2L6MA

Structure of c-terminal dsrbd of the fission yeast dicer (dcr1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MKGDIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVAYGKSRKVANAKYIMKQRLLKLLEDKSNLLLYSCNCKFSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An extended dsRBD with a novel zinc-binding motif mediates nuclear retention of fission yeast Dicer.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords Protein Dicer
total genus 24
structure length 101
sequence length 101
ec nomenclature ec 3.1.26.-:
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.400 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l6mA00
2L6MA
chains in the Genus database with same CATH superfamily
1HR0E 5IT9C 4Q35B 5KL7A 1YFHA 5AC5A 2LCEA 1YUJA 3MHHC 2EOFA 1PJSA 4B3TE 1HNZE 4DR6E 2MC5A 4F9AB 2EM9A 5KL5A 5KL4A 1RQ0A 2WBSA 2UXBE 2UUAE 4DR1E 4GZNC 3LMLA 2B7VA 1N33E 3ADJA 2EM2A 1YPNA 2EMYA 2VQFE 2EM4A 2LTRA 2RS6A 2EMWA 1WHQA 3J81C 2YTDA 1JK2A 2RPCA 2GPIA 2YRKA 2ODRC 2K7IA 4LTYA 2ZM6E 2EPKX 3K6QA 2JOBA 4DR4E 2KOUA 2EOEA 2YWQA 4JYAE 2JPAA 2IHR1 1BBOA 4TUIA 3DJWA 4DR2E 4RHBB 4DUYE 2JR1A 3C4BA 1A1GA 1IBME 4JI0E 4WFTA 4DV4E 4N4RB 2WBTA 1A1JA 2V85A 4KWYA 2LRSA 5IV8B 1BB8A 5FLXC 1TF6A 4DV1E 1UILA 1EKZA 3UK3C 2EOHA 3LLHA 1MGTA 3VYXA 1WHNA 2YTIA 2YU8A 4NXNE 2VF1A 2YTQA 3FIGA 1G2DC 5AC4A 2EMZA 2V86A 2LJHA 2R76A 4F6NA 4DV6E 3KZYA 2YTFA 1EH7A 1Z1BA 2EMFA 2V87A 1XMOE 1A1IA 3BGHA 4R2DA 4DR5E 4LFCE 3AUZA 1T39A 1GZ6A 1JK1A 4X8WA 3VHTB 1GTKA 2WCC3 2EQ0A 2VQEE 2EMIA 2HC5A 5AE3A 3TQMA 2NUGA 4O4KA 2L3JA 4WSGA 2EL4A 3QG5C 1UHZA 4M2ZA 5A69A 2F4VE 2EOOA 2L2MA 1NCSA 1HNWE 2DSYA 5T6JA 2UXDE 2YPNA 4ZYHA 1AH5A 1I94E 1T4OA 2YRHA 4R2CA 2EQ3A 4OX9E 4DR7E 2EMBA 3KZZA 3J7Yp 3T1YE 2EM8A 4Q28A 5IWAE 1T38A 1G2FC 2L2NA 2RQLA 3F6HA 2DRPA 1EH8A 2GLIA 4LU9A 2ADRA 2KONA 2M1SA 3ECRA 2EL5A 4O43A 1YYKA 1J26A 2DLKA 3EQ1A 1ZBQA 2YTNA 4DMIA 1RMDA 3ADGA 2EPUA 3C4TA 2B9DA 2YTGA 5CFFE 4K0KE 1DGCA 2RSIA 2EP3A 1X49A 4JI4E 2LT7A 1B69A 1TF3A 4R2SA 1KJKA 1RC7A 2HGHA 2EMGA 4GEQB 3MHSC 2RTXA 4KZSA 5F3WA 2JYAA 2V83A 2YZTA 4DV5E 1YYOA 2EOJA 2WZOA 2FTXB 1BBGA 5A6JA 4HEIA 2EPMX 1ZR9A 4DR3E 4LFAE 2Q8UA 3C6MA 4LF5E 3H09A 4M0VA 4F9CB 2E5LE 4F54A 2PRTA 2LUQA 2EM6A 4L8NA 2EL6A 1A1LA 1IMUA 4LF6E 4M9VC 2EOIA 1IBKE 1WXRA 4GKKE 1AAYA 2LTSA 2BB8A 1QNTA 2EMXA 1PJTA 5LMUE 5A2QC 2EJ4A 2UUBE 4JV5E 2JXPA 4R2RA 4JI7E 4JI2E 2YTPA 1PKPA 4P7DA 4X64E 3J80C 2UXCE 2LO3A 2YT4A 4LF8E 1SR9A 2MKDA 1O0WA 2NUEA 5DNYA 3HXLA 2M4IA 5AE2A 4MLVA 4DKKA 1FJGE 2M7QA 3EPHA 1A1HA 2B3TB 2NABA 3KWRA 1X48A 4BBYA 1YYWA 2EPLX 1X6EA 4M30A 3JU0A 3ADLA 2EPXA 1A1KA 3MSWA 2EORA 1ZU1A 2YTEA 2EPRA 2DIXA 2YSOA 2JVAA 2EN2A 2EM7A 2V89A 2YTOA 2EMAA 2MC6A 1TN9A 2JWOA 2I13A 4B3SE 4J8ZA 2J7JA 2LJUA 2EZ6A 2JP9A 5AASA 2LMZA 2G7HA 4B3RE 2E1MA 4BC9A 2MDGA 4BCAA 1QU6A 4LF9E 2ELYA 2F8BA 2LVHA 5BR8E 1P47A 2L8TA 2E72A 4KHPE 2DB2A 3BBGA 3L00A 3EPLA 4OOGC 2CTDA 2R1FA 4O24A 3AV0A 1SFEA 4YY3E 2N3GA 2WBUA 4JI5E 1STUA 2CT1A 4TUGA 2D9HA 2L3CA 2EMLA 2EM3A 2EN6A 2EE8A 1FKAE 1PJQA 4WSPA 4B3ME 5A6BA 4WPYA 3HPZA 2VRDA 4F6MA 4O5GA 2B7TA 2V88A 3M99B 1EH6A 5KL3A 1F2IG 1YZ9A 4ZYGA 4R03A 1KYQA 1GQEA 3F6GA 1N36E 3IWDA 4ZYEA 4YHHE 5KL6A 1T4NA 4BHBA 4JI1E 2YU5A 1L4SA 1XNQE 1X5WA 3IWCA 2VE7C 4F2JC 3EPKA 1LLMC 1PDAA 2L2KB 5A6KA 3RMPA 2MKNA 5TSEA 3OMLA 4MLQA 5IXMB 2L33A 3ZOQB 2EN3A 2ENCA 2JOXA 2DLQA 2EM5A 2KHXA 1WRJA 2BBGA 1IQSA 2EPZA 2L6MA 1YUIA 3T1HE 5KL2A 4X62E 4WX9A 1X47A 4R2QA 3IWBA 1J5EE 3BIDA 3DF6A 1N32E 2RSMA 4BHCA 2YTJA 2EPOA 4JI8E 1UBDC 2LV2A 2EOYA 4JI3E 5A6BD 2LE2A 4BMJA 2LUPB 4BS9A 2EWLA 3BF2A 4DUZE 1UN6B 1N34E 3VK6A 2A25A 2GHFA 2HJJA 4GKJE 2ELZA 1DI2A 4X65E 4RH8A 4R2EA 5A6AA 2H36X 1ZBTA 3THNA 4I8OA 3THOB 1ZAAC 2EPNA 4WXCA 1X3CA 2DGCA 2EN7A 5ADZA 4P78A 2ODRD 2I9IA 2L92A 4NHRA 2EPAA 3J7AG 2EQ1A 1NEIA 2EOQA 4JI6E 2UU9E 4L5NC 2EPCA 2YRMA 4DV0E 2K4VA 1X6HA 2EMCA 1XMQE 1XNRE 3ADIA 1HNXE 2EM0A 4IS1C 2ENAA 1YSAC 1IBLE 5LL6R 2ENHA 2HHHE 3HTXA 3C6KA 2CPNA 2FGGA 4DV7E 2JY9A 3P1XA 1A1FA 1DQ3A 4NXME 4X9JA 1T4LB 2EOXA 1IQOA 4DV2E 4WXDA 4R8OA 2FV4B 3VYYA 5LMNE 2M9AA 2EN8A 4F9BB 1WJPA 2EOZA 3OTOE 3HPSA 2EMHA 2NUFA 4R2PA 4BC7A 4ZYDA 2UUCE 4LF4E 3JAMC 1X6FA 2CSHA 2NA2A 4NZVA 2DMYA 2EOMA 4X66E 1MEYC 3HQ1A 2YSPA 2LBSB 4HTGA 2EMKA 2EN4A 2EPPA 4DV3E 4IJDA 4WYQB 2DMIA 3EPJA 5AE1A 4LF7E 2EN1A 2N8XA 2V8QB 3JTZA 4R2AA 4AQYE 4LFBE 4FK5C 2EOSA 2RS7A 2MDRA 1N3GA 5LLQA 2N3HA
chains in the Genus database with same CATH topology
1HR0E 4DR2E 5IT9C 2VQEE 3MSWA 4JI8E 5AE3A 2NUGA 2L3JA 2DIXA 4B3TE 4JI3E 2JVAA 2LE2A 4BMJA 2LUPB 4DR6E 4BS9A 2EWLA 2V89A 4DUZE 1HNZE 1UHZA 2MC5A 1N34E 4F9AB 2L2MA 3VK6A 4M2ZA 2F4VE 2MC6A 1HNWE 2DSYA 5T6JA 2UXDE 4GKJE 1DI2A 4X65E 2JWOA 1I94E 4B3SE 4J8ZA 1T4OA 2H36X 2EZ6A 1ZBTA 3ADLA 5AASA 4OX9E 4DR7E 1RQ0A 2LMZA 3J7Yp 2G7HA 3T1YE 4I8OA 4Q28A 5IWAE 2E1MA 4BC9A 2UUAE 4DR1E 4B3RE 2UXBE 2L2NA 3F6HA 4BCAA 1QU6A 3LMLA 2B7VA 4LF9E 2F8BA 4LU9A 5BR8E 1N33E 2KONA 3ADJA 2M1SA 2L8TA 2VQFE 2LTRA 1YYKA 5ADZA 4P78A 1J26A 4KHPE 1ZBQA 2RS6A 2ODRD 2DB2A 4DMIA 1WHQA 3ADGA 2L92A 4OOGC 3C4TA 2B9DA 3J81C 3J7AG 5CFFE 4K0KE 4JI6E 3AV0A 4YY3E 1X49A 2N3GA 2UU9E 4JI5E 4L5NC 4JI4E 1IBME 1STUA 4TUGA 2ODRC 2L3CA 2K4VA 4DV0E 1RC7A 4JI0E 4LTYA 4GEQB 2ZM6E 1XMQE 1XNRE 2RTXA 4KZSA 5F3WA 1FKAE 3K6QA 1HNXE 3ADIA 4WSPA 2V83A 4B3ME 2YZTA 4DV5E 2JOBA 1YYOA 2WZOA 4WPYA 4DR4E 2KOUA 2FTXB 3HPZA 1N36E 2B7TA 2V88A 4JYAE 1IBLE 2IHR1 5LL6R 2HHHE 4DR3E 4LFAE 4TUIA 1YZ9A 4R03A 3HTXA 3DJWA 4LF5E 3H09A 4M0VA 1GQEA 4DUYE 2CPNA 2JR1A 2FGGA 3C4BA 3F6GA 3IWDA 2JY9A 3P1XA 4WFTA 1DQ3A 4F54A 4YHHE 4DV4E 4NXME 2LUQA 1T4LB 1T4NA 4L8NA 4JI1E 4DV2E 2V85A 2LRSA 1XNQE 4R8OA 3IWCA 2VE7C 4DV7E 4LF6E 5FLXC 2FV4B 3VYYA 5LMNE 4F9BB 4DV1E 3OTOE 4F9CB 3HPSA 2L2KB 1UILA 3RMPA 1IBKE 4X8WA 1WXRA 4BC7A 1EKZA 2NUFA 4GKKE 2LTSA 5LMUE 3LLHA 5A2QC 2UUBE 2UUCE 3VYXA 4JV5E 1WHNA 4JI7E 3OMLA 4JI2E 4LF4E 2VF1A 4NXNE 2L33A 3ZOQB 3JAMC 1PKPA 2JOXA 2NA2A 2KHXA 3FIGA 4P7DA 4X64E 2DMYA 4X66E 3J80C 3HQ1A 2V86A 2UXCE 2L6MA 2YT4A 4LF8E 2LJHA 2LBSB 1SR9A 3T1HE 4X62E 4DV6E 1O0WA 4DV3E 2NUEA 1X47A 5DNYA 4WYQB 3HXLA 2V87A 1XMOE 2M4IA 3IWBA 5AE2A 4DKKA 5AE1A 1J5EE 1FJGE 2M7QA 4LF7E 2V8QB 2B3TB 3JTZA 3KWRA 2E5LE 1X48A 4DR5E 4AQYE 3DF6A 4BBYA 1N32E 4LFCE 1YYWA 3AUZA 4LFBE 1GZ6A 2RSMA 2RS7A 2MDRA 4M30A 3JU0A 2N3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6M A; 
#chains in the Genus database with same CATH topology
 1HR0 E;  5IT9 C;  4Q35 B;  5KL7 A;  1YFH A;  5AC5 A;  2LCE A;  1YUJ A;  3MHH C;  2EOF A;  1PJS A;  4B3T E;  1HNZ E;  4DR6 E;  2MC5 A;  4F9A B;  2EM9 A;  5KL5 A;  5KL4 A;  1RQ0 A;  2WBS A;  2UXB E;  2UUA E;  4DR1 E;  4GZN C;  3LML A;  2B7V A;  1N33 E;  3ADJ A;  2EM2 A;  1YPN A;  2EMY A;  2VQF E;  2EM4 A;  2LTR A;  2RS6 A;  2EMW A;  1WHQ A;  3J81 C;  2YTD A;  1JK2 A;  2RPC A;  2GPI A;  2YRK A;  2ODR C;  2K7I A;  4LTY A;  2ZM6 E;  2EPK X;  3K6Q A;  2JOB A;  4DR4 E;  2KOU A;  2EOE A;  2YWQ A;  4JYA E;  2JPA A;  2IHR 1;  1BBO A;  4TUI A;  3DJW A;  4DR2 E;  4RHB B;  4DUY E;  2JR1 A;  3C4B A;  1A1G A;  1IBM E;  4JI0 E;  4WFT A;  4DV4 E;  4N4R B;  2WBT A;  1A1J A;  2V85 A;  4KWY A;  2LRS A;  5IV8 B;  1BB8 A;  5FLX C;  1TF6 A;  4DV1 E;  1UIL A;  1EKZ A;  3UK3 C;  2EOH A;  3LLH A;  1MGT A;  3VYX A;  1WHN A;  2YTI A;  2YU8 A;  4NXN E;  2VF1 A;  2YTQ A;  3FIG A;  1G2D C;  5AC4 A;  2EMZ A;  2V86 A;  2LJH A;  2R76 A;  4F6N A;  4DV6 E;  3KZY A;  2YTF A;  1EH7 A;  1Z1B A;  2EMF A;  2V87 A;  1XMO E;  1A1I A;  3BGH A;  4R2D A;  4DR5 E;  4LFC E;  3AUZ A;  1T39 A;  1GZ6 A;  1JK1 A;  4X8W A;  3VHT B;  1GTK A;  2WCC 3;  2EQ0 A;  2VQE E;  2EMI A;  2HC5 A;  5AE3 A;  3TQM A;  2NUG A;  4O4K A;  2L3J A;  4WSG A;  2EL4 A;  3QG5 C;  1UHZ A;  4M2Z A;  5A69 A;  2F4V E;  2EOO A;  2L2M A;  1NCS A;  1HNW E;  2DSY A;  5T6J A;  2UXD E;  2YPN A;  4ZYH A;  1AH5 A;  1I94 E;  1T4O A;  2YRH A;  4R2C A;  2EQ3 A;  4OX9 E;  4DR7 E;  2EMB A;  3KZZ A;  3J7Y p;  3T1Y E;  2EM8 A;  4Q28 A;  5IWA E;  1T38 A;  1G2F C;  2L2N A;  2RQL A;  3F6H A;  2DRP A;  1EH8 A;  2GLI A;  4LU9 A;  2ADR A;  2KON A;  2M1S A;  3ECR A;  2EL5 A;  4O43 A;  1YYK A;  1J26 A;  2DLK A;  3EQ1 A;  1ZBQ A;  2YTN A;  4DMI A;  1RMD A;  3ADG A;  2EPU A;  3C4T A;  2B9D A;  2YTG A;  5CFF E;  4K0K E;  1DGC A;  2RSI A;  2EP3 A;  1X49 A;  4JI4 E;  2LT7 A;  1B69 A;  1TF3 A;  4R2S A;  1KJK A;  1RC7 A;  2HGH A;  2EMG A;  4GEQ B;  3MHS C;  2RTX A;  4KZS A;  5F3W A;  2JYA A;  2V83 A;  2YZT A;  4DV5 E;  1YYO A;  2EOJ A;  2WZO A;  2FTX B;  1BBG A;  5A6J A;  4HEI A;  2EPM X;  1ZR9 A;  4DR3 E;  4LFA E;  2Q8U A;  3C6M A;  4LF5 E;  3H09 A;  4M0V A;  4F9C B;  2E5L E;  4F54 A;  2PRT A;  2LUQ A;  2EM6 A;  4L8N A;  2EL6 A;  1A1L A;  1IMU A;  4LF6 E;  4M9V C;  2EOI A;  1IBK E;  1WXR A;  4GKK E;  1AAY A;  2LTS A;  2BB8 A;  1QNT A;  2EMX A;  1PJT A;  5LMU E;  5A2Q C;  2EJ4 A;  2UUB E;  4JV5 E;  2JXP A;  4R2R A;  4JI7 E;  4JI2 E;  2YTP A;  1PKP A;  4P7D A;  4X64 E;  3J80 C;  2UXC E;  2LO3 A;  2YT4 A;  4LF8 E;  1SR9 A;  2MKD A;  1O0W A;  2NUE A;  5DNY A;  3HXL A;  2M4I A;  5AE2 A;  4MLV A;  4DKK A;  1FJG E;  2M7Q A;  3EPH A;  1A1H A;  2B3T B;  2NAB A;  3KWR A;  1X48 A;  4BBY A;  1YYW A;  2EPL X;  1X6E A;  4M30 A;  3JU0 A;  3ADL A;  2EPX A;  1A1K A;  3MSW A;  2EOR A;  1ZU1 A;  2YTE A;  2EPR A;  2DIX A;  2YSO A;  2JVA A;  2EN2 A;  2EM7 A;  2V89 A;  2YTO A;  2EMA A;  2MC6 A;  1TN9 A;  2JWO A;  2I13 A;  4B3S E;  4J8Z A;  2J7J A;  2LJU A;  2EZ6 A;  2JP9 A;  5AAS A;  2LMZ A;  2G7H A;  4B3R E;  2E1M A;  4BC9 A;  2MDG A;  4BCA A;  1QU6 A;  4LF9 E;  2ELY A;  2F8B A;  2LVH A;  5BR8 E;  1P47 A;  2L8T A;  2E72 A;  4KHP E;  2DB2 A;  3BBG A;  3L00 A;  3EPL A;  4OOG C;  2CTD A;  2R1F A;  4O24 A;  3AV0 A;  1SFE A;  4YY3 E;  2N3G A;  2WBU A;  4JI5 E;  1STU A;  2CT1 A;  4TUG A;  2D9H A;  2L3C A;  2EML A;  2EM3 A;  2EN6 A;  2EE8 A;  1FKA E;  1PJQ A;  4WSP A;  4B3M E;  5A6B A;  4WPY A;  3HPZ A;  2VRD A;  4F6M A;  4O5G A;  2B7T A;  2V88 A;  3M99 B;  1EH6 A;  5KL3 A;  1F2I G;  1YZ9 A;  4ZYG A;  4R03 A;  1KYQ A;  1GQE A;  3F6G A;  1N36 E;  3IWD A;  4ZYE A;  4YHH E;  5KL6 A;  1T4N A;  4BHB A;  4JI1 E;  2YU5 A;  1L4S A;  1XNQ E;  1X5W A;  3IWC A;  2VE7 C;  4F2J C;  3EPK A;  1LLM C;  1PDA A;  2L2K B;  5A6K A;  3RMP A;  2MKN A;  5TSE A;  3OML A;  4MLQ A;  5IXM B;  2L33 A;  3ZOQ B;  2EN3 A;  2ENC A;  2JOX A;  2DLQ A;  2EM5 A;  2KHX A;  1WRJ A;  2BBG A;  1IQS A;  2EPZ A;  2L6M A;  1YUI A;  3T1H E;  5KL2 A;  4X62 E;  4WX9 A;  1X47 A;  4R2Q A;  3IWB A;  1J5E E;  3BID A;  3DF6 A;  1N32 E;  2RSM A;  4BHC A;  2YTJ A;  2EPO A;  4JI8 E;  1UBD C;  2LV2 A;  2EOY A;  4JI3 E;  5A6B D;  2LE2 A;  4BMJ A;  2LUP B;  4BS9 A;  2EWL A;  3BF2 A;  4DUZ E;  1UN6 B;  1N34 E;  3VK6 A;  2A25 A;  2GHF A;  2HJJ A;  4GKJ E;  2ELZ A;  1DI2 A;  4X65 E;  4RH8 A;  4R2E A;  5A6A A;  2H36 X;  1ZBT A;  3THN A;  4I8O A;  3THO B;  1ZAA C;  2EPN A;  4WXC A;  1X3C A;  2DGC A;  2EN7 A;  5ADZ A;  4P78 A;  2ODR D;  2I9I A;  2L92 A;  4NHR A;  2EPA A;  3J7A G;  2EQ1 A;  1NEI A;  2EOQ A;  4JI6 E;  2UU9 E;  4L5N C;  2EPC A;  2YRM A;  4DV0 E;  2K4V A;  1X6H A;  2EMC A;  1XMQ E;  1XNR E;  3ADI A;  1HNX E;  2EM0 A;  4IS1 C;  2ENA A;  1YSA C;  1IBL E;  5LL6 R;  2ENH A;  2HHH E;  3HTX A;  3C6K A;  2CPN A;  2FGG A;  4DV7 E;  2JY9 A;  3P1X A;  1A1F A;  1DQ3 A;  4NXM E;  4X9J A;  1T4L B;  2EOX A;  1IQO A;  4DV2 E;  4WXD A;  4R8O A;  2FV4 B;  3VYY A;  5LMN E;  2M9A A;  2EN8 A;  4F9B B;  1WJP A;  2EOZ A;  3OTO E;  3HPS A;  2EMH A;  2NUF A;  4R2P A;  4BC7 A;  4ZYD A;  2UUC E;  4LF4 E;  3JAM C;  1X6F A;  2CSH A;  2NA2 A;  4NZV A;  2DMY A;  2EOM A;  4X66 E;  1MEY C;  3HQ1 A;  2YSP A;  2LBS B;  4HTG A;  2EMK A;  2EN4 A;  2EPP A;  4DV3 E;  4IJD A;  4WYQ B;  2DMI A;  3EPJ A;  5AE1 A;  4LF7 E;  2EN1 A;  2N8X A;  2V8Q B;  3JTZ A;  4R2A A;  4AQY E;  4LFB E;  4FK5 C;  2EOS A;  2RS7 A;  2MDR A;  1N3G A;  5LLQ A;  2N3H A; 
#chains in the Genus database with same CATH homology
 1HR0 E;  4DR2 E;  5IT9 C;  2VQE E;  3MSW A;  4JI8 E;  5AE3 A;  2NUG A;  2L3J A;  2DIX A;  4B3T E;  4JI3 E;  2JVA A;  2LE2 A;  4BMJ A;  2LUP B;  4DR6 E;  4BS9 A;  2EWL A;  2V89 A;  4DUZ E;  1HNZ E;  1UHZ A;  2MC5 A;  1N34 E;  4F9A B;  2L2M A;  3VK6 A;  4M2Z A;  2F4V E;  2MC6 A;  1HNW E;  2DSY A;  5T6J A;  2UXD E;  4GKJ E;  1DI2 A;  4X65 E;  2JWO A;  1I94 E;  4B3S E;  4J8Z A;  1T4O A;  2H36 X;  2EZ6 A;  1ZBT A;  3ADL A;  5AAS A;  4OX9 E;  4DR7 E;  1RQ0 A;  2LMZ A;  3J7Y p;  2G7H A;  3T1Y E;  4I8O A;  4Q28 A;  5IWA E;  2E1M A;  4BC9 A;  2UUA E;  4DR1 E;  4B3R E;  2UXB E;  2L2N A;  3F6H A;  4BCA A;  1QU6 A;  3LML A;  2B7V A;  4LF9 E;  2F8B A;  4LU9 A;  5BR8 E;  1N33 E;  2KON A;  3ADJ A;  2M1S A;  2L8T A;  2VQF E;  2LTR A;  1YYK A;  5ADZ A;  4P78 A;  1J26 A;  4KHP E;  1ZBQ A;  2RS6 A;  2ODR D;  2DB2 A;  4DMI A;  1WHQ A;  3ADG A;  2L92 A;  4OOG C;  3C4T A;  2B9D A;  3J81 C;  3J7A G;  5CFF E;  4K0K E;  4JI6 E;  3AV0 A;  4YY3 E;  1X49 A;  2N3G A;  2UU9 E;  4JI5 E;  4L5N C;  4JI4 E;  1IBM E;  1STU A;  4TUG A;  2ODR C;  2L3C A;  2K4V A;  4DV0 E;  1RC7 A;  4JI0 E;  4LTY A;  4GEQ B;  2ZM6 E;  1XMQ E;  1XNR E;  2RTX A;  4KZS A;  5F3W A;  1FKA E;  3K6Q A;  1HNX E;  3ADI A;  4WSP A;  2V83 A;  4B3M E;  2YZT A;  4DV5 E;  2JOB A;  1YYO A;  2WZO A;  4WPY A;  4DR4 E;  2KOU A;  2FTX B;  3HPZ A;  1N36 E;  2B7T A;  2V88 A;  4JYA E;  1IBL E;  2IHR 1;  5LL6 R;  2HHH E;  4DR3 E;  4LFA E;  4TUI A;  1YZ9 A;  4R03 A;  3HTX A;  3DJW A;  4LF5 E;  3H09 A;  4M0V A;  1GQE A;  4DUY E;  2CPN A;  2JR1 A;  2FGG A;  3C4B A;  3F6G A;  3IWD A;  2JY9 A;  3P1X A;  4WFT A;  1DQ3 A;  4F54 A;  4YHH E;  4DV4 E;  4NXM E;  2LUQ A;  1T4L B;  1T4N A;  4L8N A;  4JI1 E;  4DV2 E;  2V85 A;  2LRS A;  1XNQ E;  4R8O A;  3IWC A;  2VE7 C;  4DV7 E;  4LF6 E;  5FLX C;  2FV4 B;  3VYY A;  5LMN E;  4F9B B;  4DV1 E;  3OTO E;  4F9C B;  3HPS A;  2L2K B;  1UIL A;  3RMP A;  1IBK E;  4X8W A;  1WXR A;  4BC7 A;  1EKZ A;  2NUF A;  4GKK E;  2LTS A;  5LMU E;  3LLH A;  5A2Q C;  2UUB E;  2UUC E;  3VYX A;  4JV5 E;  1WHN A;  4JI7 E;  3OML A;  4JI2 E;  4LF4 E;  2VF1 A;  4NXN E;  2L33 A;  3ZOQ B;  3JAM C;  1PKP A;  2JOX A;  2NA2 A;  2KHX A;  3FIG A;  4P7D A;  4X64 E;  2DMY A;  4X66 E;  3J80 C;  3HQ1 A;  2V86 A;  2UXC E;  2L6M A;  2YT4 A;  4LF8 E;  2LJH A;  2LBS B;  1SR9 A;  3T1H E;  4X62 E;  4DV6 E;  1O0W A;  4DV3 E;  2NUE A;  1X47 A;  5DNY A;  4WYQ B;  3HXL A;  2V87 A;  1XMO E;  2M4I A;  3IWB A;  5AE2 A;  4DKK A;  5AE1 A;  1J5E E;  1FJG E;  2M7Q A;  4LF7 E;  2V8Q B;  2B3T B;  3JTZ A;  3KWR A;  2E5L E;  1X48 A;  4DR5 E;  4AQY E;  3DF6 A;  4BBY A;  1N32 E;  4LFC E;  1YYW A;  3AUZ A;  4LFB E;  1GZ6 A;  2RSM A;  2RS7 A;  2MDR A;  4M30 A;  3JU0 A;  2N3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...