1UILA

Double-stranded rna-binding motif of hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-binding motif
publication title Structure of Double-stranded RNA-binding motif of Hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 17
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uilA01
2YT4A 5IWAE 4B3SE 2IHR1 1HNWE 3ADJA 4X62E 1YYOA 2LTSA 1WHNA 4DV5E 1X49A 3C4TA 2L2NA 4OX9E 5LMNE 2RS6A 4JI4E 3HTXA 3T1YE 2JVAA 4JI7E 4JI8E 2NUFA 4LFAE 2LBSB 1QU6A 1T4LB 2LRSA 1YYKA 1N36E 1FJGE 2N3GA 1UHZA 4DUYE 4NXNE 1DI2A 2UUCE 1WHQA 1ZBTA 4JI6E 5CFFE 4DR4E 1O0WA 4DR7E 1X47A 4DUZE 1UILA 4JI2E 4DR2E 4LF7E 4JI5E 2B3TB 2N3HA 3LLHA 4DV3E 4DR5E 2ZM6E 3P1XA 2UUAE 4DV7E 2NA2A 1N34E 2UXDE 2B7TA 4JYAE 2MDRA 2L33A 2DIXA 2DB2A 1J26A 2L3JA 4LF9E 4K0KE 3VYYA 4DR3E 3J7Yp 4B3TE 1XNRE 4X65E 3C4BA 2F4VE 4JI3E 2NUEA 2CPNA 4X8WA 3ADGA 2L3CA 1RC7A 2RS7A 1XMOE 2DMYA 2LUQA 2VQFE 4YHHE 4DV1E 1XNQE 4KHPE 4DV6E 4LFBE 2NUGA 1FKAE 4M2ZA 1T4OA 1YYWA 4X64E 1N32E 4YY3E 2RTXA 4OOGC 4B3ME 4WYQB 4JI1E 1HNXE 4NXME 2UU9E 4DR1E 4AQYE 5LMUE 4DV4E 5BR8E 3ADLA 4LF5E 4GKKE 1HNZE 2E5LE 4LF8E 2UXCE 4B3RE 4WFTA 1YZ9A 1STUA 4DKKA 1IBKE 2EZ6A 1IBME 1I94E 2UUBE 4LFCE 4JV5E 4DV2E 2LJHA 2HHHE 3VYXA 2KHXA 4JI0E 2L2MA 1RQ0A 2UXBE 2JY9A 4LF4E 1X48A 4DV0E 1XMQE 1J5EE 2LUPB 3T1HE 2L2KB 3ADIA 4M30A 1GQEA 1HR0E 2RSMA 1EKZA 2B7VA 3OTOE 2LTRA 4GKJE 1N33E 4LF6E 4DR6E 1IBLE 4X66E 2VQEE 1PKPA 1T4NA
chains in the Genus database with same CATH superfamily
2YT4A 2ELYA 4X62E 3ECRA 1IMUA 1PJTA 3EQ1A 4LFAE 4M0VA 2EOHA 2V86A 1KJKA 1QU6A 3AV0A 3TQMA 2GLIA 3J81C 2EOFA 4LTYA 1FJGE 2YTGA 2I9IA 1DGCA 2VE7C 4Q35B 4ZYDA 1WHQA 4MLQA 5A2QC 4JI6E 1UBDC 4RH8A 1O0WA 2I13A 2YRHA 2M9AA 4F2JC 2YTIA 3THNA 3FIGA 2YTFA 2EWLA 4LF7E 2HC5A 4R2AA 1BBOA 2B3TB 3LLHA 4BS9A 3RMPA 1B69A 2GHFA 4MLVA 4I8OA 3IWCA 2ENAA 2MDGA 4JYAE 1SR9A 3EPLA 1TN9A 3KWRA 1GZ6A 2EORA 2WBTA 4DR3E 3J7Yp 4B3TE 1N3GA 4X8WA 2HJJA 1XMOE 3MHHC 5A6KA 4DV1E 4DV6E 1A1HA 1A1LA 4LFBE 2NUGA 4WPYA 2EOYA 1PJSA 2EL6A 4X64E 2EOSA 1N32E 1NCSA 4OOGC 4B3ME 3BBGA 3EPKA 2EM3A 1JK2A 5ADZA 4LF5E 4GKKE 2DMIA 2YTQA 2DRPA 1STUA 2YPNA 1YFHA 5TSEA 4P78A 4IJDA 2KONA 2JYAA 1X6HA 5A6BD 4DV2E 2FGGA 2EOQA 5KL6A 4R2DA 2HHHE 3M99B 3VHTB 2KHXA 2L92A 1A1FA 2LVHA 2VRDA 1TF3A 1MGTA 5IV8B 1A1JA 2EN6A 2CT1A 4HTGA 2B7VA 1EKZA 2YTEA 2M7QA 4GKJE 3H09A 2DLQA 1N33E 1T4NA 2EZ6A 5IWAE 2EOXA 2IHR1 3ADJA 1G2DC 4WXDA 5KL7A 1X49A 5LMNE 3T1YE 2LV2A 4JI7E 1IQSA 4JI8E 1GTKA 2NUFA 4NHRA 3J7AG 4R2PA 4N4RB 1YUIA 1UN6B 2PRTA 2FV4B 3IWDA 2YTPA 4DR7E 2EPZA 1WRJA 2WCC3 4DUZE 4JI2E 2EMFA 4DR2E 2YU5A 4DV3E 4DR5E 2V83A 3ZOQB 2EPMX 4R2RA 2EOOA 4J8ZA 4DV7E 2NA2A 2DGCA 3K6QA 1N34E 1Z1BA 1L4SA 2EN7A 1PDAA 2JOBA 3HQ1A 1A1GA 2DB2A 2ENHA 2JXPA 4LF9E 3QG5C 3VYYA 2EQ0A 3C4BA 2EOZA 4TUIA 2NUEA 2L3CA 2R1FA 2DMYA 2EMXA 2Q8UA 2EQ3A 5LLQA 5KL5A 3J80C 3VK6A 3AUZA 1ZU1A 4M2ZA 5KL2A 1X5WA 4YY3E 4M9VC 3KZZA 3KZYA 4BC9A 5A69A 3EPHA 1HNXE 3HXLA 4AQYE 2D9HA 5LMUE 2EM9A 2BBGA 2EE8A 2YRMA 2A25A 3ADLA 1HNZE 2E5LE 4LF8E 3L00A 2EM8A 4TUGA 3C6KA 2EM2A 4LU9A 1YSAC 4BBYA 2WZOA 2YTDA 4F6NA 3VYXA 2EPNA 4JI0E 1RQ0A 2HGHA 3IWBA 5F3WA 2YRKA 1XMQE 1J5EE 3EPJA 3T1HE 4M30A 4R2EA 1YPNA 2DLKA 2M4IA 4L8NA 2WBSA 2L8TA 4LF6E 1BB8A 3THOB 1HNWE 1YYOA 2LTSA 1WHNA 3HPZA 3C4TA 4OX9E 3HTXA 4F54A 4F6MA 2EPOA 1A1KA 4O5GA 1NEIA 5AE1A 1T4LB 2BB8A 4FK5C 4KWYA 2DSYA 2LRSA 5A6JA 4IS1C 3BF2A 1JK1A 4NXNE 1YYKA 4DUYE 4NZVA 2UUCE 1ZBTA 4R2SA 4GEQB 4DR4E 2MC5A 2EPCA 4ZYEA 1T38A 5AE3A 2V87A 2WBUA 2N8XA 2EOIA 4Q28A 1G2FC 4JI5E 3MHSC 2L6MA 2ZM6E 2M1SA 3P1XA 2EMAA 2B7TA 2YSOA 2MDRA 2L33A 1KYQA 4WSGA 2EN1A 1X6FA 1J26A 1ZBQA 3JAMC 2R76A 2LMZA 4F9BB 1ZAAC 4K0KE 1XNRE 2F4VE 2EM6A 1RC7A 2RS7A 5AASA 2CSHA 2LUQA 4L5NC 5AE2A 2VQFE 4YHHE 5AC4A 4DMIA 4BC7A 2RQLA 1X3CA 4O43A 1YYWA 2LJUA 2EMIA 2LT7A 2K4VA 4RHBB 2RPCA 4WYQB 4R2CA 4NXME 2EPLX 2CTDA 2V8QB 4DR1E 1LLMC 3BIDA 1PJQA 2EJ4A 4R8OA 5BR8E 3HPSA 4BCAA 2MC6A 4WFTA 1YZ9A 4B3RE 2J7JA 1IBKE 2ENCA 2EPAA 3UK3C 2K7IA 2MKNA 1I94E 2UUBE 2VF1A 4LFCE 3DJWA 5FLXC 2V89A 2UXBE 2EPUA 1EH7A 2NABA 1A1IA 3ADIA 1GQEA 2EMBA 2RSMA 4BHCA 3OTOE 2ELZA 2V88A 2YTNA 4R2QA 1IQOA 5A6BA 2EMCA 2LO3A 4X66E 2VQEE 2EMHA 3C6MA 3OMLA 1IBLE 5A6AA 4O24A 2EN8A 4ZYHA 2JP9A 4B3SE 1SFEA 2E72A 4ZYGA 4DV5E 5T6JA 2EMLA 2EPRA 2L2NA 2B9DA 2YTOA 2V85A 2EOJA 2EM7A 2RS6A 4JI4E 2EN3A 2JVAA 3DF6A 2GPIA 1YUJA 1TF6A 5AC5A 4F9CB 2LBSB 1X6EA 4F9AB 2G7HA 1N36E 2N3GA 1UHZA 2E1MA 1DI2A 2EN2A 1BBGA 2YZTA 5CFFE 1ZR9A 2EPXA 2EQ1A 3F6HA 5IXMB 1X47A 1UILA 4R03A 2YTJA 1P47A 4P7DA 1QNTA 2H36X 1EH8A 2EMWA 2N3HA 5DNYA 2EM5A 1AH5A 3JTZA 2UUAE 2LCEA 2ODRD 2UXDE 2EMGA 2JWOA 2EM4A 2DIXA 3LMLA 4O4KA 3F6GA 4BHBA 2L3JA 5IT9C 3BGHA 4X65E 2JPAA 2ODRC 2EMYA 4JI3E 1WJPA 2CPNA 3ADGA 2EPPA 4KHPE 1XNQE 3MSWA 1DQ3A 2KOUA 1FKAE 1AAYA 1T4OA 4WSPA 2YU8A 2EL5A 2EOEA 2RTXA 4WX9A 4JI1E 2EL4A 3JU0A 2EOMA 4WXCA 1RMDA 2ADRA 2UU9E 2JR1A 4DV4E 5KL3A 2UXCE 4DKKA 2EMKA 2YWQA 2EP3A 5LL6R 2JOXA 1IBME 1MEYC 4JV5E 2LJHA 4GZNC 2EMZA 2EN4A 2YSPA 2L2MA 2RSIA 2JY9A 4LF4E 1X48A 4BMJA 4DV0E 5KL4A 2LUPB 2L2KB 1EH6A 1WXRA 1HR0E 2LE2A 2EM0A 4X9JA 2MKDA 1T39A 2LTRA 4HEIA 4KZSA 1F2IG 2EPKX 4DR6E 2FTXB 1PKPA 2F8BA
chains in the Genus database with same CATH topology
2YT4A 5IWAE 4B3SE 2IHR1 1HNWE 3ADJA 4X62E 1YYOA 2LTSA 1WHNA 3HPZA 4DV5E 5T6JA 1X49A 3C4TA 2L2NA 2B9DA 4OX9E 2V85A 5LMNE 2RS6A 4JI4E 3HTXA 3T1YE 4F54A 2JVAA 3DF6A 4JI7E 4JI8E 2NUFA 4LFAE 4M0VA 4F9CB 2V86A 2LBSB 3J7AG 5AE1A 1QU6A 1T4LB 3AV0A 4F9AB 2G7HA 3J81C 2DSYA 2LRSA 1YYKA 4LTYA 1N36E 1FJGE 2N3GA 1UHZA 4DUYE 4NXNE 2VE7C 2E1MA 1DI2A 2UUCE 1WHQA 1ZBTA 5A2QC 4JI6E 4GEQB 2FV4B 2YZTA 5CFFE 4DR4E 1O0WA 2MC5A 3F6HA 3IWDA 4DR7E 1X47A 4DUZE 1UILA 5AE3A 4R03A 4JI2E 2V87A 4P7DA 4DR2E 2H36X 3FIGA 4Q28A 2EWLA 4LF7E 4JI5E 2B3TB 2N3HA 3LLHA 2L6MA 4BS9A 5DNYA 4DV3E 4DR5E 3RMPA 2V83A 3ZOQB 2M1SA 3JTZA 3P1XA 2ZM6E 2UUAE 2ODRD 4J8ZA 4DV7E 2NA2A 3IWCA 4I8OA 3K6QA 1N34E 2UXDE 2B7TA 2JWOA 2MDRA 2L33A 4JYAE 1SR9A 2JOBA 2DIXA 3LMLA 3HQ1A 1GZ6A 3KWRA 2DB2A 3F6GA 1J26A 1ZBQA 3JAMC 2L3JA 4LF9E 5IT9C 4K0KE 2LMZA 4F9BB 3VYYA 4DR3E 3J7Yp 4B3TE 1XNRE 4X65E 2ODRC 3C4BA 2F4VE 4TUIA 4JI3E 2NUEA 2CPNA 4X8WA 3ADGA 2L3CA 1RC7A 2RS7A 5AASA 2DMYA 2LUQA 4L5NC 5AE2A 2VQFE 1XMOE 3J80C 4YHHE 4DV1E 1XNQE 3MSWA 1DQ3A 2KOUA 3VK6A 4DV6E 3AUZA 4KHPE 4LFBE 4DMIA 2NUGA 1FKAE 4BC7A 1T4OA 4M2ZA 4WPYA 1YYWA 4WSPA 4X64E 1N32E 4YY3E 2K4VA 2RTXA 4OOGC 4B3ME 4WYQB 4BC9A 4JI1E 3JU0A 1HNXE 4NXME 2UU9E 3HXLA 2V8QB 4DR1E 4AQYE 5LMUE 2JR1A 5ADZA 4DV4E 4R8OA 5BR8E 3ADLA 4LF5E 4GKKE 1HNZE 2E5LE 4LF8E 3HPSA 2UXCE 4BCAA 2MC6A 4WFTA 4TUGA 1YZ9A 4B3RE 1STUA 4DKKA 5LL6R 4P78A 1IBKE 2EZ6A 2JOXA 1IBME 2KONA 4LU9A 1I94E 2UUBE 2VF1A 4BBYA 2WZOA 4LFCE 4DV2E 4JV5E 2LJHA 2FGGA 3DJWA 2HHHE 3VYXA 2KHXA 5FLXC 4JI0E 2L2MA 1RQ0A 2L92A 2V89A 2UXBE 2JY9A 4LF4E 3IWBA 1X48A 4BMJA 5F3WA 4DV0E 1XMQE 1J5EE 2LUPB 3T1HE 2L2KB 3ADIA 4M30A 1GQEA 1WXRA 1HR0E 2RSMA 2LE2A 2M4IA 4L8NA 1EKZA 2B7VA 2M7QA 2L8TA 2LTRA 3OTOE 2V88A 3H09A 4GKJE 4KZSA 1N33E 4LF6E 4DR6E 2FTXB 4X66E 2VQEE 1IBLE 3OMLA 1PKPA 2F8BA 1T4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT4 A;  5IWA E;  4B3S E;  2IHR 1;  1HNW E;  3ADJ A;  4X62 E;  1YYO A;  2LTS A;  1WHN A;  4DV5 E;  1X49 A;  3C4T A;  2L2N A;  4OX9 E;  5LMN E;  2RS6 A;  4JI4 E;  3HTX A;  3T1Y E;  2JVA A;  4JI7 E;  4JI8 E;  2NUF A;  4LFA E;  2LBS B;  1QU6 A;  1T4L B;  2LRS A;  1YYK A;  1N36 E;  1FJG E;  2N3G A;  1UHZ A;  4DUY E;  4NXN E;  1DI2 A;  2UUC E;  1WHQ A;  1ZBT A;  4JI6 E;  5CFF E;  4DR4 E;  1O0W A;  4DR7 E;  1X47 A;  4DUZ E;  1UIL A;  4JI2 E;  4DR2 E;  4LF7 E;  4JI5 E;  2B3T B;  2N3H A;  3LLH A;  4DV3 E;  4DR5 E;  2ZM6 E;  3P1X A;  2UUA E;  4DV7 E;  2NA2 A;  1N34 E;  2UXD E;  2B7T A;  4JYA E;  2MDR A;  2L33 A;  2DIX A;  2DB2 A;  1J26 A;  2L3J A;  4LF9 E;  4K0K E;  3VYY A;  4DR3 E;  3J7Y p;  4B3T E;  1XNR E;  4X65 E;  3C4B A;  2F4V E;  4JI3 E;  2NUE A;  2CPN A;  4X8W A;  3ADG A;  2L3C A;  1RC7 A;  2RS7 A;  1XMO E;  2DMY A;  2LUQ A;  2VQF E;  4YHH E;  4DV1 E;  1XNQ E;  4KHP E;  4DV6 E;  4LFB E;  2NUG A;  1FKA E;  4M2Z A;  1T4O A;  1YYW A;  4X64 E;  1N32 E;  4YY3 E;  2RTX A;  4OOG C;  4B3M E;  4WYQ B;  4JI1 E;  1HNX E;  4NXM E;  2UU9 E;  4DR1 E;  4AQY E;  5LMU E;  4DV4 E;  5BR8 E;  3ADL A;  4LF5 E;  4GKK E;  1HNZ E;  2E5L E;  4LF8 E;  2UXC E;  4B3R E;  4WFT A;  1YZ9 A;  1STU A;  4DKK A;  1IBK E;  2EZ6 A;  1IBM E;  1I94 E;  2UUB E;  4LFC E;  4JV5 E;  4DV2 E;  2LJH A;  2HHH E;  3VYX A;  2KHX A;  4JI0 E;  2L2M A;  1RQ0 A;  2UXB E;  2JY9 A;  4LF4 E;  1X48 A;  4DV0 E;  1XMQ E;  1J5E E;  2LUP B;  3T1H E;  2L2K B;  3ADI A;  4M30 A;  1GQE A;  1HR0 E;  2RSM A;  1EKZ A;  2B7V A;  3OTO E;  2LTR A;  4GKJ E;  1N33 E;  4LF6 E;  4DR6 E;  1IBL E;  4X66 E;  2VQE E;  1PKP A;  1T4N A; 
#chains in the Genus database with same CATH topology
 2YT4 A;  2ELY A;  4X62 E;  3ECR A;  1IMU A;  1PJT A;  3EQ1 A;  4LFA E;  4M0V A;  2EOH A;  2V86 A;  1KJK A;  1QU6 A;  3AV0 A;  3TQM A;  2GLI A;  3J81 C;  2EOF A;  4LTY A;  1FJG E;  2YTG A;  2I9I A;  1DGC A;  2VE7 C;  4Q35 B;  4ZYD A;  1WHQ A;  4MLQ A;  5A2Q C;  4JI6 E;  1UBD C;  4RH8 A;  1O0W A;  2I13 A;  2YRH A;  2M9A A;  4F2J C;  2YTI A;  3THN A;  3FIG A;  2YTF A;  2EWL A;  4LF7 E;  2HC5 A;  4R2A A;  1BBO A;  2B3T B;  3LLH A;  4BS9 A;  3RMP A;  1B69 A;  2GHF A;  4MLV A;  4I8O A;  3IWC A;  2ENA A;  2MDG A;  4JYA E;  1SR9 A;  3EPL A;  1TN9 A;  3KWR A;  1GZ6 A;  2EOR A;  2WBT A;  4DR3 E;  3J7Y p;  4B3T E;  1N3G A;  4X8W A;  2HJJ A;  1XMO E;  3MHH C;  5A6K A;  4DV1 E;  4DV6 E;  1A1H A;  1A1L A;  4LFB E;  2NUG A;  4WPY A;  2EOY A;  1PJS A;  2EL6 A;  4X64 E;  2EOS A;  1N32 E;  1NCS A;  4OOG C;  4B3M E;  3BBG A;  3EPK A;  2EM3 A;  1JK2 A;  5ADZ A;  4LF5 E;  4GKK E;  2DMI A;  2YTQ A;  2DRP A;  1STU A;  2YPN A;  1YFH A;  5TSE A;  4P78 A;  4IJD A;  2KON A;  2JYA A;  1X6H A;  5A6B D;  4DV2 E;  2FGG A;  2EOQ A;  5KL6 A;  4R2D A;  2HHH E;  3M99 B;  3VHT B;  2KHX A;  2L92 A;  1A1F A;  2LVH A;  2VRD A;  1TF3 A;  1MGT A;  5IV8 B;  1A1J A;  2EN6 A;  2CT1 A;  4HTG A;  2B7V A;  1EKZ A;  2YTE A;  2M7Q A;  4GKJ E;  3H09 A;  2DLQ A;  1N33 E;  1T4N A;  2EZ6 A;  5IWA E;  2EOX A;  2IHR 1;  3ADJ A;  1G2D C;  4WXD A;  5KL7 A;  1X49 A;  5LMN E;  3T1Y E;  2LV2 A;  4JI7 E;  1IQS A;  4JI8 E;  1GTK A;  2NUF A;  4NHR A;  3J7A G;  4R2P A;  4N4R B;  1YUI A;  1UN6 B;  2PRT A;  2FV4 B;  3IWD A;  2YTP A;  4DR7 E;  2EPZ A;  1WRJ A;  2WCC 3;  4DUZ E;  4JI2 E;  2EMF A;  4DR2 E;  2YU5 A;  4DV3 E;  4DR5 E;  2V83 A;  3ZOQ B;  2EPM X;  4R2R A;  2EOO A;  4J8Z A;  4DV7 E;  2NA2 A;  2DGC A;  3K6Q A;  1N34 E;  1Z1B A;  1L4S A;  2EN7 A;  1PDA A;  2JOB A;  3HQ1 A;  1A1G A;  2DB2 A;  2ENH A;  2JXP A;  4LF9 E;  3QG5 C;  3VYY A;  2EQ0 A;  3C4B A;  2EOZ A;  4TUI A;  2NUE A;  2L3C A;  2R1F A;  2DMY A;  2EMX A;  2Q8U A;  2EQ3 A;  5LLQ A;  5KL5 A;  3J80 C;  3VK6 A;  3AUZ A;  1ZU1 A;  4M2Z A;  5KL2 A;  1X5W A;  4YY3 E;  4M9V C;  3KZZ A;  3KZY A;  4BC9 A;  5A69 A;  3EPH A;  1HNX E;  3HXL A;  4AQY E;  2D9H A;  5LMU E;  2EM9 A;  2BBG A;  2EE8 A;  2YRM A;  2A25 A;  3ADL A;  1HNZ E;  2E5L E;  4LF8 E;  3L00 A;  2EM8 A;  4TUG A;  3C6K A;  2EM2 A;  4LU9 A;  1YSA C;  4BBY A;  2WZO A;  2YTD A;  4F6N A;  3VYX A;  2EPN A;  4JI0 E;  1RQ0 A;  2HGH A;  3IWB A;  5F3W A;  2YRK A;  1XMQ E;  1J5E E;  3EPJ A;  3T1H E;  4M30 A;  4R2E A;  1YPN A;  2DLK A;  2M4I A;  4L8N A;  2WBS A;  2L8T A;  4LF6 E;  1BB8 A;  3THO B;  1HNW E;  1YYO A;  2LTS A;  1WHN A;  3HPZ A;  3C4T A;  4OX9 E;  3HTX A;  4F54 A;  4F6M A;  2EPO A;  1A1K A;  4O5G A;  1NEI A;  5AE1 A;  1T4L B;  2BB8 A;  4FK5 C;  4KWY A;  2DSY A;  2LRS A;  5A6J A;  4IS1 C;  3BF2 A;  1JK1 A;  4NXN E;  1YYK A;  4DUY E;  4NZV A;  2UUC E;  1ZBT A;  4R2S A;  4GEQ B;  4DR4 E;  2MC5 A;  2EPC A;  4ZYE A;  1T38 A;  5AE3 A;  2V87 A;  2WBU A;  2N8X A;  2EOI A;  4Q28 A;  1G2F C;  4JI5 E;  3MHS C;  2L6M A;  2ZM6 E;  2M1S A;  3P1X A;  2EMA A;  2B7T A;  2YSO A;  2MDR A;  2L33 A;  1KYQ A;  4WSG A;  2EN1 A;  1X6F A;  1J26 A;  1ZBQ A;  3JAM C;  2R76 A;  2LMZ A;  4F9B B;  1ZAA C;  4K0K E;  1XNR E;  2F4V E;  2EM6 A;  1RC7 A;  2RS7 A;  5AAS A;  2CSH A;  2LUQ A;  4L5N C;  5AE2 A;  2VQF E;  4YHH E;  5AC4 A;  4DMI A;  4BC7 A;  2RQL A;  1X3C A;  4O43 A;  1YYW A;  2LJU A;  2EMI A;  2LT7 A;  2K4V A;  4RHB B;  2RPC A;  4WYQ B;  4R2C A;  4NXM E;  2EPL X;  2CTD A;  2V8Q B;  4DR1 E;  1LLM C;  3BID A;  1PJQ A;  2EJ4 A;  4R8O A;  5BR8 E;  3HPS A;  4BCA A;  2MC6 A;  4WFT A;  1YZ9 A;  4B3R E;  2J7J A;  1IBK E;  2ENC A;  2EPA A;  3UK3 C;  2K7I A;  2MKN A;  1I94 E;  2UUB E;  2VF1 A;  4LFC E;  3DJW A;  5FLX C;  2V89 A;  2UXB E;  2EPU A;  1EH7 A;  2NAB A;  1A1I A;  3ADI A;  1GQE A;  2EMB A;  2RSM A;  4BHC A;  3OTO E;  2ELZ A;  2V88 A;  2YTN A;  4R2Q A;  1IQO A;  5A6B A;  2EMC A;  2LO3 A;  4X66 E;  2VQE E;  2EMH A;  3C6M A;  3OML A;  1IBL E;  5A6A A;  4O24 A;  2EN8 A;  4ZYH A;  2JP9 A;  4B3S E;  1SFE A;  2E72 A;  4ZYG A;  4DV5 E;  5T6J A;  2EML A;  2EPR A;  2L2N A;  2B9D A;  2YTO A;  2V85 A;  2EOJ A;  2EM7 A;  2RS6 A;  4JI4 E;  2EN3 A;  2JVA A;  3DF6 A;  2GPI A;  1YUJ A;  1TF6 A;  5AC5 A;  4F9C B;  2LBS B;  1X6E A;  4F9A B;  2G7H A;  1N36 E;  2N3G A;  1UHZ A;  2E1M A;  1DI2 A;  2EN2 A;  1BBG A;  2YZT A;  5CFF E;  1ZR9 A;  2EPX A;  2EQ1 A;  3F6H A;  5IXM B;  1X47 A;  1UIL A;  4R03 A;  2YTJ A;  1P47 A;  4P7D A;  1QNT A;  2H36 X;  1EH8 A;  2EMW A;  2N3H A;  5DNY A;  2EM5 A;  1AH5 A;  3JTZ A;  2UUA E;  2LCE A;  2ODR D;  2UXD E;  2EMG A;  2JWO A;  2EM4 A;  2DIX A;  3LML A;  4O4K A;  3F6G A;  4BHB A;  2L3J A;  5IT9 C;  3BGH A;  4X65 E;  2JPA A;  2ODR C;  2EMY A;  4JI3 E;  1WJP A;  2CPN A;  3ADG A;  2EPP A;  4KHP E;  1XNQ E;  3MSW A;  1DQ3 A;  2KOU A;  1FKA E;  1AAY A;  1T4O A;  4WSP A;  2YU8 A;  2EL5 A;  2EOE A;  2RTX A;  4WX9 A;  4JI1 E;  2EL4 A;  3JU0 A;  2EOM A;  4WXC A;  1RMD A;  2ADR A;  2UU9 E;  2JR1 A;  4DV4 E;  5KL3 A;  2UXC E;  4DKK A;  2EMK A;  2YWQ A;  2EP3 A;  5LL6 R;  2JOX A;  1IBM E;  1MEY C;  4JV5 E;  2LJH A;  4GZN C;  2EMZ A;  2EN4 A;  2YSP A;  2L2M A;  2RSI A;  2JY9 A;  4LF4 E;  1X48 A;  4BMJ A;  4DV0 E;  5KL4 A;  2LUP B;  2L2K B;  1EH6 A;  1WXR A;  1HR0 E;  2LE2 A;  2EM0 A;  4X9J A;  2MKD A;  1T39 A;  2LTR A;  4HEI A;  4KZS A;  1F2I G;  2EPK X;  4DR6 E;  2FTX B;  1PKP A;  2F8B A; 
#chains in the Genus database with same CATH homology
 2YT4 A;  5IWA E;  4B3S E;  2IHR 1;  1HNW E;  3ADJ A;  4X62 E;  1YYO A;  2LTS A;  1WHN A;  3HPZ A;  4DV5 E;  5T6J A;  1X49 A;  3C4T A;  2L2N A;  2B9D A;  4OX9 E;  2V85 A;  5LMN E;  2RS6 A;  4JI4 E;  3HTX A;  3T1Y E;  4F54 A;  2JVA A;  3DF6 A;  4JI7 E;  4JI8 E;  2NUF A;  4LFA E;  4M0V A;  4F9C B;  2V86 A;  2LBS B;  3J7A G;  5AE1 A;  1QU6 A;  1T4L B;  3AV0 A;  4F9A B;  2G7H A;  3J81 C;  2DSY A;  2LRS A;  1YYK A;  4LTY A;  1N36 E;  1FJG E;  2N3G A;  1UHZ A;  4DUY E;  4NXN E;  2VE7 C;  2E1M A;  1DI2 A;  2UUC E;  1WHQ A;  1ZBT A;  5A2Q C;  4JI6 E;  4GEQ B;  2FV4 B;  2YZT A;  5CFF E;  4DR4 E;  1O0W A;  2MC5 A;  3F6H A;  3IWD A;  4DR7 E;  1X47 A;  4DUZ E;  1UIL A;  5AE3 A;  4R03 A;  4JI2 E;  2V87 A;  4P7D A;  4DR2 E;  2H36 X;  3FIG A;  4Q28 A;  2EWL A;  4LF7 E;  4JI5 E;  2B3T B;  2N3H A;  3LLH A;  2L6M A;  4BS9 A;  5DNY A;  4DV3 E;  4DR5 E;  3RMP A;  2V83 A;  3ZOQ B;  2M1S A;  3JTZ A;  3P1X A;  2ZM6 E;  2UUA E;  2ODR D;  4J8Z A;  4DV7 E;  2NA2 A;  3IWC A;  4I8O A;  3K6Q A;  1N34 E;  2UXD E;  2B7T A;  2JWO A;  2MDR A;  2L33 A;  4JYA E;  1SR9 A;  2JOB A;  2DIX A;  3LML A;  3HQ1 A;  1GZ6 A;  3KWR A;  2DB2 A;  3F6G A;  1J26 A;  1ZBQ A;  3JAM C;  2L3J A;  4LF9 E;  5IT9 C;  4K0K E;  2LMZ A;  4F9B B;  3VYY A;  4DR3 E;  3J7Y p;  4B3T E;  1XNR E;  4X65 E;  2ODR C;  3C4B A;  2F4V E;  4TUI A;  4JI3 E;  2NUE A;  2CPN A;  4X8W A;  3ADG A;  2L3C A;  1RC7 A;  2RS7 A;  5AAS A;  2DMY A;  2LUQ A;  4L5N C;  5AE2 A;  2VQF E;  1XMO E;  3J80 C;  4YHH E;  4DV1 E;  1XNQ E;  3MSW A;  1DQ3 A;  2KOU A;  3VK6 A;  4DV6 E;  3AUZ A;  4KHP E;  4LFB E;  4DMI A;  2NUG A;  1FKA E;  4BC7 A;  1T4O A;  4M2Z A;  4WPY A;  1YYW A;  4WSP A;  4X64 E;  1N32 E;  4YY3 E;  2K4V A;  2RTX A;  4OOG C;  4B3M E;  4WYQ B;  4BC9 A;  4JI1 E;  3JU0 A;  1HNX E;  4NXM E;  2UU9 E;  3HXL A;  2V8Q B;  4DR1 E;  4AQY E;  5LMU E;  2JR1 A;  5ADZ A;  4DV4 E;  4R8O A;  5BR8 E;  3ADL A;  4LF5 E;  4GKK E;  1HNZ E;  2E5L E;  4LF8 E;  3HPS A;  2UXC E;  4BCA A;  2MC6 A;  4WFT A;  4TUG A;  1YZ9 A;  4B3R E;  1STU A;  4DKK A;  5LL6 R;  4P78 A;  1IBK E;  2EZ6 A;  2JOX A;  1IBM E;  2KON A;  4LU9 A;  1I94 E;  2UUB E;  2VF1 A;  4BBY A;  2WZO A;  4LFC E;  4DV2 E;  4JV5 E;  2LJH A;  2FGG A;  3DJW A;  2HHH E;  3VYX A;  2KHX A;  5FLX C;  4JI0 E;  2L2M A;  1RQ0 A;  2L92 A;  2V89 A;  2UXB E;  2JY9 A;  4LF4 E;  3IWB A;  1X48 A;  4BMJ A;  5F3W A;  4DV0 E;  1XMQ E;  1J5E E;  2LUP B;  3T1H E;  2L2K B;  3ADI A;  4M30 A;  1GQE A;  1WXR A;  1HR0 E;  2RSM A;  2LE2 A;  2M4I A;  4L8N A;  1EKZ A;  2B7V A;  2M7Q A;  2L8T A;  2LTR A;  3OTO E;  2V88 A;  3H09 A;  4GKJ E;  4KZS A;  1N33 E;  4LF6 E;  4DR6 E;  2FTX B;  4X66 E;  2VQE E;  1IBL E;  3OML A;  1PKP A;  2F8B A;  1T4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...