1UILA

Double-stranded rna-binding motif of hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Double-stranded RNA-binding motif of Hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding motif
total genus 17
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uilA01
3ADGA 4JI6E 1STUA 4DKKA 1RC7A 2JVAA 3LLHA 4X62E 2UXCE 4LF9E 1HNZE 2UUBE 1PKPA 1UHZA 2LJHA 4DV0E 5IWAE 4LFCE 4JI1E 4M2ZA 5LMUE 2KHXA 2L2KB 2RTXA 4DR1E 2B7VA 1O0WA 4X66E 1IBKE 4WFTA 1T4NA 4JI5E 2DIXA 2LTRA 1XMQE 2YT4A 4LF7E 1YZ9A 1HNWE 1N33E 1ZBTA 4JI7E 1X48A 4KHPE 4DV4E 1YYWA 1XMOE 2L2NA 1N32E 2E5LE 3T1HE 1WHQA 2UU9E 4AQYE 4X65E 3HTXA 4LFBE 4DUZE 1X49A 4DV7E 1FJGE 3ADIA 2UUCE 4GKJE 2L33A 4X64E 3J7Yp 1N34E 1XNRE 1YYKA 4K0KE 5BR8E 1HNXE 4JI0E 4OOGC 2RS7A 4B3ME 4JI2E 2L2MA 2LUPB 2RS6A 4DUYE 4DV1E 2LUQA 3P1XA 5CFFE 1RQ0A 2L3CA 3C4BA 4DV3E 2N3HA 4DV6E 1QU6A 4NXME 4JI3E 1X47A 1T4OA 1EKZA 3C4TA 4DV5E 4LFAE 2LRSA 2EZ6A 2UUAE 2B3TB 2NA2A 2LTSA 3T1YE 1IBME 2LBSB 2NUEA 4M30A 1YYOA 4JI8E 4DR6E 3VYXA 4X8WA 2NUFA 2VQFE 3VYYA 4DR4E 2B7TA 4YY3E 1XNQE 2VQEE 4NXNE 4OX9E 4B3TE 1UILA 4B3RE 1DI2A 4DV2E 1GQEA 2IHR1 4LF5E 4LF8E 1FKAE 2JY9A 2DB2A 4LF6E 4JV5E 5LMNE 1WHNA 4DR5E 2CPNA 1IBLE 3ADLA 2ZM6E 2RSMA 1J5EE 3OTOE 2MDRA 2HHHE 2F4VE 4DR7E 2UXDE 2DMYA 2L3JA 2UXBE 4JI4E 1I94E 4B3SE 4DR2E 2N3GA 1N36E 2NUGA 4LF4E 1HR0E 4JYAE 1J26A 1T4LB 4WYQB 3ADJA 4DR3E 4GKKE 4YHHE
chains in the Genus database with same CATH superfamily
3ADGA 4KWYA 2M4IA 2KONA 2WBSA 4DKKA 1BBOA 5F3WA 3JU0A 2EMBA 2UXCE 2V83A 1ZAAC 1UHZA 1YSAC 4R2RA 5IT9C 1YUJA 4P78A 2HGHA 4X66E 5AE2A 1T4NA 1EH7A 2I9IA 3VK6A 4F54A 4JI5E 3IWDA 1PJTA 2EM0A 2EMKA 3M99B 2E5LE 3T1HE 1WHQA 2WCC3 2ENAA 5KL4A 3H09A 4FK5C 5AE3A 1PJQA 1BB8A 1FJGE 3KWRA 4ZYEA 3J7Yp 2R76A 3HPZA 2EMIA 5ADZA 2RS7A 4L5NC 2L2MA 4LTYA 2RS6A 4DUYE 4NZVA 2EOYA 4WX9A 4DV6E 2K7IA 1X6FA 5A6KA 2DLQA 2YRKA 2EQ1A 4WPYA 2EPNA 3DJWA 3AV0A 3BBGA 2ENCA 1X5WA 4R2PA 2EOFA 2NA2A 2LTSA 3C6KA 4TUGA 1UBDC 4RHBB 2EQ3A 2NUEA 2JXPA 2YTIA 3VYXA 4X8WA 4J8ZA 2JYAA 3VYYA 4DR4E 4OX9E 2EMAA 3DF6A 5KL6A 4DV2E 1GQEA 2EL5A 2EWLA 4DMIA 4DR5E 4RH8A 1IBLE 4BC9A 2HJJA 2Q8UA 2RSMA 1J5EE 2N8XA 2YRHA 3OTOE 5KL3A 4BS9A 3L00A 2L3JA 2UXBE 2DSYA 3HXLA 3EQ1A 3HQ1A 2YTGA 2EPPA 1ZBQA 2EJ4A 4WYQB 2JPAA 2WBTA 4DR3E 2RQLA 3EPKA 4O43A 2EL6A 2EPLX 1STUA 1GTKA 4BHCA 2V89A 2YTFA 2LJHA 4DV0E 4NHRA 4WSPA 2D9HA 4IJDA 4M2ZA 5LMUE 3VHTB 2L2KB 2FV4B 4DR1E 1NEIA 5A6BA 1A1HA 4WFTA 4R8OA 1YZ9A 2CT1A 1XMQE 2EM6A 1ZBTA 2MC6A 1A1IA 4MLVA 3JTZA 1YYWA 1XMOE 3KZZA 4M9VC 2EOJA 2YTEA 4R2QA 2L2NA 2VF1A 3EPHA 4X65E 3HTXA 1KYQA 1X49A 2EMXA 2UUCE 1UN6B 1A1GA 2L33A 2EN2A 5BR8E 4OOGC 3RMPA 2V8QB 2HC5A 3LMLA 1JK1A 1NCSA 2LUPB 2V87A 2EOMA 5A6JA 2EMCA 5CFFE 1MEYC 1Z1BA 2ODRC 2WZOA 4HEIA 3ZOQB 5DNYA 1WRJA 4NXME 1EKZA 1DGCA 4DV5E 4LFAE 2LRSA 1ZU1A 2E72A 4F6MA 4GZNC 3K6QA 2YTJA 3J7AG 2EMGA 5AASA 4DR6E 1A1JA 4YY3E 1XNQE 2M1SA 2VQEE 4B3RE 1DI2A 2EOZA 3ECRA 4LF5E 2EN7A 2DB2A 3TQMA 3MSWA 5LMNE 1WHNA 1N3GA 2BB8A 2EQ0A 2WBUA 2YPNA 2CPNA 3MHHC 3ADLA 2ELZA 2HHHE 2UXDE 2EOQA 3F6HA 1A1LA 2DMYA 2JR1A 3F6GA 4JI4E 1TF6A 2LO3A 5AC4A 3OMLA 1MGTA 1N36E 2EMYA 2R1FA 2NABA 4WSGA 1GZ6A 2YZTA 5AE1A 1F2IG 3BIDA 3ADJA 2EMZA 1KJKA 4GKKE 4I8OA 2KOUA 2EPKX 2L8TA 2H36X 2JVAA 2EPZA 4LF9E 1TN9A 2G7HA 2EM4A 2YU5A 2UUBE 1PKPA 2YSOA 2EMFA 5IWAE 2RPCA 2LT7A 2YWQA 5A6BD 2EOIA 2EP3A 5AC5A 1IBKE 1X3CA 2DIXA 2LTRA 2YT4A 4LF7E 1HNWE 2DLKA 2MDGA 4JI7E 4DV4E 2YTDA 5LL6R 1AH5A 2YRMA 1T39A 2UU9E 1QNTA 4AQYE 1YPNA 3IWCA 2VRDA 1P47A 2FGGA 2EN6A 1LLMC 4DV7E 2JWOA 3ADIA 1TF3A 1N34E 1YYKA 4K0KE 1IMUA 4F2JC 4JI0E 1A1KA 3AUZA 4B3ME 4Q35B 2EM7A 5T6JA 4LU9A 4HTGA 4DV1E 2LUQA 1RQ0A 2I13A 2VE7C 2L3CA 1QU6A 3JAMC 2BBGA 2MC5A 3C4TA 2YTQA 2EPUA 1EH8A 2GPIA 2EZ6A 2UUAE 2B3TB 1JK2A 3T1YE 4GEQB 5FLXC 2EMLA 2EM8A 2LBSB 2CSHA 1YYOA 2YTNA 4JI8E 5TSEA 5A69A 1T38A 3IWBA 2NUFA 2B7TA 2ENHA 2EPXA 2LCEA 2V88A 4NXNE 4B3TE 2IHR1 4LF8E 1IQSA 4KZSA 4L8NA 1FKAE 5IXMB 2V85A 4ZYDA 4F6NA 2ODRD 5KL2A 2EM5A 2PRTA 4Q28A 2MDRA 4F9AB 2JOXA 3MHSC 3THOB 1I94E 4DR2E 2FTXB 3BF2A 1EH6A 2V86A 2NUGA 2ADRA 4LF4E 2EE8A 1IQOA 4O24A 5A2QC 4JYAE 3J81C 1BBGA 3FIGA 1YUIA 2JOBA 4BMJA 2DRPA 4O5GA 2EOEA 4YHHE 2EM3A 4JI6E 2E1MA 2YU8A 1RC7A 4P7DA 3HPSA 1A1FA 3LLHA 4X62E 1G2DC 4IS1C 2ELYA 5IV8B 1HNZE 2EM9A 4LFCE 1X6EA 1G2FC 4JI1E 2KHXA 2RTXA 2B7VA 2L92A 1O0WA 2CTDA 4MLQA 4O4KA 4M0VA 4F9CB 1N33E 1DQ3A 2EMHA 1X48A 4R2CA 4KHPE 1WJPA 1AAYA 4WXDA 5A6AA 1N32E 2EPMX 2EM2A 4R2AA 4BHBA 2EN4A 1B69A 4LFBE 4DUZE 3KZYA 2EN8A 2M7QA 4GKJE 4X64E 1XNRE 2LJUA 1PJSA 2DGCA 2EN3A 1HNXE 5LLQA 2EORA 4R2SA 2J7JA 4JI2E 2L6MA 2EOOA 3C6MA 2F8BA 2JP9A 2LE2A 3UK3C 4R2EA 3P1XA 3THNA 3C4BA 4DV3E 2N3HA 2B9DA 1SFEA 2LV2A 2EPOA 2YTOA 2EPRA 2EPCA 4BC7A 5KL5A 2M9AA 4JI3E 1X47A 1T4OA 2EN1A 4BCAA 1WXRA 3QG5C 2EPAA 2MKDA 3EPJA 1IBME 4ZYGA 4M30A 4N4RB 2MKNA 2GHFA 2VQFE 1X6HA 2EOHA 4TUIA 1UILA 2JY9A 2DMIA 4LF6E 4JV5E 2EL4A 1L4SA 4BBYA 2ZM6E 1SR9A 1ZR9A 3J80C 2F4VE 4DR7E 2EMWA 2RSIA 1YFHA 3BGHA 4X9JA 4WXCA 2YSPA 2YTPA 4F9BB 1PDAA 2GLIA 4B3SE 2N3GA 3EPLA 2EOSA 4R2DA 5KL7A 4ZYHA 4R03A 1HR0E 1J26A 2A25A 1T4LB 1RMDA 2EOXA 2LMZA 2LVHA 2K4VA
chains in the Genus database with same CATH topology
3ADGA 4JI6E 2E1MA 2M4IA 1STUA 2KONA 2L8TA 4DKKA 1RC7A 2H36X 2JVAA 5F3WA 4P7DA 3HPSA 3JU0A 3LLHA 2V89A 4X62E 4LF9E 2UXCE 1HNZE 2G7HA 2V83A 2UUBE 1PKPA 1UHZA 2LJHA 4DV0E 4WSPA 5IWAE 4LFCE 4JI1E 5IT9C 4M2ZA 5LMUE 2KHXA 2L2KB 2FV4B 2RTXA 4DR1E 4P78A 2B7VA 2L92A 1O0WA 4X66E 5AE2A 1IBKE 4WFTA 1T4NA 4R8OA 3VK6A 4M0VA 4F54A 2DIXA 2LTRA 4F9CB 2YT4A 1XMQE 4JI5E 4LF7E 1YZ9A 1HNWE 1N33E 1DQ3A 1ZBTA 2MC6A 3IWDA 4JI7E 1X48A 3JTZA 4KHPE 4DV4E 1YYWA 1XMOE 4I8OA 2L2NA 5LL6R 2VF1A 3T1HE 2E5LE 1N32E 1WHQA 2UU9E 4AQYE 3H09A 3IWCA 4X65E 3HTXA 5AE3A 2FGGA 4LFBE 4DUZE 2M7QA 1X49A 4DV7E 2JWOA 3KWRA 2UUCE 1FJGE 3ADIA 4GKJE 2L33A 4X64E 3J7Yp 1N34E 1XNRE 1YYKA 4K0KE 5BR8E 3HPZA 5ADZA 1HNXE 4JI0E 4OOGC 3RMPA 2V8QB 3AUZA 2RS7A 3LMLA 4L5NC 4B3ME 2L6MA 4JI2E 2L2MA 5T6JA 2F8BA 4LU9A 2LUPB 2LE2A 2V87A 4LTYA 2RS6A 4DUYE 4DV1E 2LUQA 3P1XA 5CFFE 1RQ0A 2VE7C 2L3CA 3C4BA 2ODRC 2N3HA 2WZOA 2B9DA 4DV3E 4DV6E 3ZOQB 4BC7A 5DNYA 1QU6A 4NXME 3JAMC 4WPYA 4JI3E 2MC5A 3DJWA 1X47A 1T4OA 1EKZA 3AV0A 3C4TA 4BCAA 4DV5E 4LFAE 2LRSA 1WXRA 2EZ6A 2UUAE 2B3TB 2NA2A 2LTSA 4GEQB 4TUGA 3T1YE 1IBME 5FLXC 2LBSB 2NUEA 4M30A 1YYOA 4JI8E 3K6QA 3J7AG 3IWBA 5AASA 3VYXA 4X8WA 4J8ZA 4DR6E 2NUFA 2VQFE 3VYYA 4DR4E 2B7TA 4YY3E 1XNQE 2M1SA 2VQEE 4NXNE 4TUIA 2V88A 4OX9E 3DF6A 1UILA 4B3TE 4B3RE 1DI2A 4DV2E 1GQEA 2IHR1 4LF5E 4KZSA 4LF8E 4L8NA 1FKAE 2JY9A 2DB2A 2V85A 4LF6E 2ODRD 4JV5E 2EWLA 3MSWA 4DMIA 5LMNE 1WHNA 4DR5E 2CPNA 4BBYA 1IBLE 4BC9A 3ADLA 2ZM6E 1SR9A 2RSMA 4Q28A 1J5EE 3J80C 2MDRA 3OTOE 4F9AB 2HHHE 2F4VE 3F6HA 2JOXA 4BS9A 4DR7E 2UXDE 2DMYA 2JR1A 2L3JA 3F6GA 2UXBE 4JI4E 4F9BB 2DSYA 1I94E 4B3SE 4DR2E 2FTXB 2N3GA 3HXLA 2V86A 3OMLA 1N36E 2NUGA 4LF4E 3HQ1A 4R03A 1HR0E 1GZ6A 1ZBQA 2YZTA 5A2QC 5AE1A 4JYAE 1J26A 3J81C 1T4LB 3FIGA 4WYQB 2JOBA 4BMJA 3ADJA 4DR3E 4GKKE 2LMZA 4YHHE 2K4VA 2KOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADG A;  4JI6 E;  1STU A;  4DKK A;  1RC7 A;  2JVA A;  3LLH A;  4X62 E;  2UXC E;  4LF9 E;  1HNZ E;  2UUB E;  1PKP A;  1UHZ A;  2LJH A;  4DV0 E;  5IWA E;  4LFC E;  4JI1 E;  4M2Z A;  5LMU E;  2KHX A;  2L2K B;  2RTX A;  4DR1 E;  2B7V A;  1O0W A;  4X66 E;  1IBK E;  4WFT A;  1T4N A;  4JI5 E;  2DIX A;  2LTR A;  1XMQ E;  2YT4 A;  4LF7 E;  1YZ9 A;  1HNW E;  1N33 E;  1ZBT A;  4JI7 E;  1X48 A;  4KHP E;  4DV4 E;  1YYW A;  1XMO E;  2L2N A;  1N32 E;  2E5L E;  3T1H E;  1WHQ A;  2UU9 E;  4AQY E;  4X65 E;  3HTX A;  4LFB E;  4DUZ E;  1X49 A;  4DV7 E;  1FJG E;  3ADI A;  2UUC E;  4GKJ E;  2L33 A;  4X64 E;  3J7Y p;  1N34 E;  1XNR E;  1YYK A;  4K0K E;  5BR8 E;  1HNX E;  4JI0 E;  4OOG C;  2RS7 A;  4B3M E;  4JI2 E;  2L2M A;  2LUP B;  2RS6 A;  4DUY E;  4DV1 E;  2LUQ A;  3P1X A;  5CFF E;  1RQ0 A;  2L3C A;  3C4B A;  4DV3 E;  2N3H A;  4DV6 E;  1QU6 A;  4NXM E;  4JI3 E;  1X47 A;  1T4O A;  1EKZ A;  3C4T A;  4DV5 E;  4LFA E;  2LRS A;  2EZ6 A;  2UUA E;  2B3T B;  2NA2 A;  2LTS A;  3T1Y E;  1IBM E;  2LBS B;  2NUE A;  4M30 A;  1YYO A;  4JI8 E;  4DR6 E;  3VYX A;  4X8W A;  2NUF A;  2VQF E;  3VYY A;  4DR4 E;  2B7T A;  4YY3 E;  1XNQ E;  2VQE E;  4NXN E;  4OX9 E;  4B3T E;  1UIL A;  4B3R E;  1DI2 A;  4DV2 E;  1GQE A;  2IHR 1;  4LF5 E;  4LF8 E;  1FKA E;  2JY9 A;  2DB2 A;  4LF6 E;  4JV5 E;  5LMN E;  1WHN A;  4DR5 E;  2CPN A;  1IBL E;  3ADL A;  2ZM6 E;  2RSM A;  1J5E E;  3OTO E;  2MDR A;  2HHH E;  2F4V E;  4DR7 E;  2UXD E;  2DMY A;  2L3J A;  2UXB E;  4JI4 E;  1I94 E;  4B3S E;  4DR2 E;  2N3G A;  1N36 E;  2NUG A;  4LF4 E;  1HR0 E;  4JYA E;  1J26 A;  1T4L B;  4WYQ B;  3ADJ A;  4DR3 E;  4GKK E;  4YHH E; 
#chains in the Genus database with same CATH topology
 3ADG A;  4KWY A;  2M4I A;  2KON A;  2WBS A;  4DKK A;  1BBO A;  5F3W A;  3JU0 A;  2EMB A;  2UXC E;  2V83 A;  1ZAA C;  1UHZ A;  1YSA C;  4R2R A;  5IT9 C;  1YUJ A;  4P78 A;  2HGH A;  4X66 E;  5AE2 A;  1T4N A;  1EH7 A;  2I9I A;  3VK6 A;  4F54 A;  4JI5 E;  3IWD A;  1PJT A;  2EM0 A;  2EMK A;  3M99 B;  2E5L E;  3T1H E;  1WHQ A;  2WCC 3;  2ENA A;  5KL4 A;  3H09 A;  4FK5 C;  5AE3 A;  1PJQ A;  1BB8 A;  1FJG E;  3KWR A;  4ZYE A;  3J7Y p;  2R76 A;  3HPZ A;  2EMI A;  5ADZ A;  2RS7 A;  4L5N C;  2L2M A;  4LTY A;  2RS6 A;  4DUY E;  4NZV A;  2EOY A;  4WX9 A;  4DV6 E;  2K7I A;  1X6F A;  5A6K A;  2DLQ A;  2YRK A;  2EQ1 A;  4WPY A;  2EPN A;  3DJW A;  3AV0 A;  3BBG A;  2ENC A;  1X5W A;  4R2P A;  2EOF A;  2NA2 A;  2LTS A;  3C6K A;  4TUG A;  1UBD C;  4RHB B;  2EQ3 A;  2NUE A;  2JXP A;  2YTI A;  3VYX A;  4X8W A;  4J8Z A;  2JYA A;  3VYY A;  4DR4 E;  4OX9 E;  2EMA A;  3DF6 A;  5KL6 A;  4DV2 E;  1GQE A;  2EL5 A;  2EWL A;  4DMI A;  4DR5 E;  4RH8 A;  1IBL E;  4BC9 A;  2HJJ A;  2Q8U A;  2RSM A;  1J5E E;  2N8X A;  2YRH A;  3OTO E;  5KL3 A;  4BS9 A;  3L00 A;  2L3J A;  2UXB E;  2DSY A;  3HXL A;  3EQ1 A;  3HQ1 A;  2YTG A;  2EPP A;  1ZBQ A;  2EJ4 A;  4WYQ B;  2JPA A;  2WBT A;  4DR3 E;  2RQL A;  3EPK A;  4O43 A;  2EL6 A;  2EPL X;  1STU A;  1GTK A;  4BHC A;  2V89 A;  2YTF A;  2LJH A;  4DV0 E;  4NHR A;  4WSP A;  2D9H A;  4IJD A;  4M2Z A;  5LMU E;  3VHT B;  2L2K B;  2FV4 B;  4DR1 E;  1NEI A;  5A6B A;  1A1H A;  4WFT A;  4R8O A;  1YZ9 A;  2CT1 A;  1XMQ E;  2EM6 A;  1ZBT A;  2MC6 A;  1A1I A;  4MLV A;  3JTZ A;  1YYW A;  1XMO E;  3KZZ A;  4M9V C;  2EOJ A;  2YTE A;  4R2Q A;  2L2N A;  2VF1 A;  3EPH A;  4X65 E;  3HTX A;  1KYQ A;  1X49 A;  2EMX A;  2UUC E;  1UN6 B;  1A1G A;  2L33 A;  2EN2 A;  5BR8 E;  4OOG C;  3RMP A;  2V8Q B;  2HC5 A;  3LML A;  1JK1 A;  1NCS A;  2LUP B;  2V87 A;  2EOM A;  5A6J A;  2EMC A;  5CFF E;  1MEY C;  1Z1B A;  2ODR C;  2WZO A;  4HEI A;  3ZOQ B;  5DNY A;  1WRJ A;  4NXM E;  1EKZ A;  1DGC A;  4DV5 E;  4LFA E;  2LRS A;  1ZU1 A;  2E72 A;  4F6M A;  4GZN C;  3K6Q A;  2YTJ A;  3J7A G;  2EMG A;  5AAS A;  4DR6 E;  1A1J A;  4YY3 E;  1XNQ E;  2M1S A;  2VQE E;  4B3R E;  1DI2 A;  2EOZ A;  3ECR A;  4LF5 E;  2EN7 A;  2DB2 A;  3TQM A;  3MSW A;  5LMN E;  1WHN A;  1N3G A;  2BB8 A;  2EQ0 A;  2WBU A;  2YPN A;  2CPN A;  3MHH C;  3ADL A;  2ELZ A;  2HHH E;  2UXD E;  2EOQ A;  3F6H A;  1A1L A;  2DMY A;  2JR1 A;  3F6G A;  4JI4 E;  1TF6 A;  2LO3 A;  5AC4 A;  3OML A;  1MGT A;  1N36 E;  2EMY A;  2R1F A;  2NAB A;  4WSG A;  1GZ6 A;  2YZT A;  5AE1 A;  1F2I G;  3BID A;  3ADJ A;  2EMZ A;  1KJK A;  4GKK E;  4I8O A;  2KOU A;  2EPK X;  2L8T A;  2H36 X;  2JVA A;  2EPZ A;  4LF9 E;  1TN9 A;  2G7H A;  2EM4 A;  2YU5 A;  2UUB E;  1PKP A;  2YSO A;  2EMF A;  5IWA E;  2RPC A;  2LT7 A;  2YWQ A;  5A6B D;  2EOI A;  2EP3 A;  5AC5 A;  1IBK E;  1X3C A;  2DIX A;  2LTR A;  2YT4 A;  4LF7 E;  1HNW E;  2DLK A;  2MDG A;  4JI7 E;  4DV4 E;  2YTD A;  5LL6 R;  1AH5 A;  2YRM A;  1T39 A;  2UU9 E;  1QNT A;  4AQY E;  1YPN A;  3IWC A;  2VRD A;  1P47 A;  2FGG A;  2EN6 A;  1LLM C;  4DV7 E;  2JWO A;  3ADI A;  1TF3 A;  1N34 E;  1YYK A;  4K0K E;  1IMU A;  4F2J C;  4JI0 E;  1A1K A;  3AUZ A;  4B3M E;  4Q35 B;  2EM7 A;  5T6J A;  4LU9 A;  4HTG A;  4DV1 E;  2LUQ A;  1RQ0 A;  2I13 A;  2VE7 C;  2L3C A;  1QU6 A;  3JAM C;  2BBG A;  2MC5 A;  3C4T A;  2YTQ A;  2EPU A;  1EH8 A;  2GPI A;  2EZ6 A;  2UUA E;  2B3T B;  1JK2 A;  3T1Y E;  4GEQ B;  5FLX C;  2EML A;  2EM8 A;  2LBS B;  2CSH A;  1YYO A;  2YTN A;  4JI8 E;  5TSE A;  5A69 A;  1T38 A;  3IWB A;  2NUF A;  2B7T A;  2ENH A;  2EPX A;  2LCE A;  2V88 A;  4NXN E;  4B3T E;  2IHR 1;  4LF8 E;  1IQS A;  4KZS A;  4L8N A;  1FKA E;  5IXM B;  2V85 A;  4ZYD A;  4F6N A;  2ODR D;  5KL2 A;  2EM5 A;  2PRT A;  4Q28 A;  2MDR A;  4F9A B;  2JOX A;  3MHS C;  3THO B;  1I94 E;  4DR2 E;  2FTX B;  3BF2 A;  1EH6 A;  2V86 A;  2NUG A;  2ADR A;  4LF4 E;  2EE8 A;  1IQO A;  4O24 A;  5A2Q C;  4JYA E;  3J81 C;  1BBG A;  3FIG A;  1YUI A;  2JOB A;  4BMJ A;  2DRP A;  4O5G A;  2EOE A;  4YHH E;  2EM3 A;  4JI6 E;  2E1M A;  2YU8 A;  1RC7 A;  4P7D A;  3HPS A;  1A1F A;  3LLH A;  4X62 E;  1G2D C;  4IS1 C;  2ELY A;  5IV8 B;  1HNZ E;  2EM9 A;  4LFC E;  1X6E A;  1G2F C;  4JI1 E;  2KHX A;  2RTX A;  2B7V A;  2L92 A;  1O0W A;  2CTD A;  4MLQ A;  4O4K A;  4M0V A;  4F9C B;  1N33 E;  1DQ3 A;  2EMH A;  1X48 A;  4R2C A;  4KHP E;  1WJP A;  1AAY A;  4WXD A;  5A6A A;  1N32 E;  2EPM X;  2EM2 A;  4R2A A;  4BHB A;  2EN4 A;  1B69 A;  4LFB E;  4DUZ E;  3KZY A;  2EN8 A;  2M7Q A;  4GKJ E;  4X64 E;  1XNR E;  2LJU A;  1PJS A;  2DGC A;  2EN3 A;  1HNX E;  5LLQ A;  2EOR A;  4R2S A;  2J7J A;  4JI2 E;  2L6M A;  2EOO A;  3C6M A;  2F8B A;  2JP9 A;  2LE2 A;  3UK3 C;  4R2E A;  3P1X A;  3THN A;  3C4B A;  4DV3 E;  2N3H A;  2B9D A;  1SFE A;  2LV2 A;  2EPO A;  2YTO A;  2EPR A;  2EPC A;  4BC7 A;  5KL5 A;  2M9A A;  4JI3 E;  1X47 A;  1T4O A;  2EN1 A;  4BCA A;  1WXR A;  3QG5 C;  2EPA A;  2MKD A;  3EPJ A;  1IBM E;  4ZYG A;  4M30 A;  4N4R B;  2MKN A;  2GHF A;  2VQF E;  1X6H A;  2EOH A;  4TUI A;  1UIL A;  2JY9 A;  2DMI A;  4LF6 E;  4JV5 E;  2EL4 A;  1L4S A;  4BBY A;  2ZM6 E;  1SR9 A;  1ZR9 A;  3J80 C;  2F4V E;  4DR7 E;  2EMW A;  2RSI A;  1YFH A;  3BGH A;  4X9J A;  4WXC A;  2YSP A;  2YTP A;  4F9B B;  1PDA A;  2GLI A;  4B3S E;  2N3G A;  3EPL A;  2EOS A;  4R2D A;  5KL7 A;  4ZYH A;  4R03 A;  1HR0 E;  1J26 A;  2A25 A;  1T4L B;  1RMD A;  2EOX A;  2LMZ A;  2LVH A;  2K4V A; 
#chains in the Genus database with same CATH homology
 3ADG A;  4JI6 E;  2E1M A;  2M4I A;  1STU A;  2KON A;  2L8T A;  4DKK A;  1RC7 A;  2H36 X;  2JVA A;  5F3W A;  4P7D A;  3HPS A;  3JU0 A;  3LLH A;  2V89 A;  4X62 E;  4LF9 E;  2UXC E;  1HNZ E;  2G7H A;  2V83 A;  2UUB E;  1PKP A;  1UHZ A;  2LJH A;  4DV0 E;  4WSP A;  5IWA E;  4LFC E;  4JI1 E;  5IT9 C;  4M2Z A;  5LMU E;  2KHX A;  2L2K B;  2FV4 B;  2RTX A;  4DR1 E;  4P78 A;  2B7V A;  2L92 A;  1O0W A;  4X66 E;  5AE2 A;  1IBK E;  4WFT A;  1T4N A;  4R8O A;  3VK6 A;  4M0V A;  4F54 A;  2DIX A;  2LTR A;  4F9C B;  2YT4 A;  1XMQ E;  4JI5 E;  4LF7 E;  1YZ9 A;  1HNW E;  1N33 E;  1DQ3 A;  1ZBT A;  2MC6 A;  3IWD A;  4JI7 E;  1X48 A;  3JTZ A;  4KHP E;  4DV4 E;  1YYW A;  1XMO E;  4I8O A;  2L2N A;  5LL6 R;  2VF1 A;  3T1H E;  2E5L E;  1N32 E;  1WHQ A;  2UU9 E;  4AQY E;  3H09 A;  3IWC A;  4X65 E;  3HTX A;  5AE3 A;  2FGG A;  4LFB E;  4DUZ E;  2M7Q A;  1X49 A;  4DV7 E;  2JWO A;  3KWR A;  2UUC E;  1FJG E;  3ADI A;  4GKJ E;  2L33 A;  4X64 E;  3J7Y p;  1N34 E;  1XNR E;  1YYK A;  4K0K E;  5BR8 E;  3HPZ A;  5ADZ A;  1HNX E;  4JI0 E;  4OOG C;  3RMP A;  2V8Q B;  3AUZ A;  2RS7 A;  3LML A;  4L5N C;  4B3M E;  2L6M A;  4JI2 E;  2L2M A;  5T6J A;  2F8B A;  4LU9 A;  2LUP B;  2LE2 A;  2V87 A;  4LTY A;  2RS6 A;  4DUY E;  4DV1 E;  2LUQ A;  3P1X A;  5CFF E;  1RQ0 A;  2VE7 C;  2L3C A;  3C4B A;  2ODR C;  2N3H A;  2WZO A;  2B9D A;  4DV3 E;  4DV6 E;  3ZOQ B;  4BC7 A;  5DNY A;  1QU6 A;  4NXM E;  3JAM C;  4WPY A;  4JI3 E;  2MC5 A;  3DJW A;  1X47 A;  1T4O A;  1EKZ A;  3AV0 A;  3C4T A;  4BCA A;  4DV5 E;  4LFA E;  2LRS A;  1WXR A;  2EZ6 A;  2UUA E;  2B3T B;  2NA2 A;  2LTS A;  4GEQ B;  4TUG A;  3T1Y E;  1IBM E;  5FLX C;  2LBS B;  2NUE A;  4M30 A;  1YYO A;  4JI8 E;  3K6Q A;  3J7A G;  3IWB A;  5AAS A;  3VYX A;  4X8W A;  4J8Z A;  4DR6 E;  2NUF A;  2VQF E;  3VYY A;  4DR4 E;  2B7T A;  4YY3 E;  1XNQ E;  2M1S A;  2VQE E;  4NXN E;  4TUI A;  2V88 A;  4OX9 E;  3DF6 A;  1UIL A;  4B3T E;  4B3R E;  1DI2 A;  4DV2 E;  1GQE A;  2IHR 1;  4LF5 E;  4KZS A;  4LF8 E;  4L8N A;  1FKA E;  2JY9 A;  2DB2 A;  2V85 A;  4LF6 E;  2ODR D;  4JV5 E;  2EWL A;  3MSW A;  4DMI A;  5LMN E;  1WHN A;  4DR5 E;  2CPN A;  4BBY A;  1IBL E;  4BC9 A;  3ADL A;  2ZM6 E;  1SR9 A;  2RSM A;  4Q28 A;  1J5E E;  3J80 C;  2MDR A;  3OTO E;  4F9A B;  2HHH E;  2F4V E;  3F6H A;  2JOX A;  4BS9 A;  4DR7 E;  2UXD E;  2DMY A;  2JR1 A;  2L3J A;  3F6G A;  2UXB E;  4JI4 E;  4F9B B;  2DSY A;  1I94 E;  4B3S E;  4DR2 E;  2FTX B;  2N3G A;  3HXL A;  2V86 A;  3OML A;  1N36 E;  2NUG A;  4LF4 E;  3HQ1 A;  4R03 A;  1HR0 E;  1GZ6 A;  1ZBQ A;  2YZT A;  5A2Q C;  5AE1 A;  4JYA E;  1J26 A;  3J81 C;  1T4L B;  3FIG A;  4WYQ B;  2JOB A;  4BMJ A;  3ADJ A;  4DR3 E;  4GKK E;  2LMZ A;  4YHH E;  2K4V A;  2KOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...