3VYYA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase a (dhx9)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase A
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyyA00
4DR5E 1N34E 1T4NA 1FKAE 2DMYA 4M2ZA 1YZ9A 4X66E 4GKJE 2NA2A 2LJHA 4X8WA 1HNXE 1QU6A 4B3TE 1YYWA 3VYYA 3OTOE 2CPNA 4X62E 5CFFE 4LF6E 4JI5E 4OX9E 1XMOE 4LF5E 4KHPE 4JV5E 2VQFE 4DR1E 1N36E 2L2NA 4NXME 2B7VA 4B3ME 1UILA 4DR4E 1T4OA 4LF9E 3T1YE 2UUBE 4JI6E 1IBLE 1XNRE 4DV1E 4X65E 1ZBTA 4DV5E 1I94E 1XNQE 2NUGA 4WFTA 1XMQE 4JI8E 1FJGE 5LMNE 1YYOA 2LBSB 1PKPA 3J7Yp 1IBME 4GKKE 1IBKE 2N3GA 2LRSA 1YYKA 1WHQA 1X49A 1T4LB 2DB2A 4DR7E 1UHZA 2EZ6A 4JYAE 1EKZA 2RTXA 3VYXA 2UXBE 4LF4E 4DR6E 4B3RE 5LMUE 2IHR1 4LFAE 1HR0E 2UUCE 2L3JA 1DI2A 4DR2E 3ADGA 4JI4E 2KHXA 3LLHA 4LF8E 4LF7E 2JY9A 1J5EE 3HTXA 1HNWE 2LUQA 3C4TA 4JI7E 1O0WA 2NUEA 2UXDE 4AQYE 2UUAE 4DV2E 4DKKA 2UU9E 4LFBE 2LUPB 2L3CA 4DUZE 4X64E 2F4VE 4JI1E 3ADIA 3P1XA 4LFCE 2E5LE 1N33E 4DV4E 1RQ0A 2YT4A 2B3TB 2L2KB 4NXNE 2RS7A 4JI3E 4JI2E 2JVAA 2ZM6E 4WYQB 3ADJA 1N32E 3C4BA 2B7TA 4DV0E 4DV3E 4B3SE 1WHNA 2RS6A 3ADLA 1GQEA 3T1HE 2LTSA 2RSMA 4K0KE 1STUA 4DV7E 1X47A 2HHHE 4JI0E 2LTRA 2NUFA 2MDRA 2N3HA 4YY3E 4YHHE 1J26A 2VQEE 5BR8E 1RC7A 2DIXA 2L2MA 4M30A 2UXCE 4OOGC 4DR3E 1HNZE 5IWAE 4DV6E 1X48A 2L33A 4DUYE
chains in the Genus database with same CATH superfamily
2NA2A 2EM5A 1Z1BA 1BBOA 1ZU1A 2CT1A 1QU6A 4B3TE 2E1MA 3H09A 1A1IA 4GEQB 2EOJA 4BBYA 4O43A 5CFFE 4JI5E 5FLXC 2EOMA 4LF5E 2EMCA 4X9JA 5ADZA 3BGHA 4R2AA 5AC5A 1N36E 2L2NA 3DF6A 4R03A 1P47A 5IXMB 2GHFA 2V86A 3J80C 4JI6E 1WXRA 3UK3C 5A6AA 2M9AA 1XNQE 4WSPA 2ENAA 2A25A 2EN1A 1WJPA 4JI8E 2ELYA 5AC4A 5A6BD 2HGHA 2M7QA 1T39A 1PKPA 3EPLA 3TQMA 3K6QA 5A69A 1PJTA 2EM4A 4R2RA 1YYKA 1IMUA 1T4LB 2YRMA 1EKZA 2RTXA 5LLQA 2L6MA 4MLQA 2G7HA 3EPKA 1YSAC 2EPAA 4LF4E 4DR6E 2LE2A 4B3RE 5TSEA 2EMFA 2Q8UA 3BF2A 4DR2E 2EPKX 4WSGA 4LF7E 2ENCA 1QNTA 2LUQA 5A6KA 1KJKA 2EPOA 4JI7E 4ZYEA 4Q35B 5AE1A 3MHHC 4LFBE 2WBTA 1X6EA 4O5GA 2F4VE 4JI1E 3HPZA 4LFCE 4LU9A 4ZYHA 2WCC3 2FV4B 1RQ0A 3THOB 4NHRA 3JAMC 2L2KB 2RS7A 2EN7A 4JI2E 2ZM6E 3C4BA 4DV3E 4F9AB 2M4IA 4R2PA 2EM6A 2JOXA 2RS6A 2GPIA 3ADLA 2DSYA 3IWBA 5KL3A 5IT9C 3EPJA 4L8NA 1X47A 4ZYGA 2EL5A 1G2DC 2LTRA 2HHHE 1JK1A 4BCAA 2H36X 4HTGA 2EM3A 1YPNA 4YY3E 2YTQA 2ELZA 1J26A 2VQEE 4DMIA 2DRPA 4M30A 4R2EA 1KYQA 4DV6E 2YZTA 2EOEA 1X48A 1SR9A 2L33A 4BHBA 4IS1C 2EMKA 4GKJE 2R1FA 4F9CB 3IWCA 4M0VA 2LO3A 3M99B 1HNXE 4Q28A 2VE7C 3VYYA 3OTOE 1A1KA 2CPNA 1JK2A 4LF6E 5AE2A 1XMOE 3IWDA 2YSOA 2VQFE 4NXME 2B7VA 2EOQA 1UILA 4M9VC 1T4OA 4LF9E 1X6HA 1ZR9A 1ZBTA 5AASA 4GZNC 1I94E 5KL2A 2F8BA 4I8OA 1FJGE 2DLKA 2RQLA 5A2QC 2EMLA 2YTGA 2YTFA 1TF6A 2E72A 3J7Yp 2YTOA 1N3GA 2EPPA 4R2DA 2LT7A 3MHSC 2LRSA 1LLMC 3F6GA 3DJWA 1TN9A 2YTEA 2EPXA 2JPAA 1A1FA 3HQ1A 4R2CA 4BS9A 2JOBA 4LFAE 1HR0E 2L3JA 1DI2A 3KWRA 2JXPA 3HTXA 2EN4A 2EPRA 3ZOQB 1F2IG 4P78A 4DV2E 4O24A 3QG5C 2EMGA 3VHTB 2EL4A 5T6JA 4DUZE 1X3CA 3P1XA 4F2JC 2I13A 1AAYA 4JI3E 5LL6R 4NZVA 2JVAA 4WYQB 2EMHA 3ADJA 1N32E 4BC9A 2KONA 1RMDA 2V89A 1TF3A 4HEIA 5F3WA 4K0KE 3C6KA 2EP3A 1IQOA 2FGGA 2EOIA 3EQ1A 3LMLA 2CTDA 2HC5A 2YU8A 1YFHA 4KZSA 4OOGC 4DR3E 1HNZE 2J7JA 3THNA 4DR5E 1N34E 4M2ZA 2ENHA 1YZ9A 3BBGA 5DNYA 4IJDA 1GZ6A 2LJHA 4X8WA 2EE8A 3ECRA 2WZOA 2JWOA 2MKDA 4WXCA 5AE3A 5IV8B 2VRDA 4X62E 1L4SA 2EOXA 4F6NA 3VK6A 4OX9E 4KHPE 2EOOA 4F9BB 4B3ME 4N4RB 3HXLA 2LV2A 2EOYA 3T1YE 1X5WA 2EN3A 1XNRE 4DV1E 4X65E 4DV5E 2EQ1A 2NUGA 4J8ZA 1XMQE 4BHCA 2LBSB 2YTDA 1IBME 2V85A 2BB8A 5KL4A 4GKKE 2EPLX 5KL6A 2EPCA 1IBKE 2EOFA 1WHQA 2EN8A 4DR7E 2EZ6A 4F6MA 2M1SA 2I9IA 2LVHA 2N8XA 2EOSA 4WPYA 2WBUA 2UXBE 3KZYA 5LMUE 2IHR1 2K4VA 2EPUA 2D9HA 4JI4E 2KHXA 1B69A 2YSPA 1DQ3A 2V87A 3LLHA 2JYAA 2EOHA 4LF8E 1O0WA 2EM0A 2UXDE 3FIGA 3KZZA 1EH8A 4DKKA 3JU0A 4R2QA 2UU9E 3EPHA 2EL6A 1PJQA 1PJSA 4F54A 1T38A 1A1LA 1PDAA 2YRKA 2DGCA 2E5LE 4DV4E 1BB8A 1NEIA 2EQ0A 1IQSA 1UN6B 1ZAAC 4DV0E 2LMZA 1WHNA 1YUIA 1X6FA 3HPSA 4FK5C 1NCSA 2LTSA 2RSMA 5A6JA 1STUA 2HJJA 2KOUA 2NUFA 2EM7A 1WRJA 4YHHE 2EPMX 2BBGA 2YTIA 2EM2A 2MDGA 5BR8E 1RC7A 2L2MA 1EH6A 2UXCE 4BC7A 3RMPA 4DUYE 1FKAE 1T4NA 1A1HA 2DMYA 4X66E 3AUZA 2EM8A 2DMIA 4L5NC 2V8QB 1YYWA 2EMBA 1A1JA 1DGCA 2YTJA 2K7IA 4JV5E 4RH8A 4DR1E 1G2FC 4WXDA 2R76A 2EM9A 2YU5A 2NABA 1UBDC 2RPCA 2EMAA 4DR4E 2L8TA 4BMJA 4LTYA 2UUBE 1IBLE 4RHBB 4O4KA 5A6BA 2EN2A 4P7DA 4WFTA 2YTPA 5LMNE 1YYOA 2MC5A 1SFEA 2YPNA 2EPNA 2EQ3A 2YWQA 2N3GA 3L00A 2EN6A 1X49A 2FTXB 2DB2A 2L92A 1UHZA 4JYAE 2RSIA 3VYXA 2EMZA 2ODRD 4TUIA 2EOZA 5KL7A 1GTKA 1A1GA 2UUCE 3ADGA 4TUGA 1MGTA 2EMIA 2YTNA 3BIDA 5KL5A 2EWLA 2CSHA 2JY9A 2YRHA 1J5EE 1HNWE 2V83A 3C4TA 2NUEA 4AQYE 4WX9A 2EMYA 2EMWA 2VF1A 3C6MA 2UUAE 2LJUA 2LUPB 2L3CA 2PRTA 3J7AG 4X64E 2ADRA 4KWYA 2ODRC 1ZBQA 2EMXA 3ADIA 1N33E 3J81C 1YUJA 2YT4A 2B3TB 4NXNE 4R8OA 2GLIA 3F6HA 1AH5A 2EPZA 1MEYC 3OMLA 2LCEA 2B7TA 2V88A 4ZYDA 4B3SE 4MLVA 2EORA 2DLQA 1GQEA 3T1HE 4DV7E 2MKNA 4JI0E 2MDRA 3JTZA 2EJ4A 2N3HA 3MSWA 2WBSA 4R2SA 2JP9A 2DIXA 3AV0A 5IWAE 2B9DA 2JR1A 1BBGA 1EH7A 2MC6A
chains in the Genus database with same CATH topology
4DR5E 1N34E 1T4NA 1FKAE 2DMYA 4F9CB 4M2ZA 4X66E 1YZ9A 2NA2A 5DNYA 1GZ6A 2LJHA 3AUZA 3IWCA 4M0VA 4X8WA 4L5NC 1HNXE 1QU6A 4B3TE 2E1MA 2VE7C 2V8QB 3H09A 4GEQB 4Q28A 2WZOA 3OTOE 3VYYA 1YYWA 2JWOA 4BBYA 5AE3A 2CPNA 4X62E 5CFFE 4LF6E 4JI5E 5FLXC 3VK6A 5AE2A 1XMOE 4LF5E 4OX9E 4KHPE 4JV5E 3IWDA 2VQFE 4DR1E 5ADZA 1N36E 4F9BB 2L2NA 4NXME 2B7VA 3DF6A 4B3ME 4R03A 1UILA 3HXLA 4DR4E 1T4OA 2L8TA 4LF9E 3T1YE 1X48A 2V86A 4BMJA 3J80C 4LTYA 2UUBE 1WXRA 1IBLE 4JI6E 1XNRE 4DV1E 4X65E 1ZBTA 4DV5E 5AASA 1I94E 1XNQE 4P7DA 2F8BA 4J8ZA 4WSPA 2NUGA 4WFTA 4I8OA 1XMQE 4JI8E 1FJGE 5A2QC 2M7QA 5LMNE 4GKJE 1YYOA 2MC5A 2LBSB 1PKPA 3J7Yp 2V85A 1IBME 4GKKE 3K6QA 1IBKE 2N3GA 2LRSA 3F6GA 3DJWA 1YYKA 1WHQA 1X49A 2FTXB 2DB2A 2L92A 1T4LB 3HQ1A 4DR7E 1UHZA 2EZ6A 2M1SA 4JYAE 1EKZA 2RTXA 3VYXA 4WPYA 2ODRD 2L6MA 4BS9A 2G7HA 2UXBE 4TUIA 4LF4E 4DUYE 2JOBA 4DR6E 2LE2A 4B3RE 5LMUE 2IHR1 2K4VA 4LFAE 1HR0E 2UUCE 2L3JA 1DI2A 4DR2E 3ADGA 4TUGA 4JI4E 2KHXA 1DQ3A 2V87A 3KWRA 3LLHA 2EWLA 4LF7E 2JY9A 1J5EE 4LF8E 3HTXA 1HNWE 2LUQA 2V83A 3C4TA 4JI7E 1O0WA 3ZOQB 2NUEA 2UXDE 4AQYE 4P78A 3FIGA 2VF1A 2UUAE 4DV2E 4DKKA 3JU0A 5AE1A 2UU9E 4LFBE 4F54A 2LUPB 2L3CA 5T6JA 4DUZE 3J7AG 4X64E 2F4VE 4JI1E 2ODRC 1ZBQA 3HPZA 3P1XA 3ADIA 4LFCE 4LU9A 2E5LE 1N33E 2FV4B 1RQ0A 3JAMC 3J81C 2YT4A 2B3TB 2L2KB 4DV4E 4NXNE 2RS7A 4R8OA 4JI3E 4JI2E 3F6HA 5LL6R 2JVAA 3OMLA 2ZM6E 4WYQB 3ADJA 1N32E 3C4BA 2B7TA 2V88A 4BC9A 2KONA 4DV0E 4F9AB 4DV3E 4B3SE 2M4IA 2LMZA 2V89A 1WHNA 2JOXA 4K0KE 2RS6A 3HPSA 5F3WA 3ADLA 2DSYA 1GQEA 3IWBA 2LTSA 2RSMA 3T1HE 5IT9C 1STUA 4L8NA 1X47A 4DV7E 2HHHE 4JI0E 2LTRA 2KOUA 4BCAA 2NUFA 2MDRA 2H36X 2FGGA 3JTZA 2N3HA 4YY3E 3MSWA 4YHHE 1J26A 2VQEE 3LMLA 5BR8E 4DMIA 1RC7A 2DIXA 2L2MA 4M30A 2UXCE 4KZSA 4OOGC 4BC7A 4DR3E 3AV0A 5IWAE 4DV6E 2B9DA 3RMPA 2YZTA 2JR1A 1HNZE 1SR9A 2L33A 2MC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  1N34 E;  1T4N A;  1FKA E;  2DMY A;  4M2Z A;  1YZ9 A;  4X66 E;  4GKJ E;  2NA2 A;  2LJH A;  4X8W A;  1HNX E;  1QU6 A;  4B3T E;  1YYW A;  3VYY A;  3OTO E;  2CPN A;  4X62 E;  5CFF E;  4LF6 E;  4JI5 E;  4OX9 E;  1XMO E;  4LF5 E;  4KHP E;  4JV5 E;  2VQF E;  4DR1 E;  1N36 E;  2L2N A;  4NXM E;  2B7V A;  4B3M E;  1UIL A;  4DR4 E;  1T4O A;  4LF9 E;  3T1Y E;  2UUB E;  4JI6 E;  1IBL E;  1XNR E;  4DV1 E;  4X65 E;  1ZBT A;  4DV5 E;  1I94 E;  1XNQ E;  2NUG A;  4WFT A;  1XMQ E;  4JI8 E;  1FJG E;  5LMN E;  1YYO A;  2LBS B;  1PKP A;  3J7Y p;  1IBM E;  4GKK E;  1IBK E;  2N3G A;  2LRS A;  1YYK A;  1WHQ A;  1X49 A;  1T4L B;  2DB2 A;  4DR7 E;  1UHZ A;  2EZ6 A;  4JYA E;  1EKZ A;  2RTX A;  3VYX A;  2UXB E;  4LF4 E;  4DR6 E;  4B3R E;  5LMU E;  2IHR 1;  4LFA E;  1HR0 E;  2UUC E;  2L3J A;  1DI2 A;  4DR2 E;  3ADG A;  4JI4 E;  2KHX A;  3LLH A;  4LF8 E;  4LF7 E;  2JY9 A;  1J5E E;  3HTX A;  1HNW E;  2LUQ A;  3C4T A;  4JI7 E;  1O0W A;  2NUE A;  2UXD E;  4AQY E;  2UUA E;  4DV2 E;  4DKK A;  2UU9 E;  4LFB E;  2LUP B;  2L3C A;  4DUZ E;  4X64 E;  2F4V E;  4JI1 E;  3ADI A;  3P1X A;  4LFC E;  2E5L E;  1N33 E;  4DV4 E;  1RQ0 A;  2YT4 A;  2B3T B;  2L2K B;  4NXN E;  2RS7 A;  4JI3 E;  4JI2 E;  2JVA A;  2ZM6 E;  4WYQ B;  3ADJ A;  1N32 E;  3C4B A;  2B7T A;  4DV0 E;  4DV3 E;  4B3S E;  1WHN A;  2RS6 A;  3ADL A;  1GQE A;  3T1H E;  2LTS A;  2RSM A;  4K0K E;  1STU A;  4DV7 E;  1X47 A;  2HHH E;  4JI0 E;  2LTR A;  2NUF A;  2MDR A;  2N3H A;  4YY3 E;  4YHH E;  1J26 A;  2VQE E;  5BR8 E;  1RC7 A;  2DIX A;  2L2M A;  4M30 A;  2UXC E;  4OOG C;  4DR3 E;  1HNZ E;  5IWA E;  4DV6 E;  1X48 A;  2L33 A;  4DUY E; 
#chains in the Genus database with same CATH topology
 2NA2 A;  2EM5 A;  1Z1B A;  1BBO A;  1ZU1 A;  2CT1 A;  1QU6 A;  4B3T E;  2E1M A;  3H09 A;  1A1I A;  4GEQ B;  2EOJ A;  4BBY A;  4O43 A;  5CFF E;  4JI5 E;  5FLX C;  2EOM A;  4LF5 E;  2EMC A;  4X9J A;  5ADZ A;  3BGH A;  4R2A A;  5AC5 A;  1N36 E;  2L2N A;  3DF6 A;  4R03 A;  1P47 A;  5IXM B;  2GHF A;  2V86 A;  3J80 C;  4JI6 E;  1WXR A;  3UK3 C;  5A6A A;  2M9A A;  1XNQ E;  4WSP A;  2ENA A;  2A25 A;  2EN1 A;  1WJP A;  4JI8 E;  2ELY A;  5AC4 A;  5A6B D;  2HGH A;  2M7Q A;  1T39 A;  1PKP A;  3EPL A;  3TQM A;  3K6Q A;  5A69 A;  1PJT A;  2EM4 A;  4R2R A;  1YYK A;  1IMU A;  1T4L B;  2YRM A;  1EKZ A;  2RTX A;  5LLQ A;  2L6M A;  4MLQ A;  2G7H A;  3EPK A;  1YSA C;  2EPA A;  4LF4 E;  4DR6 E;  2LE2 A;  4B3R E;  5TSE A;  2EMF A;  2Q8U A;  3BF2 A;  4DR2 E;  2EPK X;  4WSG A;  4LF7 E;  2ENC A;  1QNT A;  2LUQ A;  5A6K A;  1KJK A;  2EPO A;  4JI7 E;  4ZYE A;  4Q35 B;  5AE1 A;  3MHH C;  4LFB E;  2WBT A;  1X6E A;  4O5G A;  2F4V E;  4JI1 E;  3HPZ A;  4LFC E;  4LU9 A;  4ZYH A;  2WCC 3;  2FV4 B;  1RQ0 A;  3THO B;  4NHR A;  3JAM C;  2L2K B;  2RS7 A;  2EN7 A;  4JI2 E;  2ZM6 E;  3C4B A;  4DV3 E;  4F9A B;  2M4I A;  4R2P A;  2EM6 A;  2JOX A;  2RS6 A;  2GPI A;  3ADL A;  2DSY A;  3IWB A;  5KL3 A;  5IT9 C;  3EPJ A;  4L8N A;  1X47 A;  4ZYG A;  2EL5 A;  1G2D C;  2LTR A;  2HHH E;  1JK1 A;  4BCA A;  2H36 X;  4HTG A;  2EM3 A;  1YPN A;  4YY3 E;  2YTQ A;  2ELZ A;  1J26 A;  2VQE E;  4DMI A;  2DRP A;  4M30 A;  4R2E A;  1KYQ A;  4DV6 E;  2YZT A;  2EOE A;  1X48 A;  1SR9 A;  2L33 A;  4BHB A;  4IS1 C;  2EMK A;  4GKJ E;  2R1F A;  4F9C B;  3IWC A;  4M0V A;  2LO3 A;  3M99 B;  1HNX E;  4Q28 A;  2VE7 C;  3VYY A;  3OTO E;  1A1K A;  2CPN A;  1JK2 A;  4LF6 E;  5AE2 A;  1XMO E;  3IWD A;  2YSO A;  2VQF E;  4NXM E;  2B7V A;  2EOQ A;  1UIL A;  4M9V C;  1T4O A;  4LF9 E;  1X6H A;  1ZR9 A;  1ZBT A;  5AAS A;  4GZN C;  1I94 E;  5KL2 A;  2F8B A;  4I8O A;  1FJG E;  2DLK A;  2RQL A;  5A2Q C;  2EML A;  2YTG A;  2YTF A;  1TF6 A;  2E72 A;  3J7Y p;  2YTO A;  1N3G A;  2EPP A;  4R2D A;  2LT7 A;  3MHS C;  2LRS A;  1LLM C;  3F6G A;  3DJW A;  1TN9 A;  2YTE A;  2EPX A;  2JPA A;  1A1F A;  3HQ1 A;  4R2C A;  4BS9 A;  2JOB A;  4LFA E;  1HR0 E;  2L3J A;  1DI2 A;  3KWR A;  2JXP A;  3HTX A;  2EN4 A;  2EPR A;  3ZOQ B;  1F2I G;  4P78 A;  4DV2 E;  4O24 A;  3QG5 C;  2EMG A;  3VHT B;  2EL4 A;  5T6J A;  4DUZ E;  1X3C A;  3P1X A;  4F2J C;  2I13 A;  1AAY A;  4JI3 E;  5LL6 R;  4NZV A;  2JVA A;  4WYQ B;  2EMH A;  3ADJ A;  1N32 E;  4BC9 A;  2KON A;  1RMD A;  2V89 A;  1TF3 A;  4HEI A;  5F3W A;  4K0K E;  3C6K A;  2EP3 A;  1IQO A;  2FGG A;  2EOI A;  3EQ1 A;  3LML A;  2CTD A;  2HC5 A;  2YU8 A;  1YFH A;  4KZS A;  4OOG C;  4DR3 E;  1HNZ E;  2J7J A;  3THN A;  4DR5 E;  1N34 E;  4M2Z A;  2ENH A;  1YZ9 A;  3BBG A;  5DNY A;  4IJD A;  1GZ6 A;  2LJH A;  4X8W A;  2EE8 A;  3ECR A;  2WZO A;  2JWO A;  2MKD A;  4WXC A;  5AE3 A;  5IV8 B;  2VRD A;  4X62 E;  1L4S A;  2EOX A;  4F6N A;  3VK6 A;  4OX9 E;  4KHP E;  2EOO A;  4F9B B;  4B3M E;  4N4R B;  3HXL A;  2LV2 A;  2EOY A;  3T1Y E;  1X5W A;  2EN3 A;  1XNR E;  4DV1 E;  4X65 E;  4DV5 E;  2EQ1 A;  2NUG A;  4J8Z A;  1XMQ E;  4BHC A;  2LBS B;  2YTD A;  1IBM E;  2V85 A;  2BB8 A;  5KL4 A;  4GKK E;  2EPL X;  5KL6 A;  2EPC A;  1IBK E;  2EOF A;  1WHQ A;  2EN8 A;  4DR7 E;  2EZ6 A;  4F6M A;  2M1S A;  2I9I A;  2LVH A;  2N8X A;  2EOS A;  4WPY A;  2WBU A;  2UXB E;  3KZY A;  5LMU E;  2IHR 1;  2K4V A;  2EPU A;  2D9H A;  4JI4 E;  2KHX A;  1B69 A;  2YSP A;  1DQ3 A;  2V87 A;  3LLH A;  2JYA A;  2EOH A;  4LF8 E;  1O0W A;  2EM0 A;  2UXD E;  3FIG A;  3KZZ A;  1EH8 A;  4DKK A;  3JU0 A;  4R2Q A;  2UU9 E;  3EPH A;  2EL6 A;  1PJQ A;  1PJS A;  4F54 A;  1T38 A;  1A1L A;  1PDA A;  2YRK A;  2DGC A;  2E5L E;  4DV4 E;  1BB8 A;  1NEI A;  2EQ0 A;  1IQS A;  1UN6 B;  1ZAA C;  4DV0 E;  2LMZ A;  1WHN A;  1YUI A;  1X6F A;  3HPS A;  4FK5 C;  1NCS A;  2LTS A;  2RSM A;  5A6J A;  1STU A;  2HJJ A;  2KOU A;  2NUF A;  2EM7 A;  1WRJ A;  4YHH E;  2EPM X;  2BBG A;  2YTI A;  2EM2 A;  2MDG A;  5BR8 E;  1RC7 A;  2L2M A;  1EH6 A;  2UXC E;  4BC7 A;  3RMP A;  4DUY E;  1FKA E;  1T4N A;  1A1H A;  2DMY A;  4X66 E;  3AUZ A;  2EM8 A;  2DMI A;  4L5N C;  2V8Q B;  1YYW A;  2EMB A;  1A1J A;  1DGC A;  2YTJ A;  2K7I A;  4JV5 E;  4RH8 A;  4DR1 E;  1G2F C;  4WXD A;  2R76 A;  2EM9 A;  2YU5 A;  2NAB A;  1UBD C;  2RPC A;  2EMA A;  4DR4 E;  2L8T A;  4BMJ A;  4LTY A;  2UUB E;  1IBL E;  4RHB B;  4O4K A;  5A6B A;  2EN2 A;  4P7D A;  4WFT A;  2YTP A;  5LMN E;  1YYO A;  2MC5 A;  1SFE A;  2YPN A;  2EPN A;  2EQ3 A;  2YWQ A;  2N3G A;  3L00 A;  2EN6 A;  1X49 A;  2FTX B;  2DB2 A;  2L92 A;  1UHZ A;  4JYA E;  2RSI A;  3VYX A;  2EMZ A;  2ODR D;  4TUI A;  2EOZ A;  5KL7 A;  1GTK A;  1A1G A;  2UUC E;  3ADG A;  4TUG A;  1MGT A;  2EMI A;  2YTN A;  3BID A;  5KL5 A;  2EWL A;  2CSH A;  2JY9 A;  2YRH A;  1J5E E;  1HNW E;  2V83 A;  3C4T A;  2NUE A;  4AQY E;  4WX9 A;  2EMY A;  2EMW A;  2VF1 A;  3C6M A;  2UUA E;  2LJU A;  2LUP B;  2L3C A;  2PRT A;  3J7A G;  4X64 E;  2ADR A;  4KWY A;  2ODR C;  1ZBQ A;  2EMX A;  3ADI A;  1N33 E;  3J81 C;  1YUJ A;  2YT4 A;  2B3T B;  4NXN E;  4R8O A;  2GLI A;  3F6H A;  1AH5 A;  2EPZ A;  1MEY C;  3OML A;  2LCE A;  2B7T A;  2V88 A;  4ZYD A;  4B3S E;  4MLV A;  2EOR A;  2DLQ A;  1GQE A;  3T1H E;  4DV7 E;  2MKN A;  4JI0 E;  2MDR A;  3JTZ A;  2EJ4 A;  2N3H A;  3MSW A;  2WBS A;  4R2S A;  2JP9 A;  2DIX A;  3AV0 A;  5IWA E;  2B9D A;  2JR1 A;  1BBG A;  1EH7 A;  2MC6 A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  1N34 E;  1T4N A;  1FKA E;  2DMY A;  4F9C B;  4M2Z A;  4X66 E;  1YZ9 A;  2NA2 A;  5DNY A;  1GZ6 A;  2LJH A;  3AUZ A;  3IWC A;  4M0V A;  4X8W A;  4L5N C;  1HNX E;  1QU6 A;  4B3T E;  2E1M A;  2VE7 C;  2V8Q B;  3H09 A;  4GEQ B;  4Q28 A;  2WZO A;  3OTO E;  3VYY A;  1YYW A;  2JWO A;  4BBY A;  5AE3 A;  2CPN A;  4X62 E;  5CFF E;  4LF6 E;  4JI5 E;  5FLX C;  3VK6 A;  5AE2 A;  1XMO E;  4LF5 E;  4OX9 E;  4KHP E;  4JV5 E;  3IWD A;  2VQF E;  4DR1 E;  5ADZ A;  1N36 E;  4F9B B;  2L2N A;  4NXM E;  2B7V A;  3DF6 A;  4B3M E;  4R03 A;  1UIL A;  3HXL A;  4DR4 E;  1T4O A;  2L8T A;  4LF9 E;  3T1Y E;  1X48 A;  2V86 A;  4BMJ A;  3J80 C;  4LTY A;  2UUB E;  1WXR A;  1IBL E;  4JI6 E;  1XNR E;  4DV1 E;  4X65 E;  1ZBT A;  4DV5 E;  5AAS A;  1I94 E;  1XNQ E;  4P7D A;  2F8B A;  4J8Z A;  4WSP A;  2NUG A;  4WFT A;  4I8O A;  1XMQ E;  4JI8 E;  1FJG E;  5A2Q C;  2M7Q A;  5LMN E;  4GKJ E;  1YYO A;  2MC5 A;  2LBS B;  1PKP A;  3J7Y p;  2V85 A;  1IBM E;  4GKK E;  3K6Q A;  1IBK E;  2N3G A;  2LRS A;  3F6G A;  3DJW A;  1YYK A;  1WHQ A;  1X49 A;  2FTX B;  2DB2 A;  2L92 A;  1T4L B;  3HQ1 A;  4DR7 E;  1UHZ A;  2EZ6 A;  2M1S A;  4JYA E;  1EKZ A;  2RTX A;  3VYX A;  4WPY A;  2ODR D;  2L6M A;  4BS9 A;  2G7H A;  2UXB E;  4TUI A;  4LF4 E;  4DUY E;  2JOB A;  4DR6 E;  2LE2 A;  4B3R E;  5LMU E;  2IHR 1;  2K4V A;  4LFA E;  1HR0 E;  2UUC E;  2L3J A;  1DI2 A;  4DR2 E;  3ADG A;  4TUG A;  4JI4 E;  2KHX A;  1DQ3 A;  2V87 A;  3KWR A;  3LLH A;  2EWL A;  4LF7 E;  2JY9 A;  1J5E E;  4LF8 E;  3HTX A;  1HNW E;  2LUQ A;  2V83 A;  3C4T A;  4JI7 E;  1O0W A;  3ZOQ B;  2NUE A;  2UXD E;  4AQY E;  4P78 A;  3FIG A;  2VF1 A;  2UUA E;  4DV2 E;  4DKK A;  3JU0 A;  5AE1 A;  2UU9 E;  4LFB E;  4F54 A;  2LUP B;  2L3C A;  5T6J A;  4DUZ E;  3J7A G;  4X64 E;  2F4V E;  4JI1 E;  2ODR C;  1ZBQ A;  3HPZ A;  3P1X A;  3ADI A;  4LFC E;  4LU9 A;  2E5L E;  1N33 E;  2FV4 B;  1RQ0 A;  3JAM C;  3J81 C;  2YT4 A;  2B3T B;  2L2K B;  4DV4 E;  4NXN E;  2RS7 A;  4R8O A;  4JI3 E;  4JI2 E;  3F6H A;  5LL6 R;  2JVA A;  3OML A;  2ZM6 E;  4WYQ B;  3ADJ A;  1N32 E;  3C4B A;  2B7T A;  2V88 A;  4BC9 A;  2KON A;  4DV0 E;  4F9A B;  4DV3 E;  4B3S E;  2M4I A;  2LMZ A;  2V89 A;  1WHN A;  2JOX A;  4K0K E;  2RS6 A;  3HPS A;  5F3W A;  3ADL A;  2DSY A;  1GQE A;  3IWB A;  2LTS A;  2RSM A;  3T1H E;  5IT9 C;  1STU A;  4L8N A;  1X47 A;  4DV7 E;  2HHH E;  4JI0 E;  2LTR A;  2KOU A;  4BCA A;  2NUF A;  2MDR A;  2H36 X;  2FGG A;  3JTZ A;  2N3H A;  4YY3 E;  3MSW A;  4YHH E;  1J26 A;  2VQE E;  3LML A;  5BR8 E;  4DMI A;  1RC7 A;  2DIX A;  2L2M A;  4M30 A;  2UXC E;  4KZS A;  4OOG C;  4BC7 A;  4DR3 E;  3AV0 A;  5IWA E;  4DV6 E;  2B9D A;  3RMP A;  2YZT A;  2JR1 A;  1HNZ E;  1SR9 A;  2L33 A;  2MC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...