1UILA

Double-stranded rna-binding motif of hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Double-stranded RNA-binding motif of Hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding motif
total genus 17
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uilA01
3ADJA 2VQFE 1HR0E 1YZ9A 1HNWE 1UILA 1QU6A 4X64E 1XMQE 2HHHE 3ADLA 3P1XA 2UUCE 3C4BA 1HNZE 3LLHA 4DV1E 2CPNA 2ZM6E 5LMUE 1GQEA 4X66E 1I94E 4LF5E 4JI4E 1WHQA 4LFCE 4LF6E 1IBKE 2DB2A 1YYKA 1PKPA 2UUBE 5BR8E 1X49A 2VQEE 2DMYA 1DI2A 1STUA 2RS7A 2KHXA 1WHNA 4OX9E 2LTSA 4GKJE 3VYXA 1O0WA 1XNQE 1T4OA 4LF7E 1N36E 2NUEA 4B3TE 4OOGC 1FKAE 4B3RE 2NA2A 3T1HE 1IBME 2L33A 1EKZA 1N32E 2LUQA 4DKKA 4NXME 2RS6A 2E5LE 1HNXE 4DR7E 2LJHA 4DV4E 3T1YE 4JI3E 4LF8E 2B7VA 4M2ZA 2NUFA 2L3JA 1YYWA 4DV3E 2UXBE 1ZBTA 2RTXA 5LMNE 4DR5E 1XMOE 4JYAE 4GKKE 4AQYE 4JV5E 1J26A 2LRSA 4WFTA 2NUGA 2L2NA 3HTXA 5IWAE 4DUZE 4LF9E 3ADGA 3J7Yp 4DR1E 4JI8E 2UXDE 1YYOA 1RQ0A 2IHR1 2N3GA 2RSMA 4B3ME 4JI5E 4JI7E 4DV6E 3C4TA 5CFFE 2EZ6A 4B3SE 1N33E 2UXCE 1X47A 1XNRE 2DIXA 3OTOE 4JI2E 4LFBE 4DV0E 4JI0E 2L3CA 4YHHE 4DV5E 1IBLE 4JI6E 4DR6E 1X48A 1FJGE 4DUYE 2LUPB 4X8WA 2UUAE 4LF4E 2UU9E 4KHPE 1J5EE 2MDRA 2L2KB 2YT4A 4DR3E 2B7TA 1N34E 1UHZA 4X62E 3VYYA 2F4VE 4DV7E 4DR2E 2JVAA 4JI1E 4WYQB 4X65E 2JY9A 2L2MA 4YY3E 4K0KE 4DR4E 2LTRA 4LFAE 2LBSB 2N3HA 1T4NA 3ADIA 4DV2E 1T4LB 4M30A 1RC7A 4NXNE 2B3TB
chains in the Genus database with same CATH superfamily
1WJPA 2EMAA 2YRHA 3J7AG 1YUIA 2JR1A 4X64E 1DQ3A 3LMLA 3ADLA 2LMZA 3P1XA 2VRDA 3C4BA 3VK6A 1BB8A 4KWYA 3LLHA 3IWBA 2LT7A 2EOQA 1WXRA 1WHQA 5A6BA 2EMCA 4LF6E 1IBKE 2DB2A 3JTZA 1BBOA 5BR8E 1X49A 5AE1A 2DMYA 1DI2A 3ECRA 4OX9E 1XNQE 5A6JA 2EN1A 2NUEA 4B3TE 2EN6A 1FKAE 3T1HE 3THNA 1ZR9A 4BS9A 1EKZA 4R2PA 1GTKA 2LUQA 4NXME 2EPAA 2E5LE 5KL5A 2LV2A 2LJHA 4BC7A 4LF8E 2B7VA 1Z1BA 2NUFA 4DV3E 4JYAE 2RTXA 3FIGA 4DR5E 1XMOE 2NUGA 3JAMC 4M0VA 4R2SA 3HTXA 5IWAE 2EOXA 2YTIA 4HEIA 4IJDA 1YYOA 5TSEA 2DSYA 4F54A 2EMXA 5A2QC 2JWOA 2EMFA 2ODRD 4Q35B 2WCC3 2YRKA 1AAYA 1XNRE 5AASA 2YRMA 4DV0E 4JI0E 3J80C 4ZYDA 4N4RB 4DV5E 2YPNA 4J8ZA 4DR6E 2EPPA 2EN4A 1PJTA 3QG5C 2LUPB 2EM6A 4X8WA 2KOUA 2YTDA 2UU9E 3BBGA 2MDRA 5A69A 4KZSA 2CTDA 1N34E 2EM4A 4ZYGA 2L8TA 2EN3A 2EQ1A 2YTOA 4DR2E 4JI1E 3J81C 4MLQA 2J7JA 3EPHA 1SR9A 1ZU1A 5KL6A 2LCEA 2EPKX 1YSAC 2YTEA 1RMDA 2EMIA 3DF6A 2BB8A 3THOB 1RC7A 2B3TB 4MLVA 2ODRC 2E1MA 3L00A 2VQFE 1UBDC 2HHHE 2A25A 4DV1E 2EN2A 4R8OA 3EPJA 2EM2A 5T6JA 2YTGA 4LFCE 2YTPA 2EPXA 2UUBE 2EOFA 4R03A 1L4SA 2KHXA 3IWDA 1WHNA 1ZAAC 3KZZA 2I13A 2V88A 2WBUA 2DLKA 3K6QA 1N36E 2EOZA 2D9HA 4B3RE 1IMUA 2NA2A 2V85A 1PJSA 2ELYA 1IBME 2L33A 4DMIA 2EPRA 2HC5A 2FGGA 2EMWA 4TUGA 2FV4B 3KZYA 2RSIA 1HNXE 4M9VC 1JK1A 4M2ZA 2LJUA 1JK2A 1PDAA 2UXBE 1ZBTA 5LMNE 4GEQB 2EMKA 4AQYE 1J26A 2LRSA 2EPOA 2L2NA 4LF9E 4R2CA 1X6EA 3J7Yp 2YWQA 4JI8E 2M4IA 1A1GA 4BMJA 2UXDE 3DJWA 1RQ0A 1WRJA 1TF3A 2EOJA 4B3ME 5A6KA 3MHSC 4JI5E 1A1HA 1TF6A 2WZOA 4F9AB 5A6BD 1MEYC 2RQLA 2EP3A 4B3SE 2EPUA 2UXCE 2YTFA 4HTGA 4L8NA 4O5GA 1B69A 4F2JC 1BBGA 2EM5A 1QNTA 4LU9A 2ADRA 1IBLE 4WXDA 2BBGA 1X48A 2LVHA 1FJGE 2UUAE 3F6GA 4KHPE 2EOEA 2M7QA 2LE2A 2V8QB 3HQ1A 4I8OA 2L2KB 2EMZA 4X62E 5AE2A 2M1SA 2F4VE 1ZBQA 2KONA 2R76A 4LTYA 2HJJA 2GLIA 3ZOQB 5A6AA 2LBSB 1T4NA 2MDGA 2V87A 1P47A 4M30A 1EH6A 5IT9C 1LLMC 3ADJA 4F6NA 1YZ9A 4IS1C 3AV0A 1A1LA 1T39A 3C6MA 2UUCE 2G7HA 2VE7C 3KWRA 2EM0A 2VF1A 2E72A 5LMUE 2ENAA 4X66E 1I94E 4LF5E 2DLQA 2K4VA 2EN7A 1KJKA 1YYKA 1X3CA 1PKPA 3C6KA 4R2RA 2VQEE 5F3WA 2R1FA 1A1KA 2RS7A 2JPAA 4X9JA 2LTSA 1MGTA 4GKJE 3VYXA 1O0WA 1T4OA 2EWLA 4LF7E 4WSGA 4OOGC 2EMBA 2MC5A 3JU0A 5LLQA 2EOOA 2DMIA 2JOBA 4WXCA 2DGCA 1AH5A 1N32E 1UN6B 4O24A 4DKKA 3BIDA 2HGHA 1N3GA 2EOSA 2EQ0A 4BC9A 2JOXA 4R2DA 4DV4E 3T1YE 4JI3E 3HXLA 4BCAA 2L3JA 2EE8A 1YYWA 2CT1A 4WFTA 1IQSA 4RH8A 4DUZE 2LO3A 4DR1E 1T38A 4WPYA 3H09A 2WBSA 2IHR1 2K7IA 2RSMA 2PRTA 2EM8A 4TUIA 3RMPA 2EM9A 4FK5C 4DV6E 1G2FC 2EZ6A 3HPZA 4F9CB 2RPCA 1N33E 2YU5A 1X47A 2DIXA 4LFBE 3MSWA 2EMLA 2EM7A 2NABA 4ZYHA 1F2IG 2EL5A 4R2AA 4DUYE 3MHHC 1YFHA 3BF2A 1J5EE 1NEIA 4R2QA 2EPLX 1SFEA 4DR3E 2B7TA 1UHZA 1X6HA 3VYYA 2EOIA 4WYQB 4F9BB 2YSPA 2EOMA 4DR4E 3M99B 2LTRA 2WBTA 2MKNA 3ADIA 4DV2E 1T4LB 4P78A 1A1IA 5KL7A 2L92A 2EORA 1YPNA 2JYAA 1HR0E 4L5NC 1UILA 1QU6A 1HNWE 2EMHA 2YU8A 3EPKA 1XMQE 4RHBB 5ADZA 5KL4A 1HNZE 2Q8UA 2CPNA 2V83A 5IV8B 4WSPA 2ZM6E 3IWCA 1DGCA 1GQEA 2EM3A 4JI4E 3EQ1A 2M9AA 2CSHA 1STUA 3VHTB 2JXPA 2DRPA 1YUJA 4F6MA 2GHFA 2ENCA 2EOHA 1EH8A 4GZNC 4O4KA 4WX9A 5AC5A 3AUZA 1TN9A 2V86A 5IXMB 2EL4A 2EL6A 2YTNA 2EPNA 1GZ6A 2L6MA 2EMGA 1X5WA 3BGHA 4P7DA 2RS6A 4ZYEA 1A1FA 1X6FA 2FTXB 4DR7E 5KL2A 2YSOA 5AC4A 1KYQA 3HPSA 4GKKE 4JV5E 4NHRA 2V89A 3ADGA 2ELZA 2N3GA 2EPMX 2JP9A 4JI7E 3C4TA 5CFFE 2MKDA 5KL3A 2B9DA 3OTOE 4JI2E 1NCSA 2L3CA 2YTJA 5LL6R 4YHHE 2EPZA 4JI6E 2EOYA 2I9IA 4R2EA 3UK3C 2EPCA 5AE3A 3TQMA 2EN8A 5DNYA 4LF4E 3F6HA 3OMLA 2H36X 3EPLA 1IQOA 1G2DC 4NZVA 2YT4A 1A1JA 2GPIA 2F8BA 1EH7A 2EMYA 4DV7E 2EJ4A 2JVAA 5FLXC 2YZTA 4X65E 4BHCA 2JY9A 2N8XA 4O43A 2L2MA 4YY3E 4K0KE 2EQ3A 2ENHA 4LFAE 4BBYA 4Q28A 2N3HA 2YTQA 2MC6A 4NXNE 1PJQA 4BHBA
chains in the Genus database with same CATH topology
3ADJA 2VQFE 3J7AG 1HR0E 1YZ9A 3AV0A 1UILA 1QU6A 2JR1A 4L5NC 4GKKE 4X64E 1XMQE 1DQ3A 3LMLA 2HHHE 2LMZA 3P1XA 5ADZA 2UUCE 3C4BA 3VK6A 3ADLA 2G7HA 2VE7C 3KWRA 3LLHA 4DV1E 1HNZE 2VF1A 2CPNA 2V83A 3IWBA 4R8OA 4WSPA 2ZM6E 3IWCA 1WXRA 1GQEA 4X66E 5LMUE 5T6JA 1I94E 4LF5E 4JI4E 1WHQA 4LFCE 4LF6E 2K4VA 1IBKE 2DB2A 1YYKA 3JTZA 1PKPA 2UUBE 5BR8E 1X49A 5AE1A 2VQEE 5F3WA 2DMYA 4R03A 1DI2A 1STUA 2RS7A 2KHXA 3IWDA 1WHNA 4OX9E 2LTSA 4GKJE 3VYXA 1O0WA 2V88A 1T4OA 2EWLA 4LF7E 1XNQE 3K6QA 1N36E 2NUEA 4B3TE 4OOGC 2MC5A 3JU0A 1FKAE 4B3RE 3AUZA 2NA2A 2V85A 3T1HE 1IBME 2L33A 4DMIA 2V86A 2JOBA 4BS9A 1EKZA 1N32E 1GZ6A 2L6MA 1J26A 2FGGA 2LUQA 4P7DA 4DKKA 4TUGA 2FV4B 4NXME 2RS6A 4BC9A 2E5LE 2JOXA 1HNXE 2FTXB 4DR7E 2LJHA 4DV4E 3T1YE 4JI3E 3HXLA 4BC7A 4LF8E 2B7VA 4M2ZA 2NUFA 4BCAA 2L3JA 1YYWA 4DV3E 2UXBE 1ZBTA 2RTXA 3FIGA 3HPSA 4GEQB 5LMNE 4DR5E 4AQYE 1XMOE 4JYAE 2LRSA 4WFTA 3JAMC 4M0VA 2L2NA 2V89A 2NUGA 4JV5E 3HTXA 5IWAE 4DUZE 4LF9E 3ADGA 3J7Yp 4DR1E 4JI8E 2M4IA 2UXDE 4BMJA 4WPYA 3DJWA 3H09A 1YYOA 1RQ0A 2DSYA 4F54A 2IHR1 2N3GA 2RSMA 4B3ME 5A2QC 4JI5E 4TUIA 3RMPA 2WZOA 4F9AB 4JI7E 4DV6E 3C4TA 5CFFE 2JWOA 2EZ6A 4B3SE 2ODRD 3HPZA 4F9CB 1N33E 2UXCE 1X47A 1XNRE 4L8NA 2DIXA 2B9DA 5AASA 3OTOE 3MSWA 4JI2E 4LFBE 4DV0E 4JI0E 3J80C 2L3CA 4LU9A 5LL6R 4YHHE 4DV5E 4J8ZA 1IBLE 4JI6E 4DR6E 1X48A 1FJGE 4DUYE 2LUPB 4X8WA 5AE3A 2UUAE 5DNYA 4LF4E 2KOUA 3F6GA 3F6HA 2UU9E 4KHPE 1J5EE 2M7QA 2MDRA 2H36X 2LE2A 3OMLA 2V8QB 3HQ1A 4I8OA 4KZSA 2L2KB 2YT4A 4DR3E 2B7TA 1N34E 1UHZA 2L8TA 4X62E 2F8BA 5AE2A 2M1SA 3VYYA 2F4VE 1ZBQA 2KONA 4DV7E 4DR2E 2JVAA 4JI1E 4LTYA 5FLXC 3J81C 4WYQB 1HNWE 2YZTA 4F9BB 4X65E 2JY9A 1SR9A 2L2MA 4YY3E 3ZOQB 4K0KE 4DR4E 2LTRA 4LFAE 4BBYA 4Q28A 2N3HA 1T4NA 2LBSB 3ADIA 4DV2E 2V87A 1T4LB 3DF6A 4P78A 4M30A 2MC6A 1RC7A 4NXNE 5IT9C 2B3TB 2L92A 2ODRC 2E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADJ A;  2VQF E;  1HR0 E;  1YZ9 A;  1HNW E;  1UIL A;  1QU6 A;  4X64 E;  1XMQ E;  2HHH E;  3ADL A;  3P1X A;  2UUC E;  3C4B A;  1HNZ E;  3LLH A;  4DV1 E;  2CPN A;  2ZM6 E;  5LMU E;  1GQE A;  4X66 E;  1I94 E;  4LF5 E;  4JI4 E;  1WHQ A;  4LFC E;  4LF6 E;  1IBK E;  2DB2 A;  1YYK A;  1PKP A;  2UUB E;  5BR8 E;  1X49 A;  2VQE E;  2DMY A;  1DI2 A;  1STU A;  2RS7 A;  2KHX A;  1WHN A;  4OX9 E;  2LTS A;  4GKJ E;  3VYX A;  1O0W A;  1XNQ E;  1T4O A;  4LF7 E;  1N36 E;  2NUE A;  4B3T E;  4OOG C;  1FKA E;  4B3R E;  2NA2 A;  3T1H E;  1IBM E;  2L33 A;  1EKZ A;  1N32 E;  2LUQ A;  4DKK A;  4NXM E;  2RS6 A;  2E5L E;  1HNX E;  4DR7 E;  2LJH A;  4DV4 E;  3T1Y E;  4JI3 E;  4LF8 E;  2B7V A;  4M2Z A;  2NUF A;  2L3J A;  1YYW A;  4DV3 E;  2UXB E;  1ZBT A;  2RTX A;  5LMN E;  4DR5 E;  1XMO E;  4JYA E;  4GKK E;  4AQY E;  4JV5 E;  1J26 A;  2LRS A;  4WFT A;  2NUG A;  2L2N A;  3HTX A;  5IWA E;  4DUZ E;  4LF9 E;  3ADG A;  3J7Y p;  4DR1 E;  4JI8 E;  2UXD E;  1YYO A;  1RQ0 A;  2IHR 1;  2N3G A;  2RSM A;  4B3M E;  4JI5 E;  4JI7 E;  4DV6 E;  3C4T A;  5CFF E;  2EZ6 A;  4B3S E;  1N33 E;  2UXC E;  1X47 A;  1XNR E;  2DIX A;  3OTO E;  4JI2 E;  4LFB E;  4DV0 E;  4JI0 E;  2L3C A;  4YHH E;  4DV5 E;  1IBL E;  4JI6 E;  4DR6 E;  1X48 A;  1FJG E;  4DUY E;  2LUP B;  4X8W A;  2UUA E;  4LF4 E;  2UU9 E;  4KHP E;  1J5E E;  2MDR A;  2L2K B;  2YT4 A;  4DR3 E;  2B7T A;  1N34 E;  1UHZ A;  4X62 E;  3VYY A;  2F4V E;  4DV7 E;  4DR2 E;  2JVA A;  4JI1 E;  4WYQ B;  4X65 E;  2JY9 A;  2L2M A;  4YY3 E;  4K0K E;  4DR4 E;  2LTR A;  4LFA E;  2LBS B;  2N3H A;  1T4N A;  3ADI A;  4DV2 E;  1T4L B;  4M30 A;  1RC7 A;  4NXN E;  2B3T B; 
#chains in the Genus database with same CATH topology
 1WJP A;  2EMA A;  2YRH A;  3J7A G;  1YUI A;  2JR1 A;  4X64 E;  1DQ3 A;  3LML A;  3ADL A;  2LMZ A;  3P1X A;  2VRD A;  3C4B A;  3VK6 A;  1BB8 A;  4KWY A;  3LLH A;  3IWB A;  2LT7 A;  2EOQ A;  1WXR A;  1WHQ A;  5A6B A;  2EMC A;  4LF6 E;  1IBK E;  2DB2 A;  3JTZ A;  1BBO A;  5BR8 E;  1X49 A;  5AE1 A;  2DMY A;  1DI2 A;  3ECR A;  4OX9 E;  1XNQ E;  5A6J A;  2EN1 A;  2NUE A;  4B3T E;  2EN6 A;  1FKA E;  3T1H E;  3THN A;  1ZR9 A;  4BS9 A;  1EKZ A;  4R2P A;  1GTK A;  2LUQ A;  4NXM E;  2EPA A;  2E5L E;  5KL5 A;  2LV2 A;  2LJH A;  4BC7 A;  4LF8 E;  2B7V A;  1Z1B A;  2NUF A;  4DV3 E;  4JYA E;  2RTX A;  3FIG A;  4DR5 E;  1XMO E;  2NUG A;  3JAM C;  4M0V A;  4R2S A;  3HTX A;  5IWA E;  2EOX A;  2YTI A;  4HEI A;  4IJD A;  1YYO A;  5TSE A;  2DSY A;  4F54 A;  2EMX A;  5A2Q C;  2JWO A;  2EMF A;  2ODR D;  4Q35 B;  2WCC 3;  2YRK A;  1AAY A;  1XNR E;  5AAS A;  2YRM A;  4DV0 E;  4JI0 E;  3J80 C;  4ZYD A;  4N4R B;  4DV5 E;  2YPN A;  4J8Z A;  4DR6 E;  2EPP A;  2EN4 A;  1PJT A;  3QG5 C;  2LUP B;  2EM6 A;  4X8W A;  2KOU A;  2YTD A;  2UU9 E;  3BBG A;  2MDR A;  5A69 A;  4KZS A;  2CTD A;  1N34 E;  2EM4 A;  4ZYG A;  2L8T A;  2EN3 A;  2EQ1 A;  2YTO A;  4DR2 E;  4JI1 E;  3J81 C;  4MLQ A;  2J7J A;  3EPH A;  1SR9 A;  1ZU1 A;  5KL6 A;  2LCE A;  2EPK X;  1YSA C;  2YTE A;  1RMD A;  2EMI A;  3DF6 A;  2BB8 A;  3THO B;  1RC7 A;  2B3T B;  4MLV A;  2ODR C;  2E1M A;  3L00 A;  2VQF E;  1UBD C;  2HHH E;  2A25 A;  4DV1 E;  2EN2 A;  4R8O A;  3EPJ A;  2EM2 A;  5T6J A;  2YTG A;  4LFC E;  2YTP A;  2EPX A;  2UUB E;  2EOF A;  4R03 A;  1L4S A;  2KHX A;  3IWD A;  1WHN A;  1ZAA C;  3KZZ A;  2I13 A;  2V88 A;  2WBU A;  2DLK A;  3K6Q A;  1N36 E;  2EOZ A;  2D9H A;  4B3R E;  1IMU A;  2NA2 A;  2V85 A;  1PJS A;  2ELY A;  1IBM E;  2L33 A;  4DMI A;  2EPR A;  2HC5 A;  2FGG A;  2EMW A;  4TUG A;  2FV4 B;  3KZY A;  2RSI A;  1HNX E;  4M9V C;  1JK1 A;  4M2Z A;  2LJU A;  1JK2 A;  1PDA A;  2UXB E;  1ZBT A;  5LMN E;  4GEQ B;  2EMK A;  4AQY E;  1J26 A;  2LRS A;  2EPO A;  2L2N A;  4LF9 E;  4R2C A;  1X6E A;  3J7Y p;  2YWQ A;  4JI8 E;  2M4I A;  1A1G A;  4BMJ A;  2UXD E;  3DJW A;  1RQ0 A;  1WRJ A;  1TF3 A;  2EOJ A;  4B3M E;  5A6K A;  3MHS C;  4JI5 E;  1A1H A;  1TF6 A;  2WZO A;  4F9A B;  5A6B D;  1MEY C;  2RQL A;  2EP3 A;  4B3S E;  2EPU A;  2UXC E;  2YTF A;  4HTG A;  4L8N A;  4O5G A;  1B69 A;  4F2J C;  1BBG A;  2EM5 A;  1QNT A;  4LU9 A;  2ADR A;  1IBL E;  4WXD A;  2BBG A;  1X48 A;  2LVH A;  1FJG E;  2UUA E;  3F6G A;  4KHP E;  2EOE A;  2M7Q A;  2LE2 A;  2V8Q B;  3HQ1 A;  4I8O A;  2L2K B;  2EMZ A;  4X62 E;  5AE2 A;  2M1S A;  2F4V E;  1ZBQ A;  2KON A;  2R76 A;  4LTY A;  2HJJ A;  2GLI A;  3ZOQ B;  5A6A A;  2LBS B;  1T4N A;  2MDG A;  2V87 A;  1P47 A;  4M30 A;  1EH6 A;  5IT9 C;  1LLM C;  3ADJ A;  4F6N A;  1YZ9 A;  4IS1 C;  3AV0 A;  1A1L A;  1T39 A;  3C6M A;  2UUC E;  2G7H A;  2VE7 C;  3KWR A;  2EM0 A;  2VF1 A;  2E72 A;  5LMU E;  2ENA A;  4X66 E;  1I94 E;  4LF5 E;  2DLQ A;  2K4V A;  2EN7 A;  1KJK A;  1YYK A;  1X3C A;  1PKP A;  3C6K A;  4R2R A;  2VQE E;  5F3W A;  2R1F A;  1A1K A;  2RS7 A;  2JPA A;  4X9J A;  2LTS A;  1MGT A;  4GKJ E;  3VYX A;  1O0W A;  1T4O A;  2EWL A;  4LF7 E;  4WSG A;  4OOG C;  2EMB A;  2MC5 A;  3JU0 A;  5LLQ A;  2EOO A;  2DMI A;  2JOB A;  4WXC A;  2DGC A;  1AH5 A;  1N32 E;  1UN6 B;  4O24 A;  4DKK A;  3BID A;  2HGH A;  1N3G A;  2EOS A;  2EQ0 A;  4BC9 A;  2JOX A;  4R2D A;  4DV4 E;  3T1Y E;  4JI3 E;  3HXL A;  4BCA A;  2L3J A;  2EE8 A;  1YYW A;  2CT1 A;  4WFT A;  1IQS A;  4RH8 A;  4DUZ E;  2LO3 A;  4DR1 E;  1T38 A;  4WPY A;  3H09 A;  2WBS A;  2IHR 1;  2K7I A;  2RSM A;  2PRT A;  2EM8 A;  4TUI A;  3RMP A;  2EM9 A;  4FK5 C;  4DV6 E;  1G2F C;  2EZ6 A;  3HPZ A;  4F9C B;  2RPC A;  1N33 E;  2YU5 A;  1X47 A;  2DIX A;  4LFB E;  3MSW A;  2EML A;  2EM7 A;  2NAB A;  4ZYH A;  1F2I G;  2EL5 A;  4R2A A;  4DUY E;  3MHH C;  1YFH A;  3BF2 A;  1J5E E;  1NEI A;  4R2Q A;  2EPL X;  1SFE A;  4DR3 E;  2B7T A;  1UHZ A;  1X6H A;  3VYY A;  2EOI A;  4WYQ B;  4F9B B;  2YSP A;  2EOM A;  4DR4 E;  3M99 B;  2LTR A;  2WBT A;  2MKN A;  3ADI A;  4DV2 E;  1T4L B;  4P78 A;  1A1I A;  5KL7 A;  2L92 A;  2EOR A;  1YPN A;  2JYA A;  1HR0 E;  4L5N C;  1UIL A;  1QU6 A;  1HNW E;  2EMH A;  2YU8 A;  3EPK A;  1XMQ E;  4RHB B;  5ADZ A;  5KL4 A;  1HNZ E;  2Q8U A;  2CPN A;  2V83 A;  5IV8 B;  4WSP A;  2ZM6 E;  3IWC A;  1DGC A;  1GQE A;  2EM3 A;  4JI4 E;  3EQ1 A;  2M9A A;  2CSH A;  1STU A;  3VHT B;  2JXP A;  2DRP A;  1YUJ A;  4F6M A;  2GHF A;  2ENC A;  2EOH A;  1EH8 A;  4GZN C;  4O4K A;  4WX9 A;  5AC5 A;  3AUZ A;  1TN9 A;  2V86 A;  5IXM B;  2EL4 A;  2EL6 A;  2YTN A;  2EPN A;  1GZ6 A;  2L6M A;  2EMG A;  1X5W A;  3BGH A;  4P7D A;  2RS6 A;  4ZYE A;  1A1F A;  1X6F A;  2FTX B;  4DR7 E;  5KL2 A;  2YSO A;  5AC4 A;  1KYQ A;  3HPS A;  4GKK E;  4JV5 E;  4NHR A;  2V89 A;  3ADG A;  2ELZ A;  2N3G A;  2EPM X;  2JP9 A;  4JI7 E;  3C4T A;  5CFF E;  2MKD A;  5KL3 A;  2B9D A;  3OTO E;  4JI2 E;  1NCS A;  2L3C A;  2YTJ A;  5LL6 R;  4YHH E;  2EPZ A;  4JI6 E;  2EOY A;  2I9I A;  4R2E A;  3UK3 C;  2EPC A;  5AE3 A;  3TQM A;  2EN8 A;  5DNY A;  4LF4 E;  3F6H A;  3OML A;  2H36 X;  3EPL A;  1IQO A;  1G2D C;  4NZV A;  2YT4 A;  1A1J A;  2GPI A;  2F8B A;  1EH7 A;  2EMY A;  4DV7 E;  2EJ4 A;  2JVA A;  5FLX C;  2YZT A;  4X65 E;  4BHC A;  2JY9 A;  2N8X A;  4O43 A;  2L2M A;  4YY3 E;  4K0K E;  2EQ3 A;  2ENH A;  4LFA E;  4BBY A;  4Q28 A;  2N3H A;  2YTQ A;  2MC6 A;  4NXN E;  1PJQ A;  4BHB A; 
#chains in the Genus database with same CATH homology
 3ADJ A;  2VQF E;  3J7A G;  1HR0 E;  1YZ9 A;  3AV0 A;  1UIL A;  1QU6 A;  2JR1 A;  4L5N C;  4GKK E;  4X64 E;  1XMQ E;  1DQ3 A;  3LML A;  2HHH E;  2LMZ A;  3P1X A;  5ADZ A;  2UUC E;  3C4B A;  3VK6 A;  3ADL A;  2G7H A;  2VE7 C;  3KWR A;  3LLH A;  4DV1 E;  1HNZ E;  2VF1 A;  2CPN A;  2V83 A;  3IWB A;  4R8O A;  4WSP A;  2ZM6 E;  3IWC A;  1WXR A;  1GQE A;  4X66 E;  5LMU E;  5T6J A;  1I94 E;  4LF5 E;  4JI4 E;  1WHQ A;  4LFC E;  4LF6 E;  2K4V A;  1IBK E;  2DB2 A;  1YYK A;  3JTZ A;  1PKP A;  2UUB E;  5BR8 E;  1X49 A;  5AE1 A;  2VQE E;  5F3W A;  2DMY A;  4R03 A;  1DI2 A;  1STU A;  2RS7 A;  2KHX A;  3IWD A;  1WHN A;  4OX9 E;  2LTS A;  4GKJ E;  3VYX A;  1O0W A;  2V88 A;  1T4O A;  2EWL A;  4LF7 E;  1XNQ E;  3K6Q A;  1N36 E;  2NUE A;  4B3T E;  4OOG C;  2MC5 A;  3JU0 A;  1FKA E;  4B3R E;  3AUZ A;  2NA2 A;  2V85 A;  3T1H E;  1IBM E;  2L33 A;  4DMI A;  2V86 A;  2JOB A;  4BS9 A;  1EKZ A;  1N32 E;  1GZ6 A;  2L6M A;  1J26 A;  2FGG A;  2LUQ A;  4P7D A;  4DKK A;  4TUG A;  2FV4 B;  4NXM E;  2RS6 A;  4BC9 A;  2E5L E;  2JOX A;  1HNX E;  2FTX B;  4DR7 E;  2LJH A;  4DV4 E;  3T1Y E;  4JI3 E;  3HXL A;  4BC7 A;  4LF8 E;  2B7V A;  4M2Z A;  2NUF A;  4BCA A;  2L3J A;  1YYW A;  4DV3 E;  2UXB E;  1ZBT A;  2RTX A;  3FIG A;  3HPS A;  4GEQ B;  5LMN E;  4DR5 E;  4AQY E;  1XMO E;  4JYA E;  2LRS A;  4WFT A;  3JAM C;  4M0V A;  2L2N A;  2V89 A;  2NUG A;  4JV5 E;  3HTX A;  5IWA E;  4DUZ E;  4LF9 E;  3ADG A;  3J7Y p;  4DR1 E;  4JI8 E;  2M4I A;  2UXD E;  4BMJ A;  4WPY A;  3DJW A;  3H09 A;  1YYO A;  1RQ0 A;  2DSY A;  4F54 A;  2IHR 1;  2N3G A;  2RSM A;  4B3M E;  5A2Q C;  4JI5 E;  4TUI A;  3RMP A;  2WZO A;  4F9A B;  4JI7 E;  4DV6 E;  3C4T A;  5CFF E;  2JWO A;  2EZ6 A;  4B3S E;  2ODR D;  3HPZ A;  4F9C B;  1N33 E;  2UXC E;  1X47 A;  1XNR E;  4L8N A;  2DIX A;  2B9D A;  5AAS A;  3OTO E;  3MSW A;  4JI2 E;  4LFB E;  4DV0 E;  4JI0 E;  3J80 C;  2L3C A;  4LU9 A;  5LL6 R;  4YHH E;  4DV5 E;  4J8Z A;  1IBL E;  4JI6 E;  4DR6 E;  1X48 A;  1FJG E;  4DUY E;  2LUP B;  4X8W A;  5AE3 A;  2UUA E;  5DNY A;  4LF4 E;  2KOU A;  3F6G A;  3F6H A;  2UU9 E;  4KHP E;  1J5E E;  2M7Q A;  2MDR A;  2H36 X;  2LE2 A;  3OML A;  2V8Q B;  3HQ1 A;  4I8O A;  4KZS A;  2L2K B;  2YT4 A;  4DR3 E;  2B7T A;  1N34 E;  1UHZ A;  2L8T A;  4X62 E;  2F8B A;  5AE2 A;  2M1S A;  3VYY A;  2F4V E;  1ZBQ A;  2KON A;  4DV7 E;  4DR2 E;  2JVA A;  4JI1 E;  4LTY A;  5FLX C;  3J81 C;  4WYQ B;  1HNW E;  2YZT A;  4F9B B;  4X65 E;  2JY9 A;  1SR9 A;  2L2M A;  4YY3 E;  3ZOQ B;  4K0K E;  4DR4 E;  2LTR A;  4LFA E;  4BBY A;  4Q28 A;  2N3H A;  1T4N A;  2LBS B;  3ADI A;  4DV2 E;  2V87 A;  1T4L B;  3DF6 A;  4P78 A;  4M30 A;  2MC6 A;  1RC7 A;  4NXN E;  5IT9 C;  2B3T B;  2L92 A;  2ODR C;  2E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...