1UILA

Double-stranded rna-binding motif of hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-binding motif
publication title Structure of Double-stranded RNA-binding motif of Hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 17
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uilA01
4M30A 2L33A 3VYXA 3C4BA 1XMOE 2EZ6A 4JI5E 1I94E 1UILA 2DIXA 2JVAA 4LF7E 4JI8E 1WHNA 2MDRA 2L2KB 2ZM6E 1XNQE 2UXDE 2L2MA 3VYYA 1YYKA 4GKJE 4DR3E 1X48A 2RS7A 2L3JA 1HNXE 1EKZA 2DB2A 1X47A 4DR4E 2LUQA 2UXBE 2F4VE 2UUAE 4OOGC 5LMUE 1XMQE 1O0WA 4DR7E 5CFFE 4DV5E 2JY9A 2NUGA 4X62E 4KHPE 4JI0E 1IBLE 4GKKE 5BR8E 4DV3E 2DMYA 4B3ME 2N3HA 1RQ0A 3C4TA 4LF9E 2B7VA 1STUA 4X65E 4DV7E 3ADGA 1HR0E 4YHHE 1ZBTA 2NA2A 2RS6A 3ADJA 4YY3E 1J5EE 2L3CA 2VQEE 2HHHE 4DUYE 4JI2E 2NUFA 2YT4A 1QU6A 2KHXA 4M2ZA 4JI4E 2B3TB 1N34E 2IHR1 2LTSA 1YYWA 4DR6E 1T4NA 2LUPB 2E5LE 1YYOA 2LBSB 4NXNE 4LF4E 1GQEA 4DR5E 1IBKE 4NXME 4DKKA 4AQYE 4LF6E 5LMNE 4JYAE 1WHQA 1J26A 3OTOE 4DV1E 1T4LB 1DI2A 2LRSA 1YZ9A 2B7TA 4DV2E 2L2NA 3T1YE 1T4OA 4K0KE 4JI6E 4DV0E 2NUEA 4DV4E 4WYQB 4X8WA 1N32E 2LJHA 3P1XA 3ADIA 4DR1E 4DV6E 4JI1E 4X66E 1XNRE 2N3GA 1PKPA 1X49A 1N33E 1FJGE 2CPNA 4B3RE 4JV5E 1FKAE 4DUZE 2RTXA 1RC7A 2RSMA 4DR2E 4LF5E 4LFBE 1HNWE 4JI7E 4B3SE 4LFCE 2UXCE 3J7Yp 3ADLA 4LF8E 4OX9E 4X64E 2UU9E 1HNZE 4B3TE 3HTXA 1UHZA 5IWAE 3T1HE 1IBME 2UUCE 4JI3E 4WFTA 2VQFE 4LFAE 2UUBE 2LTRA 3LLHA 1N36E
chains in the Genus database with same CATH superfamily
2EMIA 3MHHC 4BS9A 2EOZA 4JI5E 2EZ6A 4JI8E 1GZ6A 4HTGA 2YTEA 2FGGA 1X48A 2RS7A 4WSPA 4DR4E 2B9DA 2LJUA 2LUQA 2I13A 2EJ4A 2EOIA 2FV4B 5TSEA 2VE7C 1A1HA 5A69A 5KL4A 4R2SA 1YUIA 1RMDA 2EPOA 2NUGA 2YRMA 1UBDC 2V86A 2V88A 2YTOA 2EM3A 4ZYEA 2DSYA 4GKKE 2EPPA 5AE1A 4B3ME 2DMYA 2N3HA 2EQ3A 5A6KA 2L92A 4O43A 1STUA 1KYQA 2DLQA 2GPIA 2V83A 1HR0E 4YHHE 2EM2A 2YTJA 3EQ1A 3JU0A 1ZBQA 2V8QB 3ADJA 4YY3E 4R2AA 2M4IA 2A25A 3MHSC 5KL2A 4JI2E 2NUFA 2YT4A 2KHXA 2J7JA 1LLMC 2WCC3 2IHR1 2MC6A 2DMIA 2EPCA 1T39A 2EMYA 1GQEA 1SFEA 4LF6E 1GTKA 2EN6A 2VRDA 3THNA 1WHQA 1YSAC 1AH5A 1TF3A 3OTOE 1ZR9A 1A1IA 3T1YE 4F6MA 4DV0E 2LMZA 4X8WA 4KZSA 3P1XA 2EM0A 3ADIA 5IXMB 1BBOA 2EP3A 2ELYA 4BC9A 4DR1E 4TUIA 1X6EA 2RSIA 1WRJA 3THOB 2H36X 2YSPA 2CPNA 2YTQA 1FKAE 1B69A 2LT7A 3UK3C 4LFBE 4LF5E 5A6AA 5KL6A 4B3SE 2WBSA 1NCSA 3J7Yp 2YPNA 1G2FC 4LF8E 2EQ1A 4DMIA 2M7QA 4BBYA 2EOYA 4B3TE 1UHZA 3T1HE 4LFAE 2UUCE 3BBGA 4F9CB 2EWLA 4R2CA 1N36E 3F6GA 2EM4A 3C6KA 4O5GA 1I94E 2DIXA 2JP9A 4KWYA 4ZYGA 2EN3A 3BGHA 3VYYA 4F54A 4DR3E 2L3JA 1EKZA 4M0VA 1KJKA 1A1LA 2ODRC 1EH8A 3L00A 2D9HA 4OOGC 1O0WA 4O4KA 2EMAA 5A6BD 2ENAA 4N4RB 3ECRA 2JY9A 4DV5E 5AE3A 1WXRA 2EORA 2HGHA 4BC7A 4KHPE 2FTXB 1YPNA 4F2JC 5BR8E 4DV3E 2EPKX 3VHTB 4LF9E 2B7VA 4X65E 4DV7E 5T6JA 4J8ZA 4IJDA 2K4VA 1Z1BA 3BF2A 3IWCA 4F9AB 2RS6A 1X3CA 2EL5A 2L3CA 2HHHE 4WPYA 4MLVA 1QNTA 1YUJA 2EPUA 4Q28A 1PDAA 4M2ZA 4TUGA 4JI4E 1N34E 2G7HA 1P47A 3ZOQB 1YYWA 2EMHA 3J7AG 3C6MA 5F3WA 1YYOA 5AASA 2EMLA 2DRPA 3AUZA 4NXME 3DF6A 4JYAE 2ADRA 4O24A 3EPKA 1YZ9A 1UN6B 5AE2A 4DV2E 1T4OA 5A6JA 4JI6E 2NUEA 4DV4E 1T38A 3KZZA 2EMBA 2LE2A 2M9AA 4NZVA 2ODRD 4DV6E 1L4SA 4WX9A 4X66E 2EOFA 1PKPA 3HQ1A 1FJGE 2YTIA 1YFHA 5LLQA 4DUZE 3LMLA 1PJQA 1RC7A 2EN7A 2JOBA 4F6NA 4DR2E 4JI7E 1DQ3A 3KZYA 3ADLA 2ELZA 4OX9E 2K7IA 5KL5A 1HNZE 1DGCA 3HTXA 2YU8A 5FLXC 2VQFE 3IWBA 3F6HA 2YZTA 2EOMA 2L33A 1N3GA 2EPAA 1UILA 2UXDE 2L2KB 2ZM6E 2JPAA 3KWRA 1X5WA 2EMWA 2L2MA 2EMCA 5KL3A 1YYKA 4GKJE 4LU9A 5LL6R 2DB2A 1X47A 2EN2A 4GZNC 2F4VE 2ENCA 2UUAE 3IWDA 2EPLX 5LMUE 1WJPA 2EOJA 1XMQE 4NHRA 1ZAAC 2EOOA 2GHFA 3RMPA 4R2RA 4JI0E 1IBLE 4R2PA 2WBUA 2JWOA 2EN8A 1RQ0A 2YRKA 3ADGA 2PRTA 5AC4A 2NA2A 1J5EE 2VQEE 1PJSA 2EPRA 5IT9C 4HEIA 4RH8A 2E72A 2YRHA 4ZYDA 3OMLA 4GEQB 2GLIA 2EM8A 4FK5C 2B3TB 2EPMX 2EOSA 2HJJA 2LTSA 3DJWA 3VK6A 1T4NA 1X6HA 2E5LE 2LBSB 4R2EA 4NXNE 4LTYA 5AC5A 4DR5E 4DKKA 2BB8A 4AQYE 4DV1E 2Q8UA 2LRSA 4IS1C 1IQSA 1G2DC 2B7TA 2EQ0A 2KONA 2L2NA 4M9VC 4L8NA 5DNYA 4BHCA 2V87A 4WYQB 2LJHA 2RPCA 2JYAA 2EOXA 1A1JA 2EMGA 4ZYHA 2LO3A 2EOQA 3HXLA 1X49A 2EMZA 3FIGA 4BMJA 2DLKA 2EPXA 3H09A 3BIDA 2V85A 2RSMA 4X9JA 1JK1A 2EMFA 4LFCE 2EPZA 3EPHA 2UXCE 2LVHA 2EL4A 3QG5C 5KL7A 4X64E 2UU9E 2CTDA 4JI3E 4WFTA 1JK2A 2V89A 3M99B 3LLHA 2YTNA 2JR1A 2EM7A 4M30A 1EH7A 4P7DA 3VYXA 3C4BA 1XMOE 3MSWA 1MEYC 4R2DA 2JVAA 4LF7E 1WHNA 2MDRA 1IQOA 1XNQE 2R76A 2EOHA 3EPJA 2L8TA 1A1FA 2EE8A 2YTFA 1HNXE 1BB8A 2EL6A 2EN1A 2LCEA 1BBGA 5A2QC 2UXBE 2M1SA 3TQMA 2RQLA 4MLQA 5IV8B 4R2QA 2ENHA 4DR7E 5CFFE 2LV2A 1IMUA 4X62E 2EM5A 2CSHA 4WXDA 2BBGA 2YWQA 3K6QA 3C4TA 3HPZA 4WSGA 2YTPA 4Q35B 2I9IA 1TF6A 1ZBTA 2CT1A 3J81C 4DUYE 3JTZA 2EM9A 1X6FA 1QU6A 1A1GA 2HC5A 2L6MA 1A1KA 5ADZA 2F8BA 2JOXA 4DR6E 4P78A 1PJTA 3HPSA 2KOUA 2LUPB 4F9BB 2YTGA 2JXPA 2MKNA 4LF4E 1NEIA 4BCAA 2VF1A 1IBKE 2MKDA 5LMNE 1J26A 2E1MA 1T4LB 1DI2A 2N8XA 4WXCA 1MGTA 4K0KE 2EOEA 2YU5A 4I8OA 5A6BA 1ZU1A 3AV0A 1N32E 1F2IG 1SR9A 1AAYA 2EMKA 4R8OA 2YTDA 4R03A 4JI1E 2WZOA 2N3GA 2R1FA 2YSOA 1XNRE 2WBTA 1N33E 2EN4A 2EM6A 4B3RE 4JV5E 2MC5A 2RTXA 4BHBA 2DGCA 2EPNA 1HNWE 3J80C 2EMXA 1EH6A 3JAMC 4L5NC 1TN9A 5IWAE 1IBME 4RHBB 2UUBE 2LTRA 2MDGA 3EPLA 2NABA
chains in the Genus database with same CATH topology
2JR1A 2YZTA 4M30A 3F6GA 4P7DA 2L33A 3VYXA 3C4BA 4BS9A 3MSWA 1XMOE 4JI5E 2EZ6A 1I94E 1UILA 2DIXA 2JVAA 4LF7E 4JI8E 1WHNA 2MDRA 2L2KB 2ZM6E 1GZ6A 3KWRA 1XNQE 2UXDE 2L2MA 3VYYA 1YYKA 4F54A 4GKJE 4LU9A 2L8TA 4DR3E 2FGGA 1X48A 2RS7A 2L3JA 1HNXE 1EKZA 5LL6R 2DB2A 4WSPA 1X47A 4DR4E 2B9DA 4M0VA 2LUQA 5A2QC 2UXBE 2FV4B 2M1SA 2ODRC 2UUAE 2F4VE 3IWDA 4OOGC 2VE7C 5LMUE 1XMQE 1O0WA 4DR7E 5CFFE 4DV5E 2JY9A 5AE3A 2NUGA 1WXRA 4X62E 2V86A 4BC7A 4KHPE 3RMPA 2FTXB 2V88A 4JI0E 1IBLE 2DSYA 4GKKE 5BR8E 5AE1A 2JWOA 4DV3E 2DMYA 4B3ME 2N3HA 1RQ0A 2L92A 3C4TA 3K6QA 3HPZA 4LF9E 2B7VA 1STUA 4X65E 4DV7E 3ADGA 5T6JA 4J8ZA 2V83A 2K4VA 1HR0E 4YHHE 1ZBTA 2NA2A 3JU0A 1ZBQA 3IWCA 4F9AB 2RS6A 2V8QB 3J81C 3ADJA 4YY3E 1J5EE 2L3CA 2VQEE 2HHHE 2M4IA 4DUYE 4JI2E 5IT9C 3JTZA 2YT4A 2NUFA 4WPYA 1QU6A 2KHXA 3OMLA 2L6MA 4GEQB 4Q28A 5ADZA 4M2ZA 4TUGA 2F8BA 4JI4E 2B3TB 1N34E 2G7HA 2IHR1 2JOXA 2LTSA 3DJWA 3VK6A 4P78A 3ZOQB 1YYWA 4DR6E 1T4NA 3HPSA 2KOUA 3J7AG 2LUPB 2MC6A 2E5LE 4F9BB 5F3WA 2LBSB 1YYOA 4NXNE 4LTYA 4LF4E 5AASA 4BCAA 1GQEA 3AUZA 2VF1A 4DR5E 1IBKE 4NXME 4DKKA 4AQYE 4LF6E 5LMNE 3DF6A 4JYAE 1WHQA 1J26A 2E1MA 3OTOE 4DV1E 1T4LB 2LRSA 1DI2A 1YZ9A 2B7TA 5AE2A 4DV2E 2KONA 2L2NA 1T4OA 3T1YE 4JI6E 4K0KE 4L8NA 5DNYA 4DV0E 4I8OA 2LMZA 2V87A 4DV4E 2NUEA 3AV0A 4WYQB 4X8WA 2LJHA 4KZSA 1N32E 3P1XA 3ADIA 1SR9A 2LE2A 4BC9A 2ODRD 4DV6E 4DR1E 4TUIA 4R8OA 4R03A 4JI1E 4X66E 3HXLA 2WZOA 2N3GA 1PKPA 1XNRE 1X49A 3HQ1A 1N33E 1FJGE 2H36X 3FIGA 2CPNA 4B3RE 4JV5E 4BMJA 1FKAE 2MC5A 3LMLA 2RTXA 4DUZE 1RC7A 2JOBA 3H09A 2V85A 2RSMA 4DR2E 4LF5E 4LFBE 1HNWE 4JI7E 4B3SE 4LFCE 2UXCE 1DQ3A 3J7Yp 3J80C 3JAMC 3ADLA 4LF8E 4DMIA 4OX9E 4L5NC 2M7QA 4BBYA 4X64E 2UU9E 1HNZE 4B3TE 3HTXA 1UHZA 5IWAE 3T1HE 1IBME 2UUCE 5FLXC 4WFTA 2VQFE 4JI3E 3IWBA 2UUBE 4LFAE 2LTRA 3F6HA 4F9CB 2V89A 2EWLA 3LLHA 1N36E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M30 A;  2L33 A;  3VYX A;  3C4B A;  1XMO E;  2EZ6 A;  4JI5 E;  1I94 E;  1UIL A;  2DIX A;  2JVA A;  4LF7 E;  4JI8 E;  1WHN A;  2MDR A;  2L2K B;  2ZM6 E;  1XNQ E;  2UXD E;  2L2M A;  3VYY A;  1YYK A;  4GKJ E;  4DR3 E;  1X48 A;  2RS7 A;  2L3J A;  1HNX E;  1EKZ A;  2DB2 A;  1X47 A;  4DR4 E;  2LUQ A;  2UXB E;  2F4V E;  2UUA E;  4OOG C;  5LMU E;  1XMQ E;  1O0W A;  4DR7 E;  5CFF E;  4DV5 E;  2JY9 A;  2NUG A;  4X62 E;  4KHP E;  4JI0 E;  1IBL E;  4GKK E;  5BR8 E;  4DV3 E;  2DMY A;  4B3M E;  2N3H A;  1RQ0 A;  3C4T A;  4LF9 E;  2B7V A;  1STU A;  4X65 E;  4DV7 E;  3ADG A;  1HR0 E;  4YHH E;  1ZBT A;  2NA2 A;  2RS6 A;  3ADJ A;  4YY3 E;  1J5E E;  2L3C A;  2VQE E;  2HHH E;  4DUY E;  4JI2 E;  2NUF A;  2YT4 A;  1QU6 A;  2KHX A;  4M2Z A;  4JI4 E;  2B3T B;  1N34 E;  2IHR 1;  2LTS A;  1YYW A;  4DR6 E;  1T4N A;  2LUP B;  2E5L E;  1YYO A;  2LBS B;  4NXN E;  4LF4 E;  1GQE A;  4DR5 E;  1IBK E;  4NXM E;  4DKK A;  4AQY E;  4LF6 E;  5LMN E;  4JYA E;  1WHQ A;  1J26 A;  3OTO E;  4DV1 E;  1T4L B;  1DI2 A;  2LRS A;  1YZ9 A;  2B7T A;  4DV2 E;  2L2N A;  3T1Y E;  1T4O A;  4K0K E;  4JI6 E;  4DV0 E;  2NUE A;  4DV4 E;  4WYQ B;  4X8W A;  1N32 E;  2LJH A;  3P1X A;  3ADI A;  4DR1 E;  4DV6 E;  4JI1 E;  4X66 E;  1XNR E;  2N3G A;  1PKP A;  1X49 A;  1N33 E;  1FJG E;  2CPN A;  4B3R E;  4JV5 E;  1FKA E;  4DUZ E;  2RTX A;  1RC7 A;  2RSM A;  4DR2 E;  4LF5 E;  4LFB E;  1HNW E;  4JI7 E;  4B3S E;  4LFC E;  2UXC E;  3J7Y p;  3ADL A;  4LF8 E;  4OX9 E;  4X64 E;  2UU9 E;  1HNZ E;  4B3T E;  3HTX A;  1UHZ A;  5IWA E;  3T1H E;  1IBM E;  2UUC E;  4JI3 E;  4WFT A;  2VQF E;  4LFA E;  2UUB E;  2LTR A;  3LLH A;  1N36 E; 
#chains in the Genus database with same CATH topology
 2EMI A;  3MHH C;  4BS9 A;  2EOZ A;  4JI5 E;  2EZ6 A;  4JI8 E;  1GZ6 A;  4HTG A;  2YTE A;  2FGG A;  1X48 A;  2RS7 A;  4WSP A;  4DR4 E;  2B9D A;  2LJU A;  2LUQ A;  2I13 A;  2EJ4 A;  2EOI A;  2FV4 B;  5TSE A;  2VE7 C;  1A1H A;  5A69 A;  5KL4 A;  4R2S A;  1YUI A;  1RMD A;  2EPO A;  2NUG A;  2YRM A;  1UBD C;  2V86 A;  2V88 A;  2YTO A;  2EM3 A;  4ZYE A;  2DSY A;  4GKK E;  2EPP A;  5AE1 A;  4B3M E;  2DMY A;  2N3H A;  2EQ3 A;  5A6K A;  2L92 A;  4O43 A;  1STU A;  1KYQ A;  2DLQ A;  2GPI A;  2V83 A;  1HR0 E;  4YHH E;  2EM2 A;  2YTJ A;  3EQ1 A;  3JU0 A;  1ZBQ A;  2V8Q B;  3ADJ A;  4YY3 E;  4R2A A;  2M4I A;  2A25 A;  3MHS C;  5KL2 A;  4JI2 E;  2NUF A;  2YT4 A;  2KHX A;  2J7J A;  1LLM C;  2WCC 3;  2IHR 1;  2MC6 A;  2DMI A;  2EPC A;  1T39 A;  2EMY A;  1GQE A;  1SFE A;  4LF6 E;  1GTK A;  2EN6 A;  2VRD A;  3THN A;  1WHQ A;  1YSA C;  1AH5 A;  1TF3 A;  3OTO E;  1ZR9 A;  1A1I A;  3T1Y E;  4F6M A;  4DV0 E;  2LMZ A;  4X8W A;  4KZS A;  3P1X A;  2EM0 A;  3ADI A;  5IXM B;  1BBO A;  2EP3 A;  2ELY A;  4BC9 A;  4DR1 E;  4TUI A;  1X6E A;  2RSI A;  1WRJ A;  3THO B;  2H36 X;  2YSP A;  2CPN A;  2YTQ A;  1FKA E;  1B69 A;  2LT7 A;  3UK3 C;  4LFB E;  4LF5 E;  5A6A A;  5KL6 A;  4B3S E;  2WBS A;  1NCS A;  3J7Y p;  2YPN A;  1G2F C;  4LF8 E;  2EQ1 A;  4DMI A;  2M7Q A;  4BBY A;  2EOY A;  4B3T E;  1UHZ A;  3T1H E;  4LFA E;  2UUC E;  3BBG A;  4F9C B;  2EWL A;  4R2C A;  1N36 E;  3F6G A;  2EM4 A;  3C6K A;  4O5G A;  1I94 E;  2DIX A;  2JP9 A;  4KWY A;  4ZYG A;  2EN3 A;  3BGH A;  3VYY A;  4F54 A;  4DR3 E;  2L3J A;  1EKZ A;  4M0V A;  1KJK A;  1A1L A;  2ODR C;  1EH8 A;  3L00 A;  2D9H A;  4OOG C;  1O0W A;  4O4K A;  2EMA A;  5A6B D;  2ENA A;  4N4R B;  3ECR A;  2JY9 A;  4DV5 E;  5AE3 A;  1WXR A;  2EOR A;  2HGH A;  4BC7 A;  4KHP E;  2FTX B;  1YPN A;  4F2J C;  5BR8 E;  4DV3 E;  2EPK X;  3VHT B;  4LF9 E;  2B7V A;  4X65 E;  4DV7 E;  5T6J A;  4J8Z A;  4IJD A;  2K4V A;  1Z1B A;  3BF2 A;  3IWC A;  4F9A B;  2RS6 A;  1X3C A;  2EL5 A;  2L3C A;  2HHH E;  4WPY A;  4MLV A;  1QNT A;  1YUJ A;  2EPU A;  4Q28 A;  1PDA A;  4M2Z A;  4TUG A;  4JI4 E;  1N34 E;  2G7H A;  1P47 A;  3ZOQ B;  1YYW A;  2EMH A;  3J7A G;  3C6M A;  5F3W A;  1YYO A;  5AAS A;  2EML A;  2DRP A;  3AUZ A;  4NXM E;  3DF6 A;  4JYA E;  2ADR A;  4O24 A;  3EPK A;  1YZ9 A;  1UN6 B;  5AE2 A;  4DV2 E;  1T4O A;  5A6J A;  4JI6 E;  2NUE A;  4DV4 E;  1T38 A;  3KZZ A;  2EMB A;  2LE2 A;  2M9A A;  4NZV A;  2ODR D;  4DV6 E;  1L4S A;  4WX9 A;  4X66 E;  2EOF A;  1PKP A;  3HQ1 A;  1FJG E;  2YTI A;  1YFH A;  5LLQ A;  4DUZ E;  3LML A;  1PJQ A;  1RC7 A;  2EN7 A;  2JOB A;  4F6N A;  4DR2 E;  4JI7 E;  1DQ3 A;  3KZY A;  3ADL A;  2ELZ A;  4OX9 E;  2K7I A;  5KL5 A;  1HNZ E;  1DGC A;  3HTX A;  2YU8 A;  5FLX C;  2VQF E;  3IWB A;  3F6H A;  2YZT A;  2EOM A;  2L33 A;  1N3G A;  2EPA A;  1UIL A;  2UXD E;  2L2K B;  2ZM6 E;  2JPA A;  3KWR A;  1X5W A;  2EMW A;  2L2M A;  2EMC A;  5KL3 A;  1YYK A;  4GKJ E;  4LU9 A;  5LL6 R;  2DB2 A;  1X47 A;  2EN2 A;  4GZN C;  2F4V E;  2ENC A;  2UUA E;  3IWD A;  2EPL X;  5LMU E;  1WJP A;  2EOJ A;  1XMQ E;  4NHR A;  1ZAA C;  2EOO A;  2GHF A;  3RMP A;  4R2R A;  4JI0 E;  1IBL E;  4R2P A;  2WBU A;  2JWO A;  2EN8 A;  1RQ0 A;  2YRK A;  3ADG A;  2PRT A;  5AC4 A;  2NA2 A;  1J5E E;  2VQE E;  1PJS A;  2EPR A;  5IT9 C;  4HEI A;  4RH8 A;  2E72 A;  2YRH A;  4ZYD A;  3OML A;  4GEQ B;  2GLI A;  2EM8 A;  4FK5 C;  2B3T B;  2EPM X;  2EOS A;  2HJJ A;  2LTS A;  3DJW A;  3VK6 A;  1T4N A;  1X6H A;  2E5L E;  2LBS B;  4R2E A;  4NXN E;  4LTY A;  5AC5 A;  4DR5 E;  4DKK A;  2BB8 A;  4AQY E;  4DV1 E;  2Q8U A;  2LRS A;  4IS1 C;  1IQS A;  1G2D C;  2B7T A;  2EQ0 A;  2KON A;  2L2N A;  4M9V C;  4L8N A;  5DNY A;  4BHC A;  2V87 A;  4WYQ B;  2LJH A;  2RPC A;  2JYA A;  2EOX A;  1A1J A;  2EMG A;  4ZYH A;  2LO3 A;  2EOQ A;  3HXL A;  1X49 A;  2EMZ A;  3FIG A;  4BMJ A;  2DLK A;  2EPX A;  3H09 A;  3BID A;  2V85 A;  2RSM A;  4X9J A;  1JK1 A;  2EMF A;  4LFC E;  2EPZ A;  3EPH A;  2UXC E;  2LVH A;  2EL4 A;  3QG5 C;  5KL7 A;  4X64 E;  2UU9 E;  2CTD A;  4JI3 E;  4WFT A;  1JK2 A;  2V89 A;  3M99 B;  3LLH A;  2YTN A;  2JR1 A;  2EM7 A;  4M30 A;  1EH7 A;  4P7D A;  3VYX A;  3C4B A;  1XMO E;  3MSW A;  1MEY C;  4R2D A;  2JVA A;  4LF7 E;  1WHN A;  2MDR A;  1IQO A;  1XNQ E;  2R76 A;  2EOH A;  3EPJ A;  2L8T A;  1A1F A;  2EE8 A;  2YTF A;  1HNX E;  1BB8 A;  2EL6 A;  2EN1 A;  2LCE A;  1BBG A;  5A2Q C;  2UXB E;  2M1S A;  3TQM A;  2RQL A;  4MLQ A;  5IV8 B;  4R2Q A;  2ENH A;  4DR7 E;  5CFF E;  2LV2 A;  1IMU A;  4X62 E;  2EM5 A;  2CSH A;  4WXD A;  2BBG A;  2YWQ A;  3K6Q A;  3C4T A;  3HPZ A;  4WSG A;  2YTP A;  4Q35 B;  2I9I A;  1TF6 A;  1ZBT A;  2CT1 A;  3J81 C;  4DUY E;  3JTZ A;  2EM9 A;  1X6F A;  1QU6 A;  1A1G A;  2HC5 A;  2L6M A;  1A1K A;  5ADZ A;  2F8B A;  2JOX A;  4DR6 E;  4P78 A;  1PJT A;  3HPS A;  2KOU A;  2LUP B;  4F9B B;  2YTG A;  2JXP A;  2MKN A;  4LF4 E;  1NEI A;  4BCA A;  2VF1 A;  1IBK E;  2MKD A;  5LMN E;  1J26 A;  2E1M A;  1T4L B;  1DI2 A;  2N8X A;  4WXC A;  1MGT A;  4K0K E;  2EOE A;  2YU5 A;  4I8O A;  5A6B A;  1ZU1 A;  3AV0 A;  1N32 E;  1F2I G;  1SR9 A;  1AAY A;  2EMK A;  4R8O A;  2YTD A;  4R03 A;  4JI1 E;  2WZO A;  2N3G A;  2R1F A;  2YSO A;  1XNR E;  2WBT A;  1N33 E;  2EN4 A;  2EM6 A;  4B3R E;  4JV5 E;  2MC5 A;  2RTX A;  4BHB A;  2DGC A;  2EPN A;  1HNW E;  3J80 C;  2EMX A;  1EH6 A;  3JAM C;  4L5N C;  1TN9 A;  5IWA E;  1IBM E;  4RHB B;  2UUB E;  2LTR A;  2MDG A;  3EPL A;  2NAB A; 
#chains in the Genus database with same CATH homology
 2JR1 A;  2YZT A;  4M30 A;  3F6G A;  4P7D A;  2L33 A;  3VYX A;  3C4B A;  4BS9 A;  3MSW A;  1XMO E;  4JI5 E;  2EZ6 A;  1I94 E;  1UIL A;  2DIX A;  2JVA A;  4LF7 E;  4JI8 E;  1WHN A;  2MDR A;  2L2K B;  2ZM6 E;  1GZ6 A;  3KWR A;  1XNQ E;  2UXD E;  2L2M A;  3VYY A;  1YYK A;  4F54 A;  4GKJ E;  4LU9 A;  2L8T A;  4DR3 E;  2FGG A;  1X48 A;  2RS7 A;  2L3J A;  1HNX E;  1EKZ A;  5LL6 R;  2DB2 A;  4WSP A;  1X47 A;  4DR4 E;  2B9D A;  4M0V A;  2LUQ A;  5A2Q C;  2UXB E;  2FV4 B;  2M1S A;  2ODR C;  2UUA E;  2F4V E;  3IWD A;  4OOG C;  2VE7 C;  5LMU E;  1XMQ E;  1O0W A;  4DR7 E;  5CFF E;  4DV5 E;  2JY9 A;  5AE3 A;  2NUG A;  1WXR A;  4X62 E;  2V86 A;  4BC7 A;  4KHP E;  3RMP A;  2FTX B;  2V88 A;  4JI0 E;  1IBL E;  2DSY A;  4GKK E;  5BR8 E;  5AE1 A;  2JWO A;  4DV3 E;  2DMY A;  4B3M E;  2N3H A;  1RQ0 A;  2L92 A;  3C4T A;  3K6Q A;  3HPZ A;  4LF9 E;  2B7V A;  1STU A;  4X65 E;  4DV7 E;  3ADG A;  5T6J A;  4J8Z A;  2V83 A;  2K4V A;  1HR0 E;  4YHH E;  1ZBT A;  2NA2 A;  3JU0 A;  1ZBQ A;  3IWC A;  4F9A B;  2RS6 A;  2V8Q B;  3J81 C;  3ADJ A;  4YY3 E;  1J5E E;  2L3C A;  2VQE E;  2HHH E;  2M4I A;  4DUY E;  4JI2 E;  5IT9 C;  3JTZ A;  2YT4 A;  2NUF A;  4WPY A;  1QU6 A;  2KHX A;  3OML A;  2L6M A;  4GEQ B;  4Q28 A;  5ADZ A;  4M2Z A;  4TUG A;  2F8B A;  4JI4 E;  2B3T B;  1N34 E;  2G7H A;  2IHR 1;  2JOX A;  2LTS A;  3DJW A;  3VK6 A;  4P78 A;  3ZOQ B;  1YYW A;  4DR6 E;  1T4N A;  3HPS A;  2KOU A;  3J7A G;  2LUP B;  2MC6 A;  2E5L E;  4F9B B;  5F3W A;  2LBS B;  1YYO A;  4NXN E;  4LTY A;  4LF4 E;  5AAS A;  4BCA A;  1GQE A;  3AUZ A;  2VF1 A;  4DR5 E;  1IBK E;  4NXM E;  4DKK A;  4AQY E;  4LF6 E;  5LMN E;  3DF6 A;  4JYA E;  1WHQ A;  1J26 A;  2E1M A;  3OTO E;  4DV1 E;  1T4L B;  2LRS A;  1DI2 A;  1YZ9 A;  2B7T A;  5AE2 A;  4DV2 E;  2KON A;  2L2N A;  1T4O A;  3T1Y E;  4JI6 E;  4K0K E;  4L8N A;  5DNY A;  4DV0 E;  4I8O A;  2LMZ A;  2V87 A;  4DV4 E;  2NUE A;  3AV0 A;  4WYQ B;  4X8W A;  2LJH A;  4KZS A;  1N32 E;  3P1X A;  3ADI A;  1SR9 A;  2LE2 A;  4BC9 A;  2ODR D;  4DV6 E;  4DR1 E;  4TUI A;  4R8O A;  4R03 A;  4JI1 E;  4X66 E;  3HXL A;  2WZO A;  2N3G A;  1PKP A;  1XNR E;  1X49 A;  3HQ1 A;  1N33 E;  1FJG E;  2H36 X;  3FIG A;  2CPN A;  4B3R E;  4JV5 E;  4BMJ A;  1FKA E;  2MC5 A;  3LML A;  2RTX A;  4DUZ E;  1RC7 A;  2JOB A;  3H09 A;  2V85 A;  2RSM A;  4DR2 E;  4LF5 E;  4LFB E;  1HNW E;  4JI7 E;  4B3S E;  4LFC E;  2UXC E;  1DQ3 A;  3J7Y p;  3J80 C;  3JAM C;  3ADL A;  4LF8 E;  4DMI A;  4OX9 E;  4L5N C;  2M7Q A;  4BBY A;  4X64 E;  2UU9 E;  1HNZ E;  4B3T E;  3HTX A;  1UHZ A;  5IWA E;  3T1H E;  1IBM E;  2UUC E;  5FLX C;  4WFT A;  2VQF E;  4JI3 E;  3IWB A;  2UUB E;  4LFA E;  2LTR A;  3F6H A;  4F9C B;  2V89 A;  2EWL A;  3LLH A;  1N36 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...