3VYYA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase a (dhx9)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase A
total genus 19
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyyA00
5LMUE 4LFCE 4DV5E 4DR2E 4LFBE 2L33A 2VQEE 2N3HA 4B3RE 3HTXA 4JI1E 2NA2A 1RC7A 2E5LE 3LLHA 2B7TA 2LBSB 1HR0E 2UUBE 4JI5E 1WHQA 3C4TA 1STUA 4LF9E 2B3TB 2LTSA 2JVAA 1X47A 1HNWE 2LUQA 1XMQE 2UXCE 2UUAE 1FKAE 1IBME 4X64E 1QU6A 4X65E 4YHHE 2N3GA 2UXDE 4WFTA 2NUGA 3ADJA 4X62E 1XNRE 2F4VE 4JI0E 4DV6E 4DV2E 4DV1E 1XMOE 4GKKE 4JV5E 5LMNE 2RSMA 1HNXE 4DR5E 1HNZE 3J7Yp 4JI8E 2UU9E 4NXNE 4DV0E 1IBLE 1ZBTA 4DV3E 2DIXA 2RS6A 1T4OA 2RTXA 4JI3E 1X48A 1N32E 3VYXA 4KHPE 1EKZA 4LF8E 4NXME 4DR6E 4LFAE 4DR7E 4OOGC 2UXBE 4OX9E 4AQYE 2UUCE 2YT4A 2L3CA 1X49A 1N34E 2HHHE 1T4NA 1T4LB 1I94E 2NUEA 2DB2A 1YYWA 1J26A 2B7VA 4B3ME 3ADGA 2CPNA 4LF4E 4YY3E 2NUFA 4M30A 2IHR1 4WYQB 4JI2E 1FJGE 4JYAE 1DI2A 3ADIA 5CFFE 2LJHA 4DUYE 4DUZE 1O0WA 1IBKE 1YYKA 4JI6E 4X8WA 1N33E 2DMYA 4B3SE 1J5EE 1UHZA 4LF7E 4X66E 2L2KB 4JI4E 1WHNA 2KHXA 2L2MA 1UILA 2RS7A 1N36E 2VQFE 4DR4E 3P1XA 1XNQE 1YZ9A 4DR3E 2L2NA 2LRSA 4M2ZA 2ZM6E 3OTOE 3VYYA 4JI7E 2L3JA 2EZ6A 2MDRA 1YYOA 4GKJE 3T1YE 4K0KE 3C4BA 4B3TE 4DKKA 1GQEA 2LTRA 3T1HE 4DV7E 5BR8E 3ADLA 2JY9A 1PKPA 2LUPB 1RQ0A 4LF5E 4LF6E 5IWAE 4DV4E 4DR1E
chains in the Genus database with same CATH superfamily
4DR2E 2L33A 4BMJA 1YFHA 4BHCA 2YTGA 1RC7A 4Q28A 2LBSB 1X5WA 2VF1A 4F6NA 2EQ3A 2EP3A 1STUA 1B69A 2EMGA 1X47A 4F9AB 2EMXA 2LUQA 4LTYA 1HNWE 2EN6A 1IBME 2V89A 2I9IA 2E1MA 4WPYA 2F4VE 2EMLA 4ZYDA 4JI0E 4DV6E 4DV2E 4DV1E 2R1FA 2YTDA 3IWCA 4ZYGA 2EOZA 1Z1BA 4R2EA 4JI8E 2YRKA 2EN8A 1IBLE 4L8NA 2MDGA 2RQLA 2YTOA 4F54A 3L00A 3J80C 2H36X 2RTXA 1RMDA 2ENAA 1X48A 3ECRA 1ZBQA 3QG5C 2EORA 4WSPA 4DR6E 4AQYE 1A1KA 3H09A 3JTZA 1IMUA 4DMIA 2MKNA 4WX9A 5AASA 2DLQA 1SR9A 2EN1A 2HHHE 1T4NA 1I94E 2WBTA 2NUEA 2DB2A 2EL5A 2NABA 1F2IG 4LF4E 4M30A 2DLKA 1DI2A 5CFFE 4DUYE 4DUZE 2LVHA 2CSHA 1YYKA 2EQ1A 1T39A 1X6HA 1IQOA 4I8OA 4JI4E 1X6FA 3KZZA 2EOMA 5F3WA 2YTPA 2ODRC 1N36E 1YZ9A 2JR1A 3LMLA 2LRSA 1EH7A 4M2ZA 1NEIA 2EN2A 3VYYA 2EOXA 2JYAA 2LMZA 1DGCA 1JK1A 2J7JA 4LU9A 2EE8A 4GEQB 2KOUA 1AAYA 4B3TE 4DKKA 2LTRA 1SFEA 2M4IA 4O43A 5AE2A 5AE1A 4NZVA 5A6KA 2JP9A 3HTXA 2EMAA 2K4VA 4R2AA 2DGCA 1PJSA 2E5LE 4M0VA 4R2DA 2UUBE 3FIGA 3MHSC 1WHQA 3AUZA 4KWYA 2LTSA 4BCAA 2JVAA 1ZR9A 2YSPA 4P78A 5A6BA 2UUAE 3THNA 2DMIA 4X65E 2YTIA 2DRPA 4WSGA 4N4RB 2RPCA 4X62E 2DSYA 5KL7A 2LJUA 2JXPA 4O24A 2HJJA 1PJQA 2YU8A 2ODRD 1HNXE 2HGHA 2YU5A 3J7Yp 4HTGA 2G7HA 3HXLA 2D9HA 3IWDA 2RS6A 5KL6A 3C6KA 5AC5A 1KJKA 2B9DA 1UN6B 4KZSA 4KHPE 3MHHC 4J8ZA 1WJPA 3OMLA 2EOQA 2EPPA 4Q35B 4LFAE 4DR7E 4O5GA 3KZYA 4OX9E 1A1JA 2L8TA 2V8QB 5AE3A 1MEYC 5DNYA 2V86A 2L3CA 1YUJA 2EPCA 2BBGA 1JK2A 2VRDA 3EPHA 4B3ME 3ADGA 2CPNA 3AV0A 2ELYA 4MLVA 2NUFA 4JI2E 4WYQB 1ZU1A 2JWOA 5LL6R 3ADIA 2EM6A 2YZTA 2BB8A 2LJHA 1UBDC 4M9VC 2LT7A 2M1SA 3BGHA 1O0WA 1TF6A 2YRHA 2DMYA 2EPXA 1J5EE 1G2FC 1UHZA 4IJDA 4X66E 2EOIA 3JAMC 2L2KB 4L5NC 2LO3A 3M99B 1X6EA 2RS7A 4DR4E 2M7QA 5KL4A 4DR3E 5LLQA 2ENCA 2EOFA 1GZ6A 2L2NA 4ZYHA 2E72A 2MDRA 4GKJE 2EMIA 2YTNA 4F2JC 2F8BA 3ZOQB 1GQEA 1BBOA 3T1HE 4DV7E 5BR8E 3ADLA 2JY9A 2K7IA 2VE7C 4X9JA 4LF5E 4LF6E 5IWAE 1ZAAC 5LMUE 2EM0A 1WRJA 1YSAC 4LFCE 2GHFA 4LFBE 5A6JA 2VQEE 2N3HA 3UK3C 2EMFA 1N3GA 3IWBA 2R76A 2Q8UA 2L92A 4BC9A 2NA2A 3F6HA 2EMCA 3LLHA 2ELZA 2B7TA 1HR0E 3C4TA 3EQ1A 4LF9E 2B3TB 2EM2A 4TUIA 1XMQE 3EPLA 1IQSA 1TF3A 2LV2A 4X64E 1QU6A 2EM9A 2UXDE 3ADJA 2JOBA 2MC6A 2FV4B 2EMKA 2EOOA 3BIDA 1L4SA 5LMNE 3HQ1A 1HNZE 4NXNE 2UU9E 1A1FA 4R8OA 4DV0E 1PJTA 1ZBTA 3MSWA 4DV3E 1YUIA 2EM4A 1T4OA 3J7AG 5A2QC 3F6GA 2YSOA 3JU0A 2EM5A 2EPZA 2EWLA 1A1GA 1EKZA 4LF8E 4OOGC 2EPKX 4P7DA 4RHBB 2UUCE 2RSIA 2EM3A 3VHTB 1T4LB 4F9BB 5ADZA 2MKDA 2V87A 2EOYA 1J26A 4WXDA 2B7VA 2IHR1 1FJGE 2YTEA 5FLXC 2EPOA 2EPMX 2WCC3 1IBKE 4JI6E 4X8WA 2LCEA 4ZYEA 4B3SE 1X3CA 2JOXA 2YTQA 5A6BD 4LF7E 3THOB 1EH8A 2L2MA 1UILA 3HPSA 3P1XA 1XNQE 4FK5C 2YWQA 2JPAA 2ZM6E 3OTOE 2EMBA 2GLIA 2EOSA 2N8XA 2EPNA 4TUGA 1P47A 2EMZA 3T1YE 4NHRA 4K0KE 4BS9A 4R2RA 2EQ0A 4HEIA 2EOJA 3EPJA 2CT1A 4GZNC 3J81C 1PKPA 2LUPB 1RQ0A 5TSEA 4DR1E 1A1LA 4DV5E 4RH8A 1NCSA 2EPAA 2EOHA 5KL2A 3DF6A 4R2SA 2EMWA 4B3RE 2A25A 2MC5A 5IT9C 4JI1E 2EM7A 5IXMB 4JI5E 2EM8A 2YRMA 1DQ3A 2EOEA 2UXCE 5KL3A 1FKAE 4BBYA 4YHHE 2EL6A 2N3GA 2L6MA 4WFTA 2NUGA 1XNRE 1AH5A 4MLQA 2EJ4A 5AC4A 2V83A 1XMOE 4GKKE 4BHBA 1MGTA 1LLMC 5KL5A 4JV5E 2RSMA 4DR5E 1G2DC 2I13A 2ENHA 1A1IA 3TQMA 2FTXB 2DIXA 1BB8A 5T6JA 3K6QA 4JI3E 3EPKA 2WBSA 4R03A 2WZOA 1N32E 3VYXA 4R2PA 2EN3A 2EL4A 4NXME 2UXBE 1PDAA 2YTFA 1T38A 4BC7A 2YT4A 3BBGA 1X49A 1N34E 3HPZA 4R2CA 3KWRA 1WXRA 4R2QA 1YYWA 1QNTA 4O4KA 1YPNA 3C6MA 4YY3E 4JYAE 1KYQA 4F6MA 2M9AA 2YTJA 3BF2A 1GTKA 2EPUA 3RMPA 2EPLX 2WBUA 2V85A 1N33E 2V88A 5A6AA 1WHNA 2EMHA 2GPIA 2KHXA 2VQFE 2YPNA 1BBGA 5IV8B 3DJWA 1EH6A 4JI7E 2L3JA 2EN7A 2EZ6A 1YYOA 1A1HA 2EN4A 4WXCA 2KONA 3VK6A 2FGGA 2ADRA 2HC5A 3C4BA 2LE2A 4F9CB 5A69A 2EPRA 2EMYA 2CTDA 4IS1C 1TN9A 4DV4E 2PRTA
chains in the Genus database with same CATH topology
5LMUE 5AE1A 4LFCE 4DV5E 4DR2E 4LFBE 2L33A 2VQEE 2N3HA 3DF6A 4BMJA 3HTXA 4B3RE 2MC5A 5IT9C 2K4VA 3IWBA 2L92A 4BC9A 2NA2A 3F6HA 1RC7A 4JI1E 2E5LE 3LLHA 4Q28A 2B7TA 2LBSB 5IWAE 4M0VA 2VF1A 1HR0E 2UUBE 3FIGA 4JI5E 1WHQA 3AUZA 3C4TA 1DQ3A 1STUA 4LF9E 2B3TB 2LTSA 2JVAA 1X47A 4BCAA 2LUQA 4LTYA 4F9AB 4TUIA 4P78A 1XMQE 1HNWE 2UXCE 2UUAE 1FKAE 1IBME 4X64E 4BBYA 1QU6A 4X65E 4YHHE 2N3GA 2L6MA 2UXDE 4WFTA 2NUGA 2V89A 3ADJA 4X62E 2E1MA 2JOBA 2MC6A 2DSYA 2FV4B 4WPYA 4JI0E 1XNRE 2F4VE 4DV6E 4DV2E 4DV1E 2V83A 1XMOE 4GKKE 3IWCA 4JV5E 2ODRD 5LMNE 2RSMA 3HQ1A 1HNXE 4DR5E 1HNZE 3J7Yp 4JI8E 2UU9E 4NXNE 4R8OA 4DV0E 2G7HA 2FTXB 1ZBTA 1IBLE 3HXLA 3MSWA 4DV3E 4L8NA 2DIXA 4F54A 3J80C 2H36X 2RS6A 1T4OA 2RTXA 3IWDA 3K6QA 5T6JA 4JI3E 3J7AG 5A2QC 3F6GA 1X48A 3JU0A 4R03A 2WZOA 1N32E 2B9DA 2EWLA 4KZSA 3VYXA 1EKZA 4KHPE 4LF8E 4J8ZA 1ZBQA 4NXME 4WSPA 3OMLA 4LFAE 4OOGC 4DR6E 4DR7E 2UXBE 4OX9E 4AQYE 3H09A 3JTZA 2L8TA 4P7DA 2V8QB 5AE3A 5DNYA 2V86A 4DMIA 2UUCE 4BC7A 2YT4A 2L3CA 1X49A 1N34E 5AASA 3HPZA 1SR9A 3KWRA 2HHHE 1T4NA 1WXRA 1T4LB 1I94E 2NUEA 4F9BB 2DB2A 5ADZA 2V87A 1YYWA 1J26A 2B7VA 4B3ME 3ADGA 2CPNA 4LF4E 3AV0A 4YY3E 2NUFA 4M30A 2IHR1 4WYQB 4JI2E 1FJGE 4JYAE 2JWOA 1DI2A 5LL6R 3ADIA 5CFFE 2YZTA 2LJHA 5FLXC 4DUYE 4DUZE 3RMPA 2M1SA 2V85A 1O0WA 1IBKE 1YYKA 4JI6E 4X8WA 1N33E 2DMYA 2V88A 4B3SE 1J5EE 1UHZA 2JOXA 4I8OA 4LF7E 4X66E 2L2KB 3JAMC 1WHNA 4JI4E 4DR4E 5F3WA 4L5NC 2KHXA 2L2MA 1UILA 2ODRC 2RS7A 2VQFE 1N36E 2M7QA 3HPSA 3P1XA 1XNQE 2JR1A 1YZ9A 4DR3E 3LMLA 1GZ6A 2L2NA 2LRSA 4M2ZA 3DJWA 2ZM6E 3OTOE 3VYYA 4JI7E 2L3JA 2EZ6A 2MDRA 1YYOA 4GKJE 2LMZA 4TUGA 4LU9A 2KONA 4GEQB 2FGGA 2KOUA 3VK6A 3T1YE 3C4BA 4K0KE 2LE2A 2F8BA 4F9CB 4B3TE 3ZOQB 1GQEA 2LTRA 4BS9A 4DKKA 3T1HE 4DV7E 5BR8E 3ADLA 2M4IA 2JY9A 2VE7C 3J81C 1PKPA 2LUPB 1RQ0A 4LF5E 4LF6E 5AE2A 4DV4E 4DR1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU E;  4LFC E;  4DV5 E;  4DR2 E;  4LFB E;  2L33 A;  2VQE E;  2N3H A;  4B3R E;  3HTX A;  4JI1 E;  2NA2 A;  1RC7 A;  2E5L E;  3LLH A;  2B7T A;  2LBS B;  1HR0 E;  2UUB E;  4JI5 E;  1WHQ A;  3C4T A;  1STU A;  4LF9 E;  2B3T B;  2LTS A;  2JVA A;  1X47 A;  1HNW E;  2LUQ A;  1XMQ E;  2UXC E;  2UUA E;  1FKA E;  1IBM E;  4X64 E;  1QU6 A;  4X65 E;  4YHH E;  2N3G A;  2UXD E;  4WFT A;  2NUG A;  3ADJ A;  4X62 E;  1XNR E;  2F4V E;  4JI0 E;  4DV6 E;  4DV2 E;  4DV1 E;  1XMO E;  4GKK E;  4JV5 E;  5LMN E;  2RSM A;  1HNX E;  4DR5 E;  1HNZ E;  3J7Y p;  4JI8 E;  2UU9 E;  4NXN E;  4DV0 E;  1IBL E;  1ZBT A;  4DV3 E;  2DIX A;  2RS6 A;  1T4O A;  2RTX A;  4JI3 E;  1X48 A;  1N32 E;  3VYX A;  4KHP E;  1EKZ A;  4LF8 E;  4NXM E;  4DR6 E;  4LFA E;  4DR7 E;  4OOG C;  2UXB E;  4OX9 E;  4AQY E;  2UUC E;  2YT4 A;  2L3C A;  1X49 A;  1N34 E;  2HHH E;  1T4N A;  1T4L B;  1I94 E;  2NUE A;  2DB2 A;  1YYW A;  1J26 A;  2B7V A;  4B3M E;  3ADG A;  2CPN A;  4LF4 E;  4YY3 E;  2NUF A;  4M30 A;  2IHR 1;  4WYQ B;  4JI2 E;  1FJG E;  4JYA E;  1DI2 A;  3ADI A;  5CFF E;  2LJH A;  4DUY E;  4DUZ E;  1O0W A;  1IBK E;  1YYK A;  4JI6 E;  4X8W A;  1N33 E;  2DMY A;  4B3S E;  1J5E E;  1UHZ A;  4LF7 E;  4X66 E;  2L2K B;  4JI4 E;  1WHN A;  2KHX A;  2L2M A;  1UIL A;  2RS7 A;  1N36 E;  2VQF E;  4DR4 E;  3P1X A;  1XNQ E;  1YZ9 A;  4DR3 E;  2L2N A;  2LRS A;  4M2Z A;  2ZM6 E;  3OTO E;  3VYY A;  4JI7 E;  2L3J A;  2EZ6 A;  2MDR A;  1YYO A;  4GKJ E;  3T1Y E;  4K0K E;  3C4B A;  4B3T E;  4DKK A;  1GQE A;  2LTR A;  3T1H E;  4DV7 E;  5BR8 E;  3ADL A;  2JY9 A;  1PKP A;  2LUP B;  1RQ0 A;  4LF5 E;  4LF6 E;  5IWA E;  4DV4 E;  4DR1 E; 
#chains in the Genus database with same CATH topology
 4DR2 E;  2L33 A;  4BMJ A;  1YFH A;  4BHC A;  2YTG A;  1RC7 A;  4Q28 A;  2LBS B;  1X5W A;  2VF1 A;  4F6N A;  2EQ3 A;  2EP3 A;  1STU A;  1B69 A;  2EMG A;  1X47 A;  4F9A B;  2EMX A;  2LUQ A;  4LTY A;  1HNW E;  2EN6 A;  1IBM E;  2V89 A;  2I9I A;  2E1M A;  4WPY A;  2F4V E;  2EML A;  4ZYD A;  4JI0 E;  4DV6 E;  4DV2 E;  4DV1 E;  2R1F A;  2YTD A;  3IWC A;  4ZYG A;  2EOZ A;  1Z1B A;  4R2E A;  4JI8 E;  2YRK A;  2EN8 A;  1IBL E;  4L8N A;  2MDG A;  2RQL A;  2YTO A;  4F54 A;  3L00 A;  3J80 C;  2H36 X;  2RTX A;  1RMD A;  2ENA A;  1X48 A;  3ECR A;  1ZBQ A;  3QG5 C;  2EOR A;  4WSP A;  4DR6 E;  4AQY E;  1A1K A;  3H09 A;  3JTZ A;  1IMU A;  4DMI A;  2MKN A;  4WX9 A;  5AAS A;  2DLQ A;  1SR9 A;  2EN1 A;  2HHH E;  1T4N A;  1I94 E;  2WBT A;  2NUE A;  2DB2 A;  2EL5 A;  2NAB A;  1F2I G;  4LF4 E;  4M30 A;  2DLK A;  1DI2 A;  5CFF E;  4DUY E;  4DUZ E;  2LVH A;  2CSH A;  1YYK A;  2EQ1 A;  1T39 A;  1X6H A;  1IQO A;  4I8O A;  4JI4 E;  1X6F A;  3KZZ A;  2EOM A;  5F3W A;  2YTP A;  2ODR C;  1N36 E;  1YZ9 A;  2JR1 A;  3LML A;  2LRS A;  1EH7 A;  4M2Z A;  1NEI A;  2EN2 A;  3VYY A;  2EOX A;  2JYA A;  2LMZ A;  1DGC A;  1JK1 A;  2J7J A;  4LU9 A;  2EE8 A;  4GEQ B;  2KOU A;  1AAY A;  4B3T E;  4DKK A;  2LTR A;  1SFE A;  2M4I A;  4O43 A;  5AE2 A;  5AE1 A;  4NZV A;  5A6K A;  2JP9 A;  3HTX A;  2EMA A;  2K4V A;  4R2A A;  2DGC A;  1PJS A;  2E5L E;  4M0V A;  4R2D A;  2UUB E;  3FIG A;  3MHS C;  1WHQ A;  3AUZ A;  4KWY A;  2LTS A;  4BCA A;  2JVA A;  1ZR9 A;  2YSP A;  4P78 A;  5A6B A;  2UUA E;  3THN A;  2DMI A;  4X65 E;  2YTI A;  2DRP A;  4WSG A;  4N4R B;  2RPC A;  4X62 E;  2DSY A;  5KL7 A;  2LJU A;  2JXP A;  4O24 A;  2HJJ A;  1PJQ A;  2YU8 A;  2ODR D;  1HNX E;  2HGH A;  2YU5 A;  3J7Y p;  4HTG A;  2G7H A;  3HXL A;  2D9H A;  3IWD A;  2RS6 A;  5KL6 A;  3C6K A;  5AC5 A;  1KJK A;  2B9D A;  1UN6 B;  4KZS A;  4KHP E;  3MHH C;  4J8Z A;  1WJP A;  3OML A;  2EOQ A;  2EPP A;  4Q35 B;  4LFA E;  4DR7 E;  4O5G A;  3KZY A;  4OX9 E;  1A1J A;  2L8T A;  2V8Q B;  5AE3 A;  1MEY C;  5DNY A;  2V86 A;  2L3C A;  1YUJ A;  2EPC A;  2BBG A;  1JK2 A;  2VRD A;  3EPH A;  4B3M E;  3ADG A;  2CPN A;  3AV0 A;  2ELY A;  4MLV A;  2NUF A;  4JI2 E;  4WYQ B;  1ZU1 A;  2JWO A;  5LL6 R;  3ADI A;  2EM6 A;  2YZT A;  2BB8 A;  2LJH A;  1UBD C;  4M9V C;  2LT7 A;  2M1S A;  3BGH A;  1O0W A;  1TF6 A;  2YRH A;  2DMY A;  2EPX A;  1J5E E;  1G2F C;  1UHZ A;  4IJD A;  4X66 E;  2EOI A;  3JAM C;  2L2K B;  4L5N C;  2LO3 A;  3M99 B;  1X6E A;  2RS7 A;  4DR4 E;  2M7Q A;  5KL4 A;  4DR3 E;  5LLQ A;  2ENC A;  2EOF A;  1GZ6 A;  2L2N A;  4ZYH A;  2E72 A;  2MDR A;  4GKJ E;  2EMI A;  2YTN A;  4F2J C;  2F8B A;  3ZOQ B;  1GQE A;  1BBO A;  3T1H E;  4DV7 E;  5BR8 E;  3ADL A;  2JY9 A;  2K7I A;  2VE7 C;  4X9J A;  4LF5 E;  4LF6 E;  5IWA E;  1ZAA C;  5LMU E;  2EM0 A;  1WRJ A;  1YSA C;  4LFC E;  2GHF A;  4LFB E;  5A6J A;  2VQE E;  2N3H A;  3UK3 C;  2EMF A;  1N3G A;  3IWB A;  2R76 A;  2Q8U A;  2L92 A;  4BC9 A;  2NA2 A;  3F6H A;  2EMC A;  3LLH A;  2ELZ A;  2B7T A;  1HR0 E;  3C4T A;  3EQ1 A;  4LF9 E;  2B3T B;  2EM2 A;  4TUI A;  1XMQ E;  3EPL A;  1IQS A;  1TF3 A;  2LV2 A;  4X64 E;  1QU6 A;  2EM9 A;  2UXD E;  3ADJ A;  2JOB A;  2MC6 A;  2FV4 B;  2EMK A;  2EOO A;  3BID A;  1L4S A;  5LMN E;  3HQ1 A;  1HNZ E;  4NXN E;  2UU9 E;  1A1F A;  4R8O A;  4DV0 E;  1PJT A;  1ZBT A;  3MSW A;  4DV3 E;  1YUI A;  2EM4 A;  1T4O A;  3J7A G;  5A2Q C;  3F6G A;  2YSO A;  3JU0 A;  2EM5 A;  2EPZ A;  2EWL A;  1A1G A;  1EKZ A;  4LF8 E;  4OOG C;  2EPK X;  4P7D A;  4RHB B;  2UUC E;  2RSI A;  2EM3 A;  3VHT B;  1T4L B;  4F9B B;  5ADZ A;  2MKD A;  2V87 A;  2EOY A;  1J26 A;  4WXD A;  2B7V A;  2IHR 1;  1FJG E;  2YTE A;  5FLX C;  2EPO A;  2EPM X;  2WCC 3;  1IBK E;  4JI6 E;  4X8W A;  2LCE A;  4ZYE A;  4B3S E;  1X3C A;  2JOX A;  2YTQ A;  5A6B D;  4LF7 E;  3THO B;  1EH8 A;  2L2M A;  1UIL A;  3HPS A;  3P1X A;  1XNQ E;  4FK5 C;  2YWQ A;  2JPA A;  2ZM6 E;  3OTO E;  2EMB A;  2GLI A;  2EOS A;  2N8X A;  2EPN A;  4TUG A;  1P47 A;  2EMZ A;  3T1Y E;  4NHR A;  4K0K E;  4BS9 A;  4R2R A;  2EQ0 A;  4HEI A;  2EOJ A;  3EPJ A;  2CT1 A;  4GZN C;  3J81 C;  1PKP A;  2LUP B;  1RQ0 A;  5TSE A;  4DR1 E;  1A1L A;  4DV5 E;  4RH8 A;  1NCS A;  2EPA A;  2EOH A;  5KL2 A;  3DF6 A;  4R2S A;  2EMW A;  4B3R E;  2A25 A;  2MC5 A;  5IT9 C;  4JI1 E;  2EM7 A;  5IXM B;  4JI5 E;  2EM8 A;  2YRM A;  1DQ3 A;  2EOE A;  2UXC E;  5KL3 A;  1FKA E;  4BBY A;  4YHH E;  2EL6 A;  2N3G A;  2L6M A;  4WFT A;  2NUG A;  1XNR E;  1AH5 A;  4MLQ A;  2EJ4 A;  5AC4 A;  2V83 A;  1XMO E;  4GKK E;  4BHB A;  1MGT A;  1LLM C;  5KL5 A;  4JV5 E;  2RSM A;  4DR5 E;  1G2D C;  2I13 A;  2ENH A;  1A1I A;  3TQM A;  2FTX B;  2DIX A;  1BB8 A;  5T6J A;  3K6Q A;  4JI3 E;  3EPK A;  2WBS A;  4R03 A;  2WZO A;  1N32 E;  3VYX A;  4R2P A;  2EN3 A;  2EL4 A;  4NXM E;  2UXB E;  1PDA A;  2YTF A;  1T38 A;  4BC7 A;  2YT4 A;  3BBG A;  1X49 A;  1N34 E;  3HPZ A;  4R2C A;  3KWR A;  1WXR A;  4R2Q A;  1YYW A;  1QNT A;  4O4K A;  1YPN A;  3C6M A;  4YY3 E;  4JYA E;  1KYQ A;  4F6M A;  2M9A A;  2YTJ A;  3BF2 A;  1GTK A;  2EPU A;  3RMP A;  2EPL X;  2WBU A;  2V85 A;  1N33 E;  2V88 A;  5A6A A;  1WHN A;  2EMH A;  2GPI A;  2KHX A;  2VQF E;  2YPN A;  1BBG A;  5IV8 B;  3DJW A;  1EH6 A;  4JI7 E;  2L3J A;  2EN7 A;  2EZ6 A;  1YYO A;  1A1H A;  2EN4 A;  4WXC A;  2KON A;  3VK6 A;  2FGG A;  2ADR A;  2HC5 A;  3C4B A;  2LE2 A;  4F9C B;  5A69 A;  2EPR A;  2EMY A;  2CTD A;  4IS1 C;  1TN9 A;  4DV4 E;  2PRT A; 
#chains in the Genus database with same CATH homology
 5LMU E;  5AE1 A;  4LFC E;  4DV5 E;  4DR2 E;  4LFB E;  2L33 A;  2VQE E;  2N3H A;  3DF6 A;  4BMJ A;  3HTX A;  4B3R E;  2MC5 A;  5IT9 C;  2K4V A;  3IWB A;  2L92 A;  4BC9 A;  2NA2 A;  3F6H A;  1RC7 A;  4JI1 E;  2E5L E;  3LLH A;  4Q28 A;  2B7T A;  2LBS B;  5IWA E;  4M0V A;  2VF1 A;  1HR0 E;  2UUB E;  3FIG A;  4JI5 E;  1WHQ A;  3AUZ A;  3C4T A;  1DQ3 A;  1STU A;  4LF9 E;  2B3T B;  2LTS A;  2JVA A;  1X47 A;  4BCA A;  2LUQ A;  4LTY A;  4F9A B;  4TUI A;  4P78 A;  1XMQ E;  1HNW E;  2UXC E;  2UUA E;  1FKA E;  1IBM E;  4X64 E;  4BBY A;  1QU6 A;  4X65 E;  4YHH E;  2N3G A;  2L6M A;  2UXD E;  4WFT A;  2NUG A;  2V89 A;  3ADJ A;  4X62 E;  2E1M A;  2JOB A;  2MC6 A;  2DSY A;  2FV4 B;  4WPY A;  4JI0 E;  1XNR E;  2F4V E;  4DV6 E;  4DV2 E;  4DV1 E;  2V83 A;  1XMO E;  4GKK E;  3IWC A;  4JV5 E;  2ODR D;  5LMN E;  2RSM A;  3HQ1 A;  1HNX E;  4DR5 E;  1HNZ E;  3J7Y p;  4JI8 E;  2UU9 E;  4NXN E;  4R8O A;  4DV0 E;  2G7H A;  2FTX B;  1ZBT A;  1IBL E;  3HXL A;  3MSW A;  4DV3 E;  4L8N A;  2DIX A;  4F54 A;  3J80 C;  2H36 X;  2RS6 A;  1T4O A;  2RTX A;  3IWD A;  3K6Q A;  5T6J A;  4JI3 E;  3J7A G;  5A2Q C;  3F6G A;  1X48 A;  3JU0 A;  4R03 A;  2WZO A;  1N32 E;  2B9D A;  2EWL A;  4KZS A;  3VYX A;  1EKZ A;  4KHP E;  4LF8 E;  4J8Z A;  1ZBQ A;  4NXM E;  4WSP A;  3OML A;  4LFA E;  4OOG C;  4DR6 E;  4DR7 E;  2UXB E;  4OX9 E;  4AQY E;  3H09 A;  3JTZ A;  2L8T A;  4P7D A;  2V8Q B;  5AE3 A;  5DNY A;  2V86 A;  4DMI A;  2UUC E;  4BC7 A;  2YT4 A;  2L3C A;  1X49 A;  1N34 E;  5AAS A;  3HPZ A;  1SR9 A;  3KWR A;  2HHH E;  1T4N A;  1WXR A;  1T4L B;  1I94 E;  2NUE A;  4F9B B;  2DB2 A;  5ADZ A;  2V87 A;  1YYW A;  1J26 A;  2B7V A;  4B3M E;  3ADG A;  2CPN A;  4LF4 E;  3AV0 A;  4YY3 E;  2NUF A;  4M30 A;  2IHR 1;  4WYQ B;  4JI2 E;  1FJG E;  4JYA E;  2JWO A;  1DI2 A;  5LL6 R;  3ADI A;  5CFF E;  2YZT A;  2LJH A;  5FLX C;  4DUY E;  4DUZ E;  3RMP A;  2M1S A;  2V85 A;  1O0W A;  1IBK E;  1YYK A;  4JI6 E;  4X8W A;  1N33 E;  2DMY A;  2V88 A;  4B3S E;  1J5E E;  1UHZ A;  2JOX A;  4I8O A;  4LF7 E;  4X66 E;  2L2K B;  3JAM C;  1WHN A;  4JI4 E;  4DR4 E;  5F3W A;  4L5N C;  2KHX A;  2L2M A;  1UIL A;  2ODR C;  2RS7 A;  2VQF E;  1N36 E;  2M7Q A;  3HPS A;  3P1X A;  1XNQ E;  2JR1 A;  1YZ9 A;  4DR3 E;  3LML A;  1GZ6 A;  2L2N A;  2LRS A;  4M2Z A;  3DJW A;  2ZM6 E;  3OTO E;  3VYY A;  4JI7 E;  2L3J A;  2EZ6 A;  2MDR A;  1YYO A;  4GKJ E;  2LMZ A;  4TUG A;  4LU9 A;  2KON A;  4GEQ B;  2FGG A;  2KOU A;  3VK6 A;  3T1Y E;  3C4B A;  4K0K E;  2LE2 A;  2F8B A;  4F9C B;  4B3T E;  3ZOQ B;  1GQE A;  2LTR A;  4BS9 A;  4DKK A;  3T1H E;  4DV7 E;  5BR8 E;  3ADL A;  2M4I A;  2JY9 A;  2VE7 C;  3J81 C;  1PKP A;  2LUP B;  1RQ0 A;  4LF5 E;  4LF6 E;  5AE2 A;  4DV4 E;  4DR1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...