2L6MA

Structure of c-terminal dsrbd of the fission yeast dicer (dcr1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MKGDIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVAYGKSRKVANAKYIMKQRLLKLLEDKSNLLLYSCNCKFSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein Dicer
publication title An extended dsRBD with a novel zinc-binding motif mediates nuclear retention of fission yeast Dicer.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 24
structure length 101
sequence length 101
ec nomenclature ec 3.1.26.-:
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.400 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l6mA00
2L6MA
chains in the Genus database with same CATH superfamily
1J26A 1BBGA 4DV4E 4R2RA 2EPKX 5FLXC 2E5LE 3L00A 1GZ6A 2CT1A 1EH7A 1SR9A 3J81C 2CSHA 2NUFA 1PKPA 3IWDA 3C4TA 1T4OA 3HXLA 2EORA 4O24A 1X6FA 2YTFA 4X9JA 3VK6A 2V85A 2E72A 2EM9A 2EM8A 2EM6A 1YUIA 2YTDA 2ODRC 2GPIA 2EOEA 2EMYA 3BGHA 4R2CA 4DV0E 2EPUA 3HPZA 1T4NA 4DMIA 2MC5A 3BF2A 4R2QA 4R2EA 4DV3E 4GKKE 2EPZA 2YTNA 4DV6E 2EMGA 4AQYE 2EMCA 2LBSB 4LU9A 1BBOA 3JU0A 1XMOE 4JI0E 4L8NA 3ADJA 1TN9A 2YZTA 4X62E 2MKDA 2F4VE 2EMKA 3KZYA 3AUZA 1PDAA 2EN8A 3M99B 2EQ1A 2LRSA 2ZM6E 5LL6R 5A2QC 4ZYEA 3HTXA 1YYKA 2EWLA 1N32E 2DB2A 2JWOA 3OTOE 2YTPA 5A6JA 3HPSA 2RSIA 1IBKE 3UK3C 2J7JA 4KWYA 1JK1A 3VYXA 4WSPA 4HEIA 2JOXA 1YZ9A 1Z1BA 1FJGE 4R03A 2EM7A 4F2JC 5KL3A 4NHRA 2L33A 2LO3A 2EN7A 3LLHA 2JYAA 2HHHE 1YYWA 1IMUA 4KZSA 2YTQA 3F6HA 4JI6E 2EN2A 2ELYA 2I13A 1RC7A 4X65E 5KL4A 4R2DA 1UILA 4ZYGA 1A1IA 4NXME 5TSEA 2YSPA 1MGTA 4L5NC 1SFEA 3ADIA 1X5WA 1EH6A 2LJUA 2M7QA 1JK2A 1ZU1A 4BCAA 2CPNA 4BHBA 1B69A 2EM3A 1YPNA 2VE7C 2H36X 1WJPA 4KHPE 2LVHA 3FIGA 3MHHC 1X6HA 3K6QA 1N34E 2EOFA 2EOJA 3OMLA 4DR2E 2RTXA 5LMUE 1IBLE 5T6JA 3VYYA 3EPJA 4BHCA 2EPLX 4ZYDA 2EMWA 1X49A 2EE8A 1RQ0A 2KOUA 2V86A 3BIDA 3F6GA 2EN1A 4J8ZA 2VQFE 3DJWA 4M9VC 2RS6A 2JR1A 2JOBA 2YTEA 1ZBQA 2UXCE 1NCSA 2HJJA 2ENHA 4B3SE 4JI7E 2YRKA 4FK5C 2L8TA 3RMPA 2KHXA 2UUBE 4JI5E 3ECRA 1KJKA 3KWRA 1EKZA 3IWCA 2NUEA 2LTRA 1KYQA 2RSMA 2EPNA 5LLQA 2M4IA 2MC6A 1G2DC 3J7AG 1AH5A 5KL7A 2IHR1 2V88A 1UHZA 4BC9A 5A6AA 4Q28A 4DR4E 2EOHA 2FGGA 4F9AB 2R76A 2G7HA 2V83A 4GEQB 1PJQA 2EM4A 5CFFE 2PRTA 2DSYA 5AE3A 2WBSA 4BBYA 2JPAA 1RMDA 2EN4A 2V89A 1DGCA 3EQ1A 1T4LB 1F2IG 2L3CA 4DV1E 1A1FA 1HNWE 4Q35B 4NZVA 4LFAE 1ZBTA 2YRMA 2FV4B 2D9HA 2ODRD 4LF7E 2Q8UA 1X3CA 2EMFA 2NUGA 1BB8A 2EZ6A 2UXBE 1IBME 2L2KB 3EPLA 4DR6E 1AAYA 4DKKA 4JI1E 3VHTB 2EM0A 4R8OA 2EOYA 4LF8E 3P1XA 2EPMX 2EOMA 2EPOA 4WX9A 2WBUA 1QNTA 1LLMC 4WFTA 4RHBB 2YTIA 2EMZA 1STUA 4X64E 2EQ0A 4OOGC 1DI2A 2EOXA 3MSWA 2EOSA 4O43A 1GTKA 2EPAA 2DGCA 1PJTA 2NABA 2RQLA 2DMYA 4K0KE 1PJSA 4WSGA 2VRDA 3T1HE 4RH8A 2BBGA 2DLQA 2JVAA 4B3ME 4JI2E 2EMIA 3C6KA 4GZNC 2DIXA 1I94E 2EPXA 3BBGA 2UU9E 5BR8E 2UUAE 2EN3A 2L6MA 2EOQA 2LTSA 2UUCE 3ADLA 2EMBA 1X47A 2K7IA 4M2ZA 3DF6A 2CTDA 4DR3E 2L2NA 4X66E 4O4KA 4YHHE 1DQ3A 4YY3E 5F3WA 4DR7E 5KL6A 2YTJA 5AE1A 5KL2A 2YT4A 2YPNA 4LF5E 1XMQE 1X48A 1WHNA 2ENAA 2EOOA 2RPCA 1WRJA 1IQOA 4DUYE 4R2SA 2B3TB 1T39A 1UBDC 4F6NA 4M30A 3T1YE 2HC5A 5A6BA 3TQMA 2EL5A 4MLVA 2YSOA 2LV2A 1YSAC 2KONA 5KL5A 4WPYA 1UN6B 1A1LA 5AC4A 4GKJE 2EM5A 2V87A 5LMNE 1YFHA 1TF3A 2N3GA 5AASA 4LFCE 2NA2A 2B9DA 4JYAE 1WHQA 2LCEA 4F9BB 4DV7E 2MKNA 2JXPA 4BS9A 2YWQA 4ZYHA 3HQ1A 2K4VA 2EMHA 5IV8B 2DMIA 4DV2E 1XNQE 2FTXB 2DRPA 4B3RE 4LF4E 2EPCA 2E1MA 4JV5E 4B3TE 3EPKA 4LF6E 1ZR9A 1G2FC 3THNA 1XNRE 2YU8A 1HNZE 2ADRA 2LE2A 2V8QB 2EN6A 2GLIA 1A1KA 1A1GA 3J7Yp 1L4SA 4JI4E 2RS7A 2GHFA 4WXDA 2DLKA 3C4BA 2EOIA 2M9AA 3IWBA 2I9IA 5ADZA 1N36E 2EOZA 2L3JA 2YTOA 2VF1A 1ZAAC 1NEIA 2EMAA 2EPRA 3ZOQB 3JTZA 4R2PA 3J80C 2ELZA 4JI3E 5IXMB 4I8OA 2N8XA 2EL6A 4DUZE 4F6MA 4LF9E 3C6MA 2WBTA 4P7DA 4BC7A 1O0WA 4M0VA 4DR1E 2YTGA 4R2AA 1P47A 3EPHA 2B7VA 4N4RB 1N3GA 4DR5E 1HNXE 2LT7A 4WYQB 1IQSA 4HTGA 2A25A 5IT9C 5AE2A 4IS1C 4BMJA 1GQEA 2B7TA 1N33E 2EMLA 4TUIA 1HR0E 1YUJA 4P78A 3H09A 2ENCA 1WXRA 2JY9A 2WZOA 1A1JA 2EQ3A 2LMZA 2LUQA 1YYOA 2EPPA 1X6EA 5A69A 4OX9E 1TF6A 2LJHA 4LTYA 2MDRA 3QG5C 1FKAE 3AV0A 3MHSC 1T38A 2YU5A 2BB8A 4NXNE 2L2MA 2L92A 2EM2A 3LMLA 2R1FA 2MDGA 2UXDE 5IWAE 4MLQA 5A6KA 3JAMC 4LFBE 4F54A 4WXCA 3THOB 2EP3A 1MEYC 1J5EE 1EH8A 4IJDA 1QU6A 4JI8E 2LUPB 2EJ4A 3ADGA 4F9CB 5A6BD 2EL4A 2M1SA 2YRHA 4X8WA 5AC5A 2EMXA 2JP9A 5DNYA 2N3HA 2VQEE 4O5GA 4DV5E 2WCC3 3KZZA 1A1HA 2HGHA 4TUGA 2F8BA
chains in the Genus database with same CATH topology
1J26A 3J7Yp 2DMYA 3FIGA 4K0KE 4DV4E 4JI4E 3K6QA 1N34E 2RS7A 4DR7E 5FLXC 2E5LE 3C4BA 3T1HE 1GZ6A 3OMLA 3IWBA 2JVAA 5ADZA 1N36E 4B3ME 4DR2E 4JI2E 1SR9A 2RTXA 3J81C 5LMUE 1IBLE 2L3JA 2VF1A 5T6JA 2NUFA 1PKPA 2DIXA 1I94E 3ZOQB 3VYYA 3IWDA 3C4TA 3JTZA 5BR8E 2UU9E 3J80C 2UUAE 1T4OA 3HXLA 4JI3E 2L6MA 3VK6A 2LTSA 2V85A 2UUCE 4I8OA 3ADLA 1X49A 2ODRC 4DUZE 1X47A 4LF9E 1RQ0A 2KOUA 2V86A 4P7DA 4BC7A 3DF6A 3F6GA 4M2ZA 4DR3E 4DV0E 2L2NA 4J8ZA 2VQFE 3HPZA 1T4NA 4DMIA 2MC5A 1O0WA 3DJWA 4M0VA 2RS6A 4DV3E 2JR1A 2JOBA 4DR1E 4GKKE 4X66E 4DV6E 4YHHE 1ZBQA 2B7VA 4AQYE 2LBSB 2UXCE 1DQ3A 4YY3E 4LU9A 4DR5E 5F3WA 4JI7E 3JU0A 1XMOE 2L8TA 3RMPA 2KHXA 4WYQB 4L8NA 1HNXE 2UUBE 3ADJA 4JI0E 3KWRA 1EKZA 4JI5E 5AE1A 3IWCA 2YT4A 2NUEA 2LTRA 2YZTA 4LF5E 1XMQE 1X48A 2RSMA 4X62E 1WHNA 5IT9C 5AE2A 2F4VE 3AUZA 2M4IA 4BMJA 1GQEA 4DUYE 2B7TA 1N33E 2MC6A 2B3TB 3J7AG 2ZM6E 2LRSA 2IHR1 4M30A 4TUIA 5LL6R 1HR0E 5A2QC 2V88A 1UHZA 4P78A 4BC9A 3T1YE 4Q28A 3HTXA 4DR4E 1YYKA 2EWLA 2FGGA 3H09A 1WXRA 2VE7C 2JY9A 2WZOA 1N32E 4F9AB 2DB2A 2JWOA 3OTOE 2LMZA 2G7HA 2LUQA 2V83A 3HPSA 4GEQB 5CFFE 2DSYA 1YYOA 5AE3A 1IBKE 4BBYA 4OX9E 2KONA 2V89A 4WPYA 1T4LB 2LJHA 4LTYA 2L3CA 4DV1E 3VYXA 1HNWE 2MDRA 1FKAE 4WSPA 4GKJE 3AV0A 2V87A 1ZBTA 5LMNE 2JOXA 4LFAE 2N3GA 1YZ9A 2FV4B 4NXNE 1FJGE 4R03A 5AASA 2L2MA 2L92A 2ODRD 4LF7E 3LMLA 4LFCE 2NA2A 2B9DA 2NUGA 4JYAE 1WHQA 2EZ6A 4F9BB 4DV7E 2UXBE 1IBME 2L33A 2L2KB 4BS9A 4DR6E 2UXDE 3LLHA 5IWAE 4DKKA 4JI1E 2HHHE 3HQ1A 1YYWA 4R8OA 2K4VA 3JAMC 4LF8E 4LFBE 3P1XA 4KZSA 4F54A 3F6HA 1J5EE 4JI6E 1QU6A 4WFTA 4DV2E 1XNQE 2FTXB 4JI8E 2LUPB 4X65E 3ADGA 4F9CB 1RC7A 4B3RE 1UILA 2M1SA 4X8WA 4LF4E 1STUA 4NXME 4X64E 2E1MA 4JV5E 4B3SE 4B3TE 4LF6E 5DNYA 2N3HA 4L5NC 4OOGC 2VQEE 4DV5E 3ADIA 2M7QA 1DI2A 1XNRE 3MSWA 1HNZE 4BCAA 2CPNA 2LE2A 2V8QB 4TUGA 2F8BA 4KHPE 2H36X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6M A; 
#chains in the Genus database with same CATH topology
 1J26 A;  1BBG A;  4DV4 E;  4R2R A;  2EPK X;  5FLX C;  2E5L E;  3L00 A;  1GZ6 A;  2CT1 A;  1EH7 A;  1SR9 A;  3J81 C;  2CSH A;  2NUF A;  1PKP A;  3IWD A;  3C4T A;  1T4O A;  3HXL A;  2EOR A;  4O24 A;  1X6F A;  2YTF A;  4X9J A;  3VK6 A;  2V85 A;  2E72 A;  2EM9 A;  2EM8 A;  2EM6 A;  1YUI A;  2YTD A;  2ODR C;  2GPI A;  2EOE A;  2EMY A;  3BGH A;  4R2C A;  4DV0 E;  2EPU A;  3HPZ A;  1T4N A;  4DMI A;  2MC5 A;  3BF2 A;  4R2Q A;  4R2E A;  4DV3 E;  4GKK E;  2EPZ A;  2YTN A;  4DV6 E;  2EMG A;  4AQY E;  2EMC A;  2LBS B;  4LU9 A;  1BBO A;  3JU0 A;  1XMO E;  4JI0 E;  4L8N A;  3ADJ A;  1TN9 A;  2YZT A;  4X62 E;  2MKD A;  2F4V E;  2EMK A;  3KZY A;  3AUZ A;  1PDA A;  2EN8 A;  3M99 B;  2EQ1 A;  2LRS A;  2ZM6 E;  5LL6 R;  5A2Q C;  4ZYE A;  3HTX A;  1YYK A;  2EWL A;  1N32 E;  2DB2 A;  2JWO A;  3OTO E;  2YTP A;  5A6J A;  3HPS A;  2RSI A;  1IBK E;  3UK3 C;  2J7J A;  4KWY A;  1JK1 A;  3VYX A;  4WSP A;  4HEI A;  2JOX A;  1YZ9 A;  1Z1B A;  1FJG E;  4R03 A;  2EM7 A;  4F2J C;  5KL3 A;  4NHR A;  2L33 A;  2LO3 A;  2EN7 A;  3LLH A;  2JYA A;  2HHH E;  1YYW A;  1IMU A;  4KZS A;  2YTQ A;  3F6H A;  4JI6 E;  2EN2 A;  2ELY A;  2I13 A;  1RC7 A;  4X65 E;  5KL4 A;  4R2D A;  1UIL A;  4ZYG A;  1A1I A;  4NXM E;  5TSE A;  2YSP A;  1MGT A;  4L5N C;  1SFE A;  3ADI A;  1X5W A;  1EH6 A;  2LJU A;  2M7Q A;  1JK2 A;  1ZU1 A;  4BCA A;  2CPN A;  4BHB A;  1B69 A;  2EM3 A;  1YPN A;  2VE7 C;  2H36 X;  1WJP A;  4KHP E;  2LVH A;  3FIG A;  3MHH C;  1X6H A;  3K6Q A;  1N34 E;  2EOF A;  2EOJ A;  3OML A;  4DR2 E;  2RTX A;  5LMU E;  1IBL E;  5T6J A;  3VYY A;  3EPJ A;  4BHC A;  2EPL X;  4ZYD A;  2EMW A;  1X49 A;  2EE8 A;  1RQ0 A;  2KOU A;  2V86 A;  3BID A;  3F6G A;  2EN1 A;  4J8Z A;  2VQF E;  3DJW A;  4M9V C;  2RS6 A;  2JR1 A;  2JOB A;  2YTE A;  1ZBQ A;  2UXC E;  1NCS A;  2HJJ A;  2ENH A;  4B3S E;  4JI7 E;  2YRK A;  4FK5 C;  2L8T A;  3RMP A;  2KHX A;  2UUB E;  4JI5 E;  3ECR A;  1KJK A;  3KWR A;  1EKZ A;  3IWC A;  2NUE A;  2LTR A;  1KYQ A;  2RSM A;  2EPN A;  5LLQ A;  2M4I A;  2MC6 A;  1G2D C;  3J7A G;  1AH5 A;  5KL7 A;  2IHR 1;  2V88 A;  1UHZ A;  4BC9 A;  5A6A A;  4Q28 A;  4DR4 E;  2EOH A;  2FGG A;  4F9A B;  2R76 A;  2G7H A;  2V83 A;  4GEQ B;  1PJQ A;  2EM4 A;  5CFF E;  2PRT A;  2DSY A;  5AE3 A;  2WBS A;  4BBY A;  2JPA A;  1RMD A;  2EN4 A;  2V89 A;  1DGC A;  3EQ1 A;  1T4L B;  1F2I G;  2L3C A;  4DV1 E;  1A1F A;  1HNW E;  4Q35 B;  4NZV A;  4LFA E;  1ZBT A;  2YRM A;  2FV4 B;  2D9H A;  2ODR D;  4LF7 E;  2Q8U A;  1X3C A;  2EMF A;  2NUG A;  1BB8 A;  2EZ6 A;  2UXB E;  1IBM E;  2L2K B;  3EPL A;  4DR6 E;  1AAY A;  4DKK A;  4JI1 E;  3VHT B;  2EM0 A;  4R8O A;  2EOY A;  4LF8 E;  3P1X A;  2EPM X;  2EOM A;  2EPO A;  4WX9 A;  2WBU A;  1QNT A;  1LLM C;  4WFT A;  4RHB B;  2YTI A;  2EMZ A;  1STU A;  4X64 E;  2EQ0 A;  4OOG C;  1DI2 A;  2EOX A;  3MSW A;  2EOS A;  4O43 A;  1GTK A;  2EPA A;  2DGC A;  1PJT A;  2NAB A;  2RQL A;  2DMY A;  4K0K E;  1PJS A;  4WSG A;  2VRD A;  3T1H E;  4RH8 A;  2BBG A;  2DLQ A;  2JVA A;  4B3M E;  4JI2 E;  2EMI A;  3C6K A;  4GZN C;  2DIX A;  1I94 E;  2EPX A;  3BBG A;  2UU9 E;  5BR8 E;  2UUA E;  2EN3 A;  2L6M A;  2EOQ A;  2LTS A;  2UUC E;  3ADL A;  2EMB A;  1X47 A;  2K7I A;  4M2Z A;  3DF6 A;  2CTD A;  4DR3 E;  2L2N A;  4X66 E;  4O4K A;  4YHH E;  1DQ3 A;  4YY3 E;  5F3W A;  4DR7 E;  5KL6 A;  2YTJ A;  5AE1 A;  5KL2 A;  2YT4 A;  2YPN A;  4LF5 E;  1XMQ E;  1X48 A;  1WHN A;  2ENA A;  2EOO A;  2RPC A;  1WRJ A;  1IQO A;  4DUY E;  4R2S A;  2B3T B;  1T39 A;  1UBD C;  4F6N A;  4M30 A;  3T1Y E;  2HC5 A;  5A6B A;  3TQM A;  2EL5 A;  4MLV A;  2YSO A;  2LV2 A;  1YSA C;  2KON A;  5KL5 A;  4WPY A;  1UN6 B;  1A1L A;  5AC4 A;  4GKJ E;  2EM5 A;  2V87 A;  5LMN E;  1YFH A;  1TF3 A;  2N3G A;  5AAS A;  4LFC E;  2NA2 A;  2B9D A;  4JYA E;  1WHQ A;  2LCE A;  4F9B B;  4DV7 E;  2MKN A;  2JXP A;  4BS9 A;  2YWQ A;  4ZYH A;  3HQ1 A;  2K4V A;  2EMH A;  5IV8 B;  2DMI A;  4DV2 E;  1XNQ E;  2FTX B;  2DRP A;  4B3R E;  4LF4 E;  2EPC A;  2E1M A;  4JV5 E;  4B3T E;  3EPK A;  4LF6 E;  1ZR9 A;  1G2F C;  3THN A;  1XNR E;  2YU8 A;  1HNZ E;  2ADR A;  2LE2 A;  2V8Q B;  2EN6 A;  2GLI A;  1A1K A;  1A1G A;  3J7Y p;  1L4S A;  4JI4 E;  2RS7 A;  2GHF A;  4WXD A;  2DLK A;  3C4B A;  2EOI A;  2M9A A;  3IWB A;  2I9I A;  5ADZ A;  1N36 E;  2EOZ A;  2L3J A;  2YTO A;  2VF1 A;  1ZAA C;  1NEI A;  2EMA A;  2EPR A;  3ZOQ B;  3JTZ A;  4R2P A;  3J80 C;  2ELZ A;  4JI3 E;  5IXM B;  4I8O A;  2N8X A;  2EL6 A;  4DUZ E;  4F6M A;  4LF9 E;  3C6M A;  2WBT A;  4P7D A;  4BC7 A;  1O0W A;  4M0V A;  4DR1 E;  2YTG A;  4R2A A;  1P47 A;  3EPH A;  2B7V A;  4N4R B;  1N3G A;  4DR5 E;  1HNX E;  2LT7 A;  4WYQ B;  1IQS A;  4HTG A;  2A25 A;  5IT9 C;  5AE2 A;  4IS1 C;  4BMJ A;  1GQE A;  2B7T A;  1N33 E;  2EML A;  4TUI A;  1HR0 E;  1YUJ A;  4P78 A;  3H09 A;  2ENC A;  1WXR A;  2JY9 A;  2WZO A;  1A1J A;  2EQ3 A;  2LMZ A;  2LUQ A;  1YYO A;  2EPP A;  1X6E A;  5A69 A;  4OX9 E;  1TF6 A;  2LJH A;  4LTY A;  2MDR A;  3QG5 C;  1FKA E;  3AV0 A;  3MHS C;  1T38 A;  2YU5 A;  2BB8 A;  4NXN E;  2L2M A;  2L92 A;  2EM2 A;  3LML A;  2R1F A;  2MDG A;  2UXD E;  5IWA E;  4MLQ A;  5A6K A;  3JAM C;  4LFB E;  4F54 A;  4WXC A;  3THO B;  2EP3 A;  1MEY C;  1J5E E;  1EH8 A;  4IJD A;  1QU6 A;  4JI8 E;  2LUP B;  2EJ4 A;  3ADG A;  4F9C B;  5A6B D;  2EL4 A;  2M1S A;  2YRH A;  4X8W A;  5AC5 A;  2EMX A;  2JP9 A;  5DNY A;  2N3H A;  2VQE E;  4O5G A;  4DV5 E;  2WCC 3;  3KZZ A;  1A1H A;  2HGH A;  4TUG A;  2F8B A; 
#chains in the Genus database with same CATH homology
 1J26 A;  3J7Y p;  2DMY A;  3FIG A;  4K0K E;  4DV4 E;  4JI4 E;  3K6Q A;  1N34 E;  2RS7 A;  4DR7 E;  5FLX C;  2E5L E;  3C4B A;  3T1H E;  1GZ6 A;  3OML A;  3IWB A;  2JVA A;  5ADZ A;  1N36 E;  4B3M E;  4DR2 E;  4JI2 E;  1SR9 A;  2RTX A;  3J81 C;  5LMU E;  1IBL E;  2L3J A;  2VF1 A;  5T6J A;  2NUF A;  1PKP A;  2DIX A;  1I94 E;  3ZOQ B;  3VYY A;  3IWD A;  3C4T A;  3JTZ A;  5BR8 E;  2UU9 E;  3J80 C;  2UUA E;  1T4O A;  3HXL A;  4JI3 E;  2L6M A;  3VK6 A;  2LTS A;  2V85 A;  2UUC E;  4I8O A;  3ADL A;  1X49 A;  2ODR C;  4DUZ E;  1X47 A;  4LF9 E;  1RQ0 A;  2KOU A;  2V86 A;  4P7D A;  4BC7 A;  3DF6 A;  3F6G A;  4M2Z A;  4DR3 E;  4DV0 E;  2L2N A;  4J8Z A;  2VQF E;  3HPZ A;  1T4N A;  4DMI A;  2MC5 A;  1O0W A;  3DJW A;  4M0V A;  2RS6 A;  4DV3 E;  2JR1 A;  2JOB A;  4DR1 E;  4GKK E;  4X66 E;  4DV6 E;  4YHH E;  1ZBQ A;  2B7V A;  4AQY E;  2LBS B;  2UXC E;  1DQ3 A;  4YY3 E;  4LU9 A;  4DR5 E;  5F3W A;  4JI7 E;  3JU0 A;  1XMO E;  2L8T A;  3RMP A;  2KHX A;  4WYQ B;  4L8N A;  1HNX E;  2UUB E;  3ADJ A;  4JI0 E;  3KWR A;  1EKZ A;  4JI5 E;  5AE1 A;  3IWC A;  2YT4 A;  2NUE A;  2LTR A;  2YZT A;  4LF5 E;  1XMQ E;  1X48 A;  2RSM A;  4X62 E;  1WHN A;  5IT9 C;  5AE2 A;  2F4V E;  3AUZ A;  2M4I A;  4BMJ A;  1GQE A;  4DUY E;  2B7T A;  1N33 E;  2MC6 A;  2B3T B;  3J7A G;  2ZM6 E;  2LRS A;  2IHR 1;  4M30 A;  4TUI A;  5LL6 R;  1HR0 E;  5A2Q C;  2V88 A;  1UHZ A;  4P78 A;  4BC9 A;  3T1Y E;  4Q28 A;  3HTX A;  4DR4 E;  1YYK A;  2EWL A;  2FGG A;  3H09 A;  1WXR A;  2VE7 C;  2JY9 A;  2WZO A;  1N32 E;  4F9A B;  2DB2 A;  2JWO A;  3OTO E;  2LMZ A;  2G7H A;  2LUQ A;  2V83 A;  3HPS A;  4GEQ B;  5CFF E;  2DSY A;  1YYO A;  5AE3 A;  1IBK E;  4BBY A;  4OX9 E;  2KON A;  2V89 A;  4WPY A;  1T4L B;  2LJH A;  4LTY A;  2L3C A;  4DV1 E;  3VYX A;  1HNW E;  2MDR A;  1FKA E;  4WSP A;  4GKJ E;  3AV0 A;  2V87 A;  1ZBT A;  5LMN E;  2JOX A;  4LFA E;  2N3G A;  1YZ9 A;  2FV4 B;  4NXN E;  1FJG E;  4R03 A;  5AAS A;  2L2M A;  2L92 A;  2ODR D;  4LF7 E;  3LML A;  4LFC E;  2NA2 A;  2B9D A;  2NUG A;  4JYA E;  1WHQ A;  2EZ6 A;  4F9B B;  4DV7 E;  2UXB E;  1IBM E;  2L33 A;  2L2K B;  4BS9 A;  4DR6 E;  2UXD E;  3LLH A;  5IWA E;  4DKK A;  4JI1 E;  2HHH E;  3HQ1 A;  1YYW A;  4R8O A;  2K4V A;  3JAM C;  4LF8 E;  4LFB E;  3P1X A;  4KZS A;  4F54 A;  3F6H A;  1J5E E;  4JI6 E;  1QU6 A;  4WFT A;  4DV2 E;  1XNQ E;  2FTX B;  4JI8 E;  2LUP B;  4X65 E;  3ADG A;  4F9C B;  1RC7 A;  4B3R E;  1UIL A;  2M1S A;  4X8W A;  4LF4 E;  1STU A;  4NXM E;  4X64 E;  2E1M A;  4JV5 E;  4B3S E;  4B3T E;  4LF6 E;  5DNY A;  2N3H A;  4L5N C;  4OOG C;  2VQE E;  4DV5 E;  3ADI A;  2M7Q A;  1DI2 A;  1XNR E;  3MSW A;  1HNZ E;  4BCA A;  2CPN A;  2LE2 A;  2V8Q B;  4TUG A;  2F8B A;  4KHP E;  2H36 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...