2L6MA

Structure of c-terminal dsrbd of the fission yeast dicer (dcr1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MKGDIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVAYGKSRKVANAKYIMKQRLLKLLEDKSNLLLYSCNCKFSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Dicer
publication title An extended dsRBD with a novel zinc-binding motif mediates nuclear retention of fission yeast Dicer.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 24
structure length 101
sequence length 101
ec nomenclature ec 3.1.26.-:
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.400 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l6mA00
2L6MA
chains in the Genus database with same CATH superfamily
4BBYA 2EMLA 2J7JA 2A25A 2I13A 1UHZA 2Q8UA 3BGHA 2ENCA 2EPUA 1XMOE 1T4OA 4AQYE 3EQ1A 4BS9A 2V86A 1Z1BA 4BC7A 4LF6E 1G2DC 4FK5C 2BBGA 2CT1A 3JTZA 2H36X 4R2AA 2EN1A 2YTIA 1YUJA 1P47A 5BR8E 2EOYA 5DNYA 4P78A 1QNTA 3HTXA 5FLXC 4IS1C 1XNRE 2EP3A 2M4IA 1YZ9A 4IJDA 2B7TA 3THNA 5AC5A 1IQSA 2JY9A 4R2RA 2IHR1 1G2FC 4M9VC 2EM0A 2EWLA 2VRDA 2YU5A 4KHPE 2YT4A 2L2KB 4BMJA 4LU9A 4YY3E 4LF9E 2EOXA 4DV4E 2YTFA 2LUQA 3IWDA 2LTRA 1N32E 1UBDC 2EL5A 4DR2E 1T39A 5KL2A 2VQEE 2JVAA 4F2JC 2JWOA 2K4VA 1B69A 4X8WA 2KOUA 1IBME 2EM4A 2UUCE 4B3ME 2DMIA 2F4VE 1FKAE 2ZM6E 2EPCA 2EN2A 2EPMX 1MGTA 1X6HA 2WBSA 1ZBTA 2ADRA 2B3TB 2LBSB 5F3WA 3F6GA 2YPNA 2DIXA 3AUZA 2HJJA 2LJHA 4O43A 2LV2A 2EPKX 4X64E 3EPLA 2DMYA 1T4NA 2WCC3 4M30A 3TQMA 3FIGA 1N34E 2L3JA 3MHSC 4DUYE 4R03A 2MC6A 4J8ZA 4M0VA 4F6NA 2EOSA 3C6MA 2EPLX 5AE2A 2HGHA 2CSHA 1PKPA 2NA2A 3JU0A 3ZOQB 1SR9A 4X62E 2B9DA 2EQ0A 2UUAE 4F9BB 2EOQA 3HQ1A 3OTOE 2YTNA 4Q28A 2EL6A 2EMWA 2VE7C 2YRKA 2JPAA 2EMXA 2EPRA 2E1MA 1A1IA 2JOBA 4F6MA 1EH6A 1RMDA 5A2QC 1ZU1A 2DLQA 3T1HE 2MC5A 1ZAAC 2EMCA 4HEIA 3THOB 2VQFE 4O5GA 2RS6A 4LF8E 2EOFA 3VYXA 4DV6E 1A1FA 2EN6A 2EZ6A 3JAMC 2ODRC 2EOOA 3HPSA 3UK3C 1TF6A 2V83A 4GEQB 5ADZA 1PJTA 3L00A 1JK1A 2F8BA 4R2PA 3J81C 2EM7A 2JYAA 2LVHA 3KZZA 2EN8A 2JP9A 2ELZA 2RS7A 1YYWA 2ENHA 3QG5C 1YUIA 4RH8A 1AAYA 3H09A 3VK6A 4JI5E 2L2NA 2EOZA 2EM8A 3ADIA 2JXPA 2LTSA 3ADJA 3C6KA 1T4LB 4O4KA 4NXME 2YTOA 2R76A 1TN9A 1A1HA 4LTYA 4LFBE 2ELYA 2K7IA 2DSYA 2KHXA 2DLKA 2YTJA 3IWBA 2EPAA 2YSOA 1YSAC 4F9AB 2EPNA 2YU8A 1TF3A 2DB2A 5KL6A 1X49A 2M1SA 2LUPB 1HNZE 2D9HA 2FGGA 1ZBQA 3F6HA 1O0WA 2EL4A 3EPJA 4JI2E 4DMIA 2EMFA 2V87A 2EOMA 2BB8A 1X5WA 4MLQA 1X6EA 4TUIA 4DR5E 4DV7E 4WFTA 1UILA 3LMLA 1EH8A 4F54A 5T6JA 5AASA 2EMHA 1HR0E 5KL3A 5A6AA 4B3TE 4JI0E 4B3RE 2N3GA 2LT7A 1IMUA 2EM2A 2LRSA 1X6FA 4NXNE 2RTXA 1JK2A 4WSPA 2GPIA 2YTGA 1X47A 2EMGA 2GHFA 4LF5E 1YYOA 1SFEA 4BHBA 4WYQB 2L92A 1AH5A 2N8XA 2CPNA 2YTQA 3MHHC 5A69A 4L8NA 2YTDA 4JI7E 4WX9A 2B7VA 2NUEA 4ZYDA 2YTEA 1IBKE 3J7AG 2EPOA 5KL5A 2YRMA 3BIDA 3MSWA 5KL7A 4DR7E 2NUFA 1BBOA 1DI2A 3KZYA 1PJSA 5TSEA 2WZOA 2M7QA 1IBLE 3KWRA 2EOIA 2L33A 3J80C 1KJKA 4OX9E 4TUGA 4NHRA 2FV4B 2EMYA 2WBUA 4WXCA 1UN6B 4JYAE 1WHNA 2KONA 2CTDA 5IXMB 4GKJE 2EPZA 3LLHA 3OMLA 4L5NC 3M99B 1GZ6A 4NZVA 5AE1A 4R2SA 4DV5E 4I8OA 2EM5A 3K6QA 4LF4E 4JI6E 1X3CA 2RQLA 2DRPA 2EM9A 4LF7E 1FJGE 2VF1A 1HNWE 5CFFE 4R2QA 3DJWA 1WJPA 2EQ1A 2EOHA 5LLQA 2I9IA 4M2ZA 3VYYA 2E5LE 4R2EA 4GKKE 2E72A 5IV8B 2NUGA 4GZNC 4JI4E 3P1XA 1A1JA 4KZSA 1RQ0A 2EM6A 4HTGA 4R2CA 1ZR9A 4ZYHA 1YFHA 5AC4A 5LMNE 2PRTA 1XMQE 1A1LA 1MEYC 3AV0A 2M9AA 4MLVA 1EH7A 2G7HA 2YTPA 1IQOA 1L4SA 1HNXE 4JI3E 2MDGA 3C4TA 3ADGA 4WXDA 4DR3E 1J5EE 3IWCA 1J26A 4OOGC 2EN3A 1LLMC 2EQ3A 2MKDA 5A6BA 3EPKA 2YWQA 2EMBA 3BF2A 3C4BA 2GLIA 1YYKA 2JR1A 2FTXB 1WXRA 3J7Yp 4DUZE 4BCAA 2YRHA 4BHCA 1PDAA 2V8QB 2EN7A 1GTKA 5AE3A 3T1YE 1F2IG 4WPYA 4DKKA 2ENAA 2V85A 2RPCA 4B3SE 2MKNA 1X48A 4ZYEA 1EKZA 2UU9E 4RHBB 2R1FA 1NCSA 4DR6E 2EMIA 2EPPA 4K0KE 1PJQA 2EJ4A 3HXLA 4JV5E 4DV2E 4WSGA 3ECRA 2L3CA 1WHQA 2V88A 1STUA 2EN4A 2HC5A 4N4RB 2V89A 4LFCE 1RC7A 1N36E 2N3HA 1YPNA 2YZTA 2EMAA 2LMZA 3EPHA 5LL6R 3DF6A 4X66E 4KWYA 4DR4E 2L6MA 4R8OA 4X9JA 2LJUA 2NABA 3BBGA 2RSMA 1T38A 2EMKA 4ZYGA 5IT9C 2L2MA 2LCEA 2L8TA 3VHTB 4YHHE 1BBGA 2JOXA 4DV1E 4BC9A 4JI1E 4DV3E 2WBTA 1A1KA 4R2DA 4F9CB 2EM3A 1DQ3A 2EORA 2EE8A 2DGCA 4DR1E 1WRJA 1KYQA 3RMPA 2HHHE 5IWAE 4DV0E 1QU6A 2EPXA 3HPZA 1BB8A 3ADLA 1N33E 4JI8E 5KL4A 1I94E 2UXCE 1XNQE 2EOJA 2RSIA 2UXBE 1NEIA 2UXDE 2ODRD 2UUBE 4Q35B 5A6JA 2LE2A 4O24A 1N3GA 2YSPA 2EOEA 4P7DA 4LFAE 2LO3A 5A6KA 5A6BD 2MDRA 1A1GA 1GQEA 4X65E 1DGCA 2EMZA 5LMUE
chains in the Genus database with same CATH topology
4JI7E 4BCAA 2B7VA 3T1HE 4BBYA 2V8QB 2MC5A 2NUEA 3J7AG 1IBKE 2VQFE 2RS6A 4LF8E 3VYXA 5AE3A 4DV6E 1UHZA 3T1YE 1XMOE 1T4OA 4AQYE 4WPYA 4BS9A 4DKKA 2V86A 3MSWA 4BC7A 4LF6E 2V85A 2NUFA 4B3SE 2EZ6A 4DR7E 3JAMC 1DI2A 2ODRC 3HPSA 2WZOA 3JTZA 1X48A 2H36X 2M7QA 1EKZA 2UU9E 2V83A 1IBLE 3KWRA 4GEQB 2L33A 5ADZA 3J80C 4DR6E 2F8BA 4OX9E 3J81C 4TUGA 5BR8E 2FV4B 5DNYA 4K0KE 4JV5E 3HXLA 4P78A 3HTXA 5FLXC 1XNRE 4JYAE 2M4IA 1YZ9A 1WHNA 2KONA 4DV2E 4GKJE 2B7TA 2RS7A 3LLHA 3OMLA 2L3CA 1WHQA 2V88A 4L5NC 1STUA 1YYWA 2JY9A 1GZ6A 2IHR1 5AE1A 2EWLA 2V89A 4DV5E 4I8OA 4LFCE 4KHPE 1RC7A 2YT4A 2L2KB 1N36E 2N3HA 3H09A 4BMJA 2YZTA 3K6QA 4LU9A 4YY3E 2LMZA 4LF9E 4LF4E 3VK6A 5LL6R 4JI6E 4DV4E 3DF6A 2L2NA 4X66E 4JI5E 2LUQA 2L6MA 2LTRA 3IWDA 1N32E 4DR4E 4R8OA 3ADIA 4LF7E 2LTSA 1FJGE 4DR2E 3ADJA 2VF1A 1HNWE 2RSMA 5CFFE 2VQEE 1T4LB 2JVAA 3DJWA 2JWOA 2K4VA 4NXME 4X8WA 2KOUA 1IBME 4LTYA 3VYYA 2E5LE 2UUCE 4M2ZA 4B3ME 5IT9C 2L2MA 4LFBE 4GKKE 2DSYA 2KHXA 2F4VE 1FKAE 3IWBA 2ZM6E 2L8TA 4YHHE 4F9AB 2NUGA 2JOXA 1ZBTA 4DV1E 4JI4E 3P1XA 2B3TB 4BC9A 4KZSA 2LBSB 1RQ0A 3F6GA 5F3WA 2DIXA 4JI1E 4DV3E 3AUZA 2DB2A 2LJHA 1X49A 2M1SA 2LUPB 4X64E 1HNZE 4F9CB 1DQ3A 2FGGA 2DMYA 1ZBQA 1T4NA 5LMNE 1XMQE 3F6HA 4M30A 1O0WA 3FIGA 4DR1E 1N34E 3AV0A 4JI2E 4DMIA 2L3JA 3RMPA 2G7HA 2V87A 5IWAE 2HHHE 4DUYE 1HNXE 4R03A 4JI3E 2MC6A 4J8ZA 4M0VA 4DV0E 3C4TA 3ADGA 4TUIA 1QU6A 5AE2A 4DR5E 4DV7E 3HPZA 4WFTA 1UILA 3ADLA 1N33E 1PKPA 3LMLA 4JI8E 1I94E 2NA2A 3JU0A 4DR3E 4F54A 1J5EE 2UXCE 3IWCA 1XNQE 3ZOQB 1J26A 5T6JA 1SR9A 4OOGC 5AASA 1HR0E 4B3RE 4B3TE 4JI0E 2UXBE 2N3GA 2UXDE 4X62E 2ODRD 2UUBE 2LRSA 4NXNE 2B9DA 2LE2A 2RTXA 4F9BB 2UUAE 3HQ1A 4WSPA 3OTOE 4Q28A 4P7DA 1X47A 4LFAE 2VE7C 3C4BA 4LF5E 1YYOA 2E1MA 2JR1A 2MDRA 1YYKA 2FTXB 1WXRA 4WYQB 2L92A 1GQEA 4X65E 2JOBA 3J7Yp 5LMUE 4DUZE 2CPNA 4L8NA 5A2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6M A; 
#chains in the Genus database with same CATH topology
 4BBY A;  2EML A;  2J7J A;  2A25 A;  2I13 A;  1UHZ A;  2Q8U A;  3BGH A;  2ENC A;  2EPU A;  1XMO E;  1T4O A;  4AQY E;  3EQ1 A;  4BS9 A;  2V86 A;  1Z1B A;  4BC7 A;  4LF6 E;  1G2D C;  4FK5 C;  2BBG A;  2CT1 A;  3JTZ A;  2H36 X;  4R2A A;  2EN1 A;  2YTI A;  1YUJ A;  1P47 A;  5BR8 E;  2EOY A;  5DNY A;  4P78 A;  1QNT A;  3HTX A;  5FLX C;  4IS1 C;  1XNR E;  2EP3 A;  2M4I A;  1YZ9 A;  4IJD A;  2B7T A;  3THN A;  5AC5 A;  1IQS A;  2JY9 A;  4R2R A;  2IHR 1;  1G2F C;  4M9V C;  2EM0 A;  2EWL A;  2VRD A;  2YU5 A;  4KHP E;  2YT4 A;  2L2K B;  4BMJ A;  4LU9 A;  4YY3 E;  4LF9 E;  2EOX A;  4DV4 E;  2YTF A;  2LUQ A;  3IWD A;  2LTR A;  1N32 E;  1UBD C;  2EL5 A;  4DR2 E;  1T39 A;  5KL2 A;  2VQE E;  2JVA A;  4F2J C;  2JWO A;  2K4V A;  1B69 A;  4X8W A;  2KOU A;  1IBM E;  2EM4 A;  2UUC E;  4B3M E;  2DMI A;  2F4V E;  1FKA E;  2ZM6 E;  2EPC A;  2EN2 A;  2EPM X;  1MGT A;  1X6H A;  2WBS A;  1ZBT A;  2ADR A;  2B3T B;  2LBS B;  5F3W A;  3F6G A;  2YPN A;  2DIX A;  3AUZ A;  2HJJ A;  2LJH A;  4O43 A;  2LV2 A;  2EPK X;  4X64 E;  3EPL A;  2DMY A;  1T4N A;  2WCC 3;  4M30 A;  3TQM A;  3FIG A;  1N34 E;  2L3J A;  3MHS C;  4DUY E;  4R03 A;  2MC6 A;  4J8Z A;  4M0V A;  4F6N A;  2EOS A;  3C6M A;  2EPL X;  5AE2 A;  2HGH A;  2CSH A;  1PKP A;  2NA2 A;  3JU0 A;  3ZOQ B;  1SR9 A;  4X62 E;  2B9D A;  2EQ0 A;  2UUA E;  4F9B B;  2EOQ A;  3HQ1 A;  3OTO E;  2YTN A;  4Q28 A;  2EL6 A;  2EMW A;  2VE7 C;  2YRK A;  2JPA A;  2EMX A;  2EPR A;  2E1M A;  1A1I A;  2JOB A;  4F6M A;  1EH6 A;  1RMD A;  5A2Q C;  1ZU1 A;  2DLQ A;  3T1H E;  2MC5 A;  1ZAA C;  2EMC A;  4HEI A;  3THO B;  2VQF E;  4O5G A;  2RS6 A;  4LF8 E;  2EOF A;  3VYX A;  4DV6 E;  1A1F A;  2EN6 A;  2EZ6 A;  3JAM C;  2ODR C;  2EOO A;  3HPS A;  3UK3 C;  1TF6 A;  2V83 A;  4GEQ B;  5ADZ A;  1PJT A;  3L00 A;  1JK1 A;  2F8B A;  4R2P A;  3J81 C;  2EM7 A;  2JYA A;  2LVH A;  3KZZ A;  2EN8 A;  2JP9 A;  2ELZ A;  2RS7 A;  1YYW A;  2ENH A;  3QG5 C;  1YUI A;  4RH8 A;  1AAY A;  3H09 A;  3VK6 A;  4JI5 E;  2L2N A;  2EOZ A;  2EM8 A;  3ADI A;  2JXP A;  2LTS A;  3ADJ A;  3C6K A;  1T4L B;  4O4K A;  4NXM E;  2YTO A;  2R76 A;  1TN9 A;  1A1H A;  4LTY A;  4LFB E;  2ELY A;  2K7I A;  2DSY A;  2KHX A;  2DLK A;  2YTJ A;  3IWB A;  2EPA A;  2YSO A;  1YSA C;  4F9A B;  2EPN A;  2YU8 A;  1TF3 A;  2DB2 A;  5KL6 A;  1X49 A;  2M1S A;  2LUP B;  1HNZ E;  2D9H A;  2FGG A;  1ZBQ A;  3F6H A;  1O0W A;  2EL4 A;  3EPJ A;  4JI2 E;  4DMI A;  2EMF A;  2V87 A;  2EOM A;  2BB8 A;  1X5W A;  4MLQ A;  1X6E A;  4TUI A;  4DR5 E;  4DV7 E;  4WFT A;  1UIL A;  3LML A;  1EH8 A;  4F54 A;  5T6J A;  5AAS A;  2EMH A;  1HR0 E;  5KL3 A;  5A6A A;  4B3T E;  4JI0 E;  4B3R E;  2N3G A;  2LT7 A;  1IMU A;  2EM2 A;  2LRS A;  1X6F A;  4NXN E;  2RTX A;  1JK2 A;  4WSP A;  2GPI A;  2YTG A;  1X47 A;  2EMG A;  2GHF A;  4LF5 E;  1YYO A;  1SFE A;  4BHB A;  4WYQ B;  2L92 A;  1AH5 A;  2N8X A;  2CPN A;  2YTQ A;  3MHH C;  5A69 A;  4L8N A;  2YTD A;  4JI7 E;  4WX9 A;  2B7V A;  2NUE A;  4ZYD A;  2YTE A;  1IBK E;  3J7A G;  2EPO A;  5KL5 A;  2YRM A;  3BID A;  3MSW A;  5KL7 A;  4DR7 E;  2NUF A;  1BBO A;  1DI2 A;  3KZY A;  1PJS A;  5TSE A;  2WZO A;  2M7Q A;  1IBL E;  3KWR A;  2EOI A;  2L33 A;  3J80 C;  1KJK A;  4OX9 E;  4TUG A;  4NHR A;  2FV4 B;  2EMY A;  2WBU A;  4WXC A;  1UN6 B;  4JYA E;  1WHN A;  2KON A;  2CTD A;  5IXM B;  4GKJ E;  2EPZ A;  3LLH A;  3OML A;  4L5N C;  3M99 B;  1GZ6 A;  4NZV A;  5AE1 A;  4R2S A;  4DV5 E;  4I8O A;  2EM5 A;  3K6Q A;  4LF4 E;  4JI6 E;  1X3C A;  2RQL A;  2DRP A;  2EM9 A;  4LF7 E;  1FJG E;  2VF1 A;  1HNW E;  5CFF E;  4R2Q A;  3DJW A;  1WJP A;  2EQ1 A;  2EOH A;  5LLQ A;  2I9I A;  4M2Z A;  3VYY A;  2E5L E;  4R2E A;  4GKK E;  2E72 A;  5IV8 B;  2NUG A;  4GZN C;  4JI4 E;  3P1X A;  1A1J A;  4KZS A;  1RQ0 A;  2EM6 A;  4HTG A;  4R2C A;  1ZR9 A;  4ZYH A;  1YFH A;  5AC4 A;  5LMN E;  2PRT A;  1XMQ E;  1A1L A;  1MEY C;  3AV0 A;  2M9A A;  4MLV A;  1EH7 A;  2G7H A;  2YTP A;  1IQO A;  1L4S A;  1HNX E;  4JI3 E;  2MDG A;  3C4T A;  3ADG A;  4WXD A;  4DR3 E;  1J5E E;  3IWC A;  1J26 A;  4OOG C;  2EN3 A;  1LLM C;  2EQ3 A;  2MKD A;  5A6B A;  3EPK A;  2YWQ A;  2EMB A;  3BF2 A;  3C4B A;  2GLI A;  1YYK A;  2JR1 A;  2FTX B;  1WXR A;  3J7Y p;  4DUZ E;  4BCA A;  2YRH A;  4BHC A;  1PDA A;  2V8Q B;  2EN7 A;  1GTK A;  5AE3 A;  3T1Y E;  1F2I G;  4WPY A;  4DKK A;  2ENA A;  2V85 A;  2RPC A;  4B3S E;  2MKN A;  1X48 A;  4ZYE A;  1EKZ A;  2UU9 E;  4RHB B;  2R1F A;  1NCS A;  4DR6 E;  2EMI A;  2EPP A;  4K0K E;  1PJQ A;  2EJ4 A;  3HXL A;  4JV5 E;  4DV2 E;  4WSG A;  3ECR A;  2L3C A;  1WHQ A;  2V88 A;  1STU A;  2EN4 A;  2HC5 A;  4N4R B;  2V89 A;  4LFC E;  1RC7 A;  1N36 E;  2N3H A;  1YPN A;  2YZT A;  2EMA A;  2LMZ A;  3EPH A;  5LL6 R;  3DF6 A;  4X66 E;  4KWY A;  4DR4 E;  2L6M A;  4R8O A;  4X9J A;  2LJU A;  2NAB A;  3BBG A;  2RSM A;  1T38 A;  2EMK A;  4ZYG A;  5IT9 C;  2L2M A;  2LCE A;  2L8T A;  3VHT B;  4YHH E;  1BBG A;  2JOX A;  4DV1 E;  4BC9 A;  4JI1 E;  4DV3 E;  2WBT A;  1A1K A;  4R2D A;  4F9C B;  2EM3 A;  1DQ3 A;  2EOR A;  2EE8 A;  2DGC A;  4DR1 E;  1WRJ A;  1KYQ A;  3RMP A;  2HHH E;  5IWA E;  4DV0 E;  1QU6 A;  2EPX A;  3HPZ A;  1BB8 A;  3ADL A;  1N33 E;  4JI8 E;  5KL4 A;  1I94 E;  2UXC E;  1XNQ E;  2EOJ A;  2RSI A;  2UXB E;  1NEI A;  2UXD E;  2ODR D;  2UUB E;  4Q35 B;  5A6J A;  2LE2 A;  4O24 A;  1N3G A;  2YSP A;  2EOE A;  4P7D A;  4LFA E;  2LO3 A;  5A6K A;  5A6B D;  2MDR A;  1A1G A;  1GQE A;  4X65 E;  1DGC A;  2EMZ A;  5LMU E; 
#chains in the Genus database with same CATH homology
 4JI7 E;  4BCA A;  2B7V A;  3T1H E;  4BBY A;  2V8Q B;  2MC5 A;  2NUE A;  3J7A G;  1IBK E;  2VQF E;  2RS6 A;  4LF8 E;  3VYX A;  5AE3 A;  4DV6 E;  1UHZ A;  3T1Y E;  1XMO E;  1T4O A;  4AQY E;  4WPY A;  4BS9 A;  4DKK A;  2V86 A;  3MSW A;  4BC7 A;  4LF6 E;  2V85 A;  2NUF A;  4B3S E;  2EZ6 A;  4DR7 E;  3JAM C;  1DI2 A;  2ODR C;  3HPS A;  2WZO A;  3JTZ A;  1X48 A;  2H36 X;  2M7Q A;  1EKZ A;  2UU9 E;  2V83 A;  1IBL E;  3KWR A;  4GEQ B;  2L33 A;  5ADZ A;  3J80 C;  4DR6 E;  2F8B A;  4OX9 E;  3J81 C;  4TUG A;  5BR8 E;  2FV4 B;  5DNY A;  4K0K E;  4JV5 E;  3HXL A;  4P78 A;  3HTX A;  5FLX C;  1XNR E;  4JYA E;  2M4I A;  1YZ9 A;  1WHN A;  2KON A;  4DV2 E;  4GKJ E;  2B7T A;  2RS7 A;  3LLH A;  3OML A;  2L3C A;  1WHQ A;  2V88 A;  4L5N C;  1STU A;  1YYW A;  2JY9 A;  1GZ6 A;  2IHR 1;  5AE1 A;  2EWL A;  2V89 A;  4DV5 E;  4I8O A;  4LFC E;  4KHP E;  1RC7 A;  2YT4 A;  2L2K B;  1N36 E;  2N3H A;  3H09 A;  4BMJ A;  2YZT A;  3K6Q A;  4LU9 A;  4YY3 E;  2LMZ A;  4LF9 E;  4LF4 E;  3VK6 A;  5LL6 R;  4JI6 E;  4DV4 E;  3DF6 A;  2L2N A;  4X66 E;  4JI5 E;  2LUQ A;  2L6M A;  2LTR A;  3IWD A;  1N32 E;  4DR4 E;  4R8O A;  3ADI A;  4LF7 E;  2LTS A;  1FJG E;  4DR2 E;  3ADJ A;  2VF1 A;  1HNW E;  2RSM A;  5CFF E;  2VQE E;  1T4L B;  2JVA A;  3DJW A;  2JWO A;  2K4V A;  4NXM E;  4X8W A;  2KOU A;  1IBM E;  4LTY A;  3VYY A;  2E5L E;  2UUC E;  4M2Z A;  4B3M E;  5IT9 C;  2L2M A;  4LFB E;  4GKK E;  2DSY A;  2KHX A;  2F4V E;  1FKA E;  3IWB A;  2ZM6 E;  2L8T A;  4YHH E;  4F9A B;  2NUG A;  2JOX A;  1ZBT A;  4DV1 E;  4JI4 E;  3P1X A;  2B3T B;  4BC9 A;  4KZS A;  2LBS B;  1RQ0 A;  3F6G A;  5F3W A;  2DIX A;  4JI1 E;  4DV3 E;  3AUZ A;  2DB2 A;  2LJH A;  1X49 A;  2M1S A;  2LUP B;  4X64 E;  1HNZ E;  4F9C B;  1DQ3 A;  2FGG A;  2DMY A;  1ZBQ A;  1T4N A;  5LMN E;  1XMQ E;  3F6H A;  4M30 A;  1O0W A;  3FIG A;  4DR1 E;  1N34 E;  3AV0 A;  4JI2 E;  4DMI A;  2L3J A;  3RMP A;  2G7H A;  2V87 A;  5IWA E;  2HHH E;  4DUY E;  1HNX E;  4R03 A;  4JI3 E;  2MC6 A;  4J8Z A;  4M0V A;  4DV0 E;  3C4T A;  3ADG A;  4TUI A;  1QU6 A;  5AE2 A;  4DR5 E;  4DV7 E;  3HPZ A;  4WFT A;  1UIL A;  3ADL A;  1N33 E;  1PKP A;  3LML A;  4JI8 E;  1I94 E;  2NA2 A;  3JU0 A;  4DR3 E;  4F54 A;  1J5E E;  2UXC E;  3IWC A;  1XNQ E;  3ZOQ B;  1J26 A;  5T6J A;  1SR9 A;  4OOG C;  5AAS A;  1HR0 E;  4B3R E;  4B3T E;  4JI0 E;  2UXB E;  2N3G A;  2UXD E;  4X62 E;  2ODR D;  2UUB E;  2LRS A;  4NXN E;  2B9D A;  2LE2 A;  2RTX A;  4F9B B;  2UUA E;  3HQ1 A;  4WSP A;  3OTO E;  4Q28 A;  4P7D A;  1X47 A;  4LFA E;  2VE7 C;  3C4B A;  4LF5 E;  1YYO A;  2E1M A;  2JR1 A;  2MDR A;  1YYK A;  2FTX B;  1WXR A;  4WYQ B;  2L92 A;  1GQE A;  4X65 E;  2JOB A;  3J7Y p;  5LMU E;  4DUZ E;  2CPN A;  4L8N A;  5A2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...