2EMC A;  4IS1 C;  1X47 A;  1FJG E;  3JTZ A;  2EOO A;  1TN9 A;  1X48 A;  2YTG A;  1NEI A;  2A25 A;  2EM9 A;  2LV2 A;  1YYO A;  3ADJ A;  1T38 A;  2DIX A;  4AQY E;  1TF6 A;  4JI3 E;  1L4S A;  1ZAA C;  5DNY A;  4R8O A;  2EN3 A;  2K4V A;  2EE8 A;  2EPO A;  2LT7 A;  1YYK A;  1WRJ A;  4TUG A;  4R03 A;  4JV5 E;  2EPL X;  3J80 C;  2VQF E;  1I94 E;  1ZBT A;  2WZO A;  2EOQ A;  3F6H A;  5LL6 R;  2WCC 3;  1EH7 A;  2HJJ A;  2E72 A;  4MLQ A;  2EQ0 A;  1LLM C;  2MDG A;  2ENH A;  5LMU E;  2ENA A;  2L8T A;  2ENC A;  2M4I A;  4RHB B;  5A69 A;  5A6B D;  4DR4 E;  4N4R B;  2GLI A;  4OX9 E;  5IWA E;  2WBU A;  5A6J A;  2EQ1 A;  2JVA A;  2NUF A;  4JI6 E;  1A1G A;  1YUJ A;  4WSP A;  1Z1B A;  3MHS C;  5IV8 B;  4JI5 E;  1RC7 A;  4JI2 E;  2LVH A;  2L2N A;  2LUQ A;  3MHH C;  2ODR C;  4Q28 A;  1O0W A;  1BB8 A;  3ADI A;  1WJP A;  4TUI A;  2N8X A;  4DV0 E;  3DJW A;  2EPP A;  4DV4 E;  2HGH A;  1MGT A;  2EPZ A;  1ZR9 A;  1F2I G;  2HHH E;  3ADG A;  3IWC A;  1X6F A;  3EQ1 A;  1RQ0 A;  4B3M E;  2V83 A;  4HTG A;  1ZU1 A;  2L92 A;  4LFC E;  1IBM E;  1T39 A;  4O43 A;  1A1H A;  4WSG A;  2RS6 A;  2WBT A;  2M1S A;  1YZ9 A;  2GHF A;  4R2A A;  1TF3 A;  4DV2 E;  3TQM A;  4LFB E;  2CPN A;  4WXC A;  2VF1 A;  2DLK A;  2LJU A;  2M9A A;  4R2R A;  2WBS A;  2V89 A;  2V88 A;  2YU5 A;  1QNT A;  1XMQ E;  2EOJ A;  3DF6 A;  4X8W A;  1T4L B;  4M2Z A;  4X62 E;  2YTP A;  2LTR A;  2EML A;  2EN6 A;  2IHR 1;  2ZM6 E;  3JU0 A;  2L3J A;  2YTO A;  3HPZ A;  2GPI A;  4L8N A;  2EPC A;  2RQL A;  3OTO E; 
#chains in the Genus database with same CATH homology
 3RMP A;  2FV4 B;  4JYA E;  5DNY A;  4R8O A;  3T1Y E;  4LF9 E;  2V87 A;  1FKA E;  1XMO E;  2KOU A;  1IBL E;  2K4V A;  4DR5 E;  1YYK A;  4DR3 E;  4JI0 E;  4BMJ A;  4KHP E;  4TUG A;  4F54 A;  4R03 A;  2YZT A;  4JV5 E;  4DUZ E;  2M7Q A;  3J80 C;  1N36 E;  2B7V A;  4BS9 A;  2VQF E;  1I94 E;  4OOG C;  1ZBT A;  4B3T E;  4BCA A;  1N33 E;  2WZO A;  3F6H A;  5LL6 R;  4LF4 E;  2L2K B;  2FTX B;  4WYQ B;  3P1X A;  4WFT A;  4X66 E;  1EKZ A;  1SR9 A;  2UXD E;  2KHX A;  2VE7 C;  3J81 C;  2JR1 A;  5AAS A;  2NUG A;  4M30 A;  2B3T B;  5LMU E;  5AE1 A;  1HR0 E;  2L8T A;  3T1H E;  4JI1 E;  2DMY A;  4X65 E;  2M4I A;  3LLH A;  4BC7 A;  2RS7 A;  1DQ3 A;  4BBY A;  2DSY A;  2LTS A;  4DR4 E;  2NA2 A;  1UHZ A;  2LBS B;  4DR6 E;  1HNW E;  4DR1 E;  4NXM E;  4OX9 E;  4P7D A;  4GEQ B;  3IWD A;  2MC5 A;  2LMZ A;  5IWA E;  2UUB E;  4NXN E;  4DUY E;  3HQ1 A;  2EWL A;  1YYW A;  4DV6 E;  4DV7 E;  4M0V A;  2JVA A;  2VQE E;  5IT9 C;  2NUF A;  3C4B A;  2UUC E;  4B3M E;  4JI6 E;  2LJH A;  3OML A;  1GQE A;  4WSP A;  2UU9 E;  4DV3 E;  4JI5 E;  1RC7 A;  4JI2 E;  3LML A;  4DKK A;  2DB2 A;  2L2N A;  2LUQ A;  3J7Y p;  4GKJ E;  4BC9 A;  4WPY A;  2ODR C;  5FLX C;  2JY9 A;  4Q28 A;  3VK6 A;  1O0W A;  1WXR A;  1ZBQ A;  3HXL A;  4J8Z A;  3ADI A;  4JI4 E;  2FGG A;  2RTX A;  3H09 A;  4I8O A;  2V8Q B;  4JI8 E;  1HNZ E;  4GKK E;  2JOX A;  4KZS A;  1WHN A;  5BR8 E;  4TUI A;  4DV0 E;  2LUP B;  5CFF E;  2MC6 A;  3DJW A;  5LMN E;  4DV4 E;  2UUA E;  2NUE A;  2ODR D;  1QU6 A;  4JI7 E;  2HHH E;  3ADG A;  4LF7 E;  3VYX A;  4LF6 E;  3IWC A;  4DV1 E;  2N3H A;  2JOB A;  5AE2 A;  4DR2 E;  1IBK E;  3VYY A;  2UXC E;  2UXB E;  1RQ0 A;  4P78 A;  5AE3 A;  2H36 X;  4X64 E;  4B3S E;  2V83 A;  1STU A;  4DMI A;  4L5N C;  5ADZ A;  5F3W A;  2G7H A;  3AUZ A;  4LTY A;  2L92 A;  1XNQ E;  1GZ6 A;  2B7T A;  3ZOQ B;  2RSM A;  1IBM E;  2E5L E;  4LFC E;  3HTX A;  2F4V E;  4K0K E;  3C4T A;  4DV5 E;  1HNX E;  2RS6 A;  2M1S A;  3HPS A;  3JAM C;  1YZ9 A;  4DR7 E;  4LF8 E;  1X49 A;  2N3G A;  4LU9 A;  3ADL A;  2V86 A;  2YT4 A;  4F9C B;  1N34 E;  4B3R E;  4DV2 E;  2L3C A;  3AV0 A;  2L2M A;  4F9A B;  4YHH E;  2LRS A;  1J5E E;  1YYO A;  1N32 E;  5T6J A;  4LFB E;  2KON A;  2CPN A;  2E1M A;  1WHQ A;  1UIL A;  2VF1 A;  3FIG A;  4YY3 E;  3KWR A;  2JWO A;  2MDR A;  2V89 A;  3MSW A;  2V88 A;  1T4N A;  3K6Q A;  1XMQ E;  1X47 A;  3DF6 A;  4LF5 E;  4X8W A;  1FJG E;  1DI2 A;  4LFA E;  1T4L B;  3JTZ A;  4X62 E;  4M2Z A;  1PKP A;  3J7A G;  2LTR A;  2IHR 1;  4F9B B;  2ZM6 E;  3JU0 A;  1J26 A;  2LE2 A;  5A2Q C;  2L3J A;  1XNR E;  1X48 A;  3F6G A;  3HPZ A;  1T4O A;  2B9D A;  2V85 A;  3IWB A;  2L6M A;  2F8B A;  2DIX A;  3ADJ A;  4L8N A;  3OTO E;  4AQY E;  4JI3 E;  2EZ6 A;  2L33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...