1UILA

Double-stranded rna-binding motif of hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
113
Chain Sequence
GSSGSSGLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVIEAYSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Double-stranded RNA-binding motif
publication title Structure of Double-stranded RNA-binding motif of Hypothetical protein BAB28848
rcsb
source organism Mus musculus
total genus 17
structure length 113
sequence length 113
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1uilA01
2DB2A 4DV5E 4DV6E 2UUBE 2JVAA 1N34E 1UILA 1XNRE 3ADIA 2CPNA 4LF6E 2N3HA 3T1HE 2UUAE 1HNZE 4JI5E 4JI6E 4B3RE 4OOGC 4JI4E 4X66E 4JI3E 2L2MA 4YHHE 4WFTA 4K0KE 2N3GA 5BR8E 4JI7E 2L2KB 4LFCE 3ADJA 2LBSB 2HHHE 1YZ9A 3J7Yp 2L3CA 1X47A 4DV4E 1J5EE 4DR2E 4OX9E 2LTSA 3C4TA 2LJHA 3ADLA 2LUPB 2B7TA 2F4VE 2IHR1 2RS7A 4DV1E 1YYOA 1FKAE 1YYKA 1GQEA 1O0WA 1XMQE 1WHQA 1PKPA 2B7VA 4X62E 4B3TE 1RQ0A 4DR6E 4LF5E 2RS6A 2YT4A 1N33E 4DR3E 4DUZE 1N32E 4B3ME 4NXNE 4M30A 2UXBE 1HR0E 2LUQA 4LF9E 4DKKA 2L33A 2MDRA 3ADGA 2UUCE 2KHXA 2NUEA 3HTXA 4GKKE 4DR5E 1T4LB 1N36E 3OTOE 2JY9A 4X65E 1HNXE 2LTRA 4LF7E 4LF8E 4JI2E 3VYXA 4NXME 2EZ6A 5LMUE 2NUGA 4LFBE 5CFFE 2VQEE 4JV5E 2L3JA 4DUYE 2B3TB 1DI2A 1X49A 1J26A 2DIXA 4YY3E 4KHPE 3P1XA 4M2ZA 1IBME 2UXCE 2RTXA 1EKZA 3C4BA 4GKJE 4DV7E 1XMOE 1T4OA 4LF4E 2DMYA 1ZBTA 2E5LE 3LLHA 1XNQE 1X48A 4AQYE 4DR4E 2UXDE 4DV2E 1T4NA 2RSMA 4X64E 2UU9E 2LRSA 4JI8E 4DR1E 4DV0E 4JI0E 1STUA 1QU6A 1WHNA 4JI1E 2ZM6E 1IBKE 2L2NA 4DV3E 2VQFE 4WYQB 5IWAE 1UHZA 4LFAE 1RC7A 4X8WA 2NUFA 4B3SE 1IBLE 4JYAE 3VYYA 3T1YE 4DR7E 1HNWE 2NA2A 1I94E 1YYWA 1FJGE 5LMNE
chains in the Genus database with same CATH superfamily
3EPLA 2ELYA 2EL5A 2DSYA 2GHFA 4BMJA 1PDAA 2RQLA 2EPOA 4DV5E 1A1LA 4DV6E 3IWDA 2UUBE 2EMGA 1UILA 3ADIA 2N3HA 2EMWA 2HC5A 1A1KA 2EQ1A 2KONA 5A2QC 5LL6R 4M9VC 3HPZA 4B3RE 1WRJA 4R2EA 4OOGC 5A6JA 3MSWA 2G7HA 1YPNA 2EOIA 2YTNA 4X9JA 1A1IA 1TF3A 2B9DA 5BR8E 2L2KB 2JR1A 3THOB 2EM3A 1X5WA 3BF2A 1UN6B 2MDGA 4OX9E 2DLQA 5KL5A 3ADLA 4DV1E 1YYOA 2EOSA 1GQEA 5LLQA 2H36X 4O24A 2EN3A 4DR6E 4RHBB 2RS6A 1ZU1A 1N33E 5KL6A 2EPKX 3DF6A 3EQ1A 4B3ME 4NXNE 2EM6A 1IQOA 1A1GA 3HTXA 2NUEA 2KHXA 4F9CB 1TF6A 1T4LB 4F2JC 2FTXB 4F9AB 3OTOE 1HNXE 4LF7E 4NXME 2YU8A 4ZYEA 3KWRA 2WBSA 4R2DA 2L6MA 2VQEE 2EM5A 2HJJA 2CTDA 2B3TB 1PJQA 3J81C 3H09A 1X49A 2ENCA 4YY3E 2EMYA 3P1XA 4HEIA 1X3CA 5AE1A 3MHHC 2NABA 3BGHA 4L8NA 4DV7E 1KJKA 2DMYA 2WBUA 3LLHA 2EMKA 2V89A 3F6GA 2RSMA 2DMIA 2LRSA 2YZTA 4JI0E 2LO3A 4NHRA 1YUIA 4F54A 2EJ4A 2YTFA 2M1SA 2VQFE 2R76A 3C6KA 4I8OA 5T6JA 1IBLE 4JYAE 1BBGA 2M4IA 4Q35B 2Q8UA 4F9BB 3T1YE 4R03A 1Z1BA 2NA2A 1I94E 2EOXA 1FJGE 5LMNE 3MHSC 4LF6E 2V88A 4JI5E 2MKDA 4BS9A 4RH8A 2LMZA 3HXLA 2LT7A 1ZAAC 3VHTB 4JI3E 1JK1A 3FIGA 4K0KE 5AC4A 3TQMA 2BB8A 1YFHA 1YZ9A 3UK3C 1EH8A 4WXCA 2YTEA 1X47A 2YWQA 1DQ3A 2ENAA 2LJUA 2LTSA 1N3GA 2HGHA 1FKAE 1ZR9A 2WZOA 1G2DC 1PKPA 2LVHA 1SR9A 4O43A 2EE8A 2DLKA 1TN9A 2DRPA 4LF5E 1N32E 2EMCA 2EOZA 3LMLA 4M30A 5IT9C 2EM0A 1HR0E 1YSAC 4DKKA 2UUCE 2EL6A 4GKKE 3EPHA 5DNYA 4X65E 2LTRA 2V85A 4M0VA 2EZ6A 3KZYA 2YTQA 2NUGA 5CFFE 4JV5E 1ZBQA 2L3JA 4DUYE 1NEIA 2YTJA 2DIXA 4KHPE 2YTPA 3VK6A 4M2ZA 1IQSA 2E72A 2EM8A 2EOEA 2EM9A 2EN1A 5AE2A 3EPJA 2EN6A 1T4OA 2E5LE 1ZBTA 2UXDE 5AE3A 4KWYA 1X48A 2EN2A 1PJSA 4R2PA 1XNQE 4DV2E 2ADRA 4X64E 1F2IG 2EPXA 4BC9A 2KOUA 4MLVA 3QG5C 2K7IA 4WSPA 1X6EA 3L00A 1WHNA 4DMIA 2ZM6E 2JXPA 2CSHA 2ODRC 4LU9A 4WYQB 5IWAE 2EP3A 4X8WA 2EM4A 2ELZA 1B69A 3DJWA 2EMLA 5IXMB 2JOBA 2JP9A 1GZ6A 1A1HA 4R2RA 2EN4A 3K6QA 2JVAA 2LE2A 1N34E 1SFEA 4R2AA 2BBGA 5A6AA 5AASA 2EQ0A 1RMDA 2M7QA 4X66E 4O4KA 4YHHE 4WFTA 3EPKA 1EH6A 2N3GA 2VF1A 3ADJA 1UBDC 4LTYA 5F3WA 3J7Yp 2EMAA 4ZYHA 4DV4E 2V87A 4DR2E 2V8QB 2EPMX 2LUPB 1YUJA 2B7TA 4IJDA 2F4VE 3C6MA 3HQ1A 5ADZA 2IHR1 3HPSA 3BBGA 1YYKA 3J7AG 3JTZA 1XMQE 1WHQA 4BCAA 2B7VA 2R1FA 1RQ0A 4ZYGA 2EM7A 2YT4A 2RSIA 1X6HA 2UXBE 1LLMC 2EM2A 2LUQA 4LF9E 2L33A 3ADGA 1N36E 2JY9A 2EPRA 3IWBA 4F6MA 2EOQA 4JI2E 2EOFA 3VYXA 2A25A 2EORA 4LFBE 4BHBA 2WCC3 2F8BA 4O5GA 4ZYDA 1J26A 2L8TA 4WPYA 2D9HA 2YRHA 2EWLA 2RTXA 5KL7A 4KZSA 1P47A 1EKZA 4WSGA 4LF4E 4AQYE 2EMBA 3THNA 2UU9E 2EOJA 2YU5A 4JI8E 2DGCA 4DR1E 5A6BD 3AV0A 2MC5A 1QU6A 2EOYA 3JAMC 2CT1A 2MC6A 2YSOA 4JI1E 2LCEA 4DV3E 2EN8A 2MKNA 2YPNA 1UHZA 2RPCA 1RC7A 2LV2A 2NUFA 4B3SE 2N8XA 3IWCA 4P78A 4BBYA 2EPCA 2EPUA 3RMPA 4DR7E 1HNWE 4N4RB 4NZVA 2DB2A 2YTDA 4F6NA 1L4SA 1XNRE 2EN7A 2CPNA 3T1HE 2UUAE 1HNZE 2L92A 4JI6E 4JI4E 3F6HA 3KZZA 4BHCA 4IS1C 1AAYA 4R2CA 1BBOA 2L2MA 1GTKA 2EPNA 2EMFA 4R2SA 2EMXA 4JI7E 5A6KA 2EMZA 5FLXC 4LFCE 2ENHA 4HTGA 2LBSB 2HHHE 2JOXA 2L3CA 1J5EE 2YRMA 3C4TA 2LJHA 1WJPA 1DGCA 2YTIA 5AC5A 4L5NC 2RS7A 4P7DA 2YTGA 2FGGA 2YRKA 5KL4A 4TUIA 1T38A 1O0WA 4TUGA 2V83A 2GLIA 4X62E 4B3TE 3ECRA 2WBTA 3OMLA 2JYAA 5TSEA 1A1FA 2YSPA 4DR3E 4DUZE 3BIDA 1MEYC 2I9IA 2MDRA 2JPAA 4DR5E 2EL4A 2FV4B 2EQ3A 4R2QA 2YTOA 4LF8E 4GEQB 2V86A 2EPZA 1IMUA 2J7JA 5LMUE 1WXRA 2EOHA 5A69A 2EOOA 1DI2A 1PJTA 1AH5A 2K4VA 3ZOQB 4MLQA 1BB8A 1IBME 2UXCE 1X6FA 5IV8B 2I13A 4J8ZA 3C4BA 1JK2A 4GKJE 1KYQA 4WX9A 1XMOE 4DR4E 5KL3A 2EMHA 1T4NA 4WXDA 4GZNC 1A1JA 3M99B 2EOMA 1G2FC 2ODRD 4BC7A 4FK5C 2VE7C 4DV0E 1STUA 3AUZA 1EH7A 1IBKE 2EMIA 2L2NA 5A6BA 2M9AA 5KL2A 4LFAE 2E1MA 1NCSA 2EPAA 2GPIA 1QNTA 3J80C 4R8OA 2JWOA 4Q28A 1MGTA 2EPPA 1T39A 2EPLX 3VYYA 2VRDA 3JU0A 2PRTA 1YYWA
chains in the Genus database with same CATH topology
4BMJA 2DSYA 2DB2A 4DV5E 3K6QA 4DV6E 3IWDA 2UUBE 2JVAA 2LE2A 1UILA 1N34E 1XNRE 2CPNA 4LF6E 2N3HA 3ADIA 3T1HE 2V88A 2UUAE 2KONA 5A2QC 5LL6R 1HNZE 2L92A 3HPZA 4JI5E 4JI6E 4B3RE 4OOGC 5AASA 4BS9A 3MSWA 2LMZA 2G7HA 4JI4E 3F6HA 3HXLA 2M7QA 4X66E 4JI3E 2L2MA 3FIGA 4YHHE 2B9DA 4WFTA 4K0KE 2N3GA 2VF1A 5BR8E 4JI7E 2L2KB 5FLXC 2JR1A 3ADJA 4LFCE 2LBSB 4LTYA 5F3WA 2HHHE 3J7Yp 2JOXA 2L3CA 1YZ9A 1X47A 1DQ3A 4DV4E 1J5EE 2V87A 4DR2E 4OX9E 2LTSA 3C4TA 2LJHA 2V8QB 3ADLA 2LUPB 2B7TA 2F4VE 5ADZA 3HQ1A 2IHR1 2RS7A 4L5NC 4P7DA 3HPSA 4DV1E 2WZOA 1YYOA 1FKAE 2FGGA 4TUIA 1GQEA 1YYKA 1O0WA 4TUGA 3J7AG 3JTZA 2V83A 1XMQE 1WHQA 1PKPA 2H36X 4BCAA 2B7VA 1SR9A 4X62E 4B3TE 1RQ0A 4DR6E 3OMLA 4LF5E 2RS6A 2YT4A 1N33E 4DR3E 4DUZE 1N32E 3DF6A 3LMLA 4B3ME 4NXNE 4M30A 5IT9C 2UXBE 1HR0E 2LUQA 4LF9E 2L33A 3ADGA 2MDRA 4DKKA 2UUCE 2KHXA 4F9CB 2NUEA 3HTXA 4DR5E 1T4LB 4GKKE 2FTXB 4F9AB 1N36E 3OTOE 2JY9A 5DNYA 2FV4B 3IWBA 4X65E 1HNXE 2LTRA 4LF7E 4LF8E 4JI2E 2V85A 4GEQB 3VYXA 2V86A 4NXME 4M0VA 2EZ6A 3KWRA 5LMUE 1WXRA 2NUGA 4LFBE 5CFFE 2L6MA 2VQEE 1ZBQA 4JV5E 2L3JA 2F8BA 2B3TB 4DUYE 1DI2A 3J81C 3H09A 1X49A 1J26A 2DIXA 2K4VA 4YY3E 4KHPE 2L8TA 3P1XA 4WPYA 3ZOQB 3VK6A 4M2ZA 4DR4E 5AE1A 1IBME 2EWLA 2RTXA 2UXCE 4KZSA 1EKZA 4J8ZA 3C4BA 5AE2A 4L8NA 4GKJE 4DV7E 1XMOE 1T4OA 4LF4E 2DMYA 1ZBTA 2E5LE 3LLHA 5AE3A 1X48A 4AQYE 2V89A 1XNQE 2UXDE 4DV2E 1T4NA 3F6GA 2RSMA 4X64E 2UU9E 2ODRD 2LRSA 4JI8E 2YZTA 4BC7A 2KOUA 4BC9A 4DR1E 2VE7C 3AV0A 4DV0E 4JI0E 1STUA 4WSPA 2MC5A 3AUZA 1QU6A 3JAMC 2MC6A 1WHNA 4DMIA 4JI1E 4F54A 2ZM6E 1IBKE 2L2NA 4DV3E 2ODRC 4LU9A 2M1SA 2VQFE 4WYQB 5IWAE 1UHZA 4LFAE 1RC7A 2E1MA 4X8WA 2NUFA 4B3SE 4I8OA 3J80C 5T6JA 4R8OA 3IWCA 2JWOA 4Q28A 1IBLE 4P78A 4BBYA 4JYAE 3VYYA 2M4IA 3DJWA 3JU0A 4F9BB 3RMPA 3T1YE 2JOBA 4R03A 4DR7E 1HNWE 1GZ6A 2NA2A 1I94E 1YYWA 1FJGE 5LMNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB2 A;  4DV5 E;  4DV6 E;  2UUB E;  2JVA A;  1N34 E;  1UIL A;  1XNR E;  3ADI A;  2CPN A;  4LF6 E;  2N3H A;  3T1H E;  2UUA E;  1HNZ E;  4JI5 E;  4JI6 E;  4B3R E;  4OOG C;  4JI4 E;  4X66 E;  4JI3 E;  2L2M A;  4YHH E;  4WFT A;  4K0K E;  2N3G A;  5BR8 E;  4JI7 E;  2L2K B;  4LFC E;  3ADJ A;  2LBS B;  2HHH E;  1YZ9 A;  3J7Y p;  2L3C A;  1X47 A;  4DV4 E;  1J5E E;  4DR2 E;  4OX9 E;  2LTS A;  3C4T A;  2LJH A;  3ADL A;  2LUP B;  2B7T A;  2F4V E;  2IHR 1;  2RS7 A;  4DV1 E;  1YYO A;  1FKA E;  1YYK A;  1GQE A;  1O0W A;  1XMQ E;  1WHQ A;  1PKP A;  2B7V A;  4X62 E;  4B3T E;  1RQ0 A;  4DR6 E;  4LF5 E;  2RS6 A;  2YT4 A;  1N33 E;  4DR3 E;  4DUZ E;  1N32 E;  4B3M E;  4NXN E;  4M30 A;  2UXB E;  1HR0 E;  2LUQ A;  4LF9 E;  4DKK A;  2L33 A;  2MDR A;  3ADG A;  2UUC E;  2KHX A;  2NUE A;  3HTX A;  4GKK E;  4DR5 E;  1T4L B;  1N36 E;  3OTO E;  2JY9 A;  4X65 E;  1HNX E;  2LTR A;  4LF7 E;  4LF8 E;  4JI2 E;  3VYX A;  4NXM E;  2EZ6 A;  5LMU E;  2NUG A;  4LFB E;  5CFF E;  2VQE E;  4JV5 E;  2L3J A;  4DUY E;  2B3T B;  1DI2 A;  1X49 A;  1J26 A;  2DIX A;  4YY3 E;  4KHP E;  3P1X A;  4M2Z A;  1IBM E;  2UXC E;  2RTX A;  1EKZ A;  3C4B A;  4GKJ E;  4DV7 E;  1XMO E;  1T4O A;  4LF4 E;  2DMY A;  1ZBT A;  2E5L E;  3LLH A;  1XNQ E;  1X48 A;  4AQY E;  4DR4 E;  2UXD E;  4DV2 E;  1T4N A;  2RSM A;  4X64 E;  2UU9 E;  2LRS A;  4JI8 E;  4DR1 E;  4DV0 E;  4JI0 E;  1STU A;  1QU6 A;  1WHN A;  4JI1 E;  2ZM6 E;  1IBK E;  2L2N A;  4DV3 E;  2VQF E;  4WYQ B;  5IWA E;  1UHZ A;  4LFA E;  1RC7 A;  4X8W A;  2NUF A;  4B3S E;  1IBL E;  4JYA E;  3VYY A;  3T1Y E;  4DR7 E;  1HNW E;  2NA2 A;  1I94 E;  1YYW A;  1FJG E;  5LMN E; 
#chains in the Genus database with same CATH topology
 3EPL A;  2ELY A;  2EL5 A;  2DSY A;  2GHF A;  4BMJ A;  1PDA A;  2RQL A;  2EPO A;  4DV5 E;  1A1L A;  4DV6 E;  3IWD A;  2UUB E;  2EMG A;  1UIL A;  3ADI A;  2N3H A;  2EMW A;  2HC5 A;  1A1K A;  2EQ1 A;  2KON A;  5A2Q C;  5LL6 R;  4M9V C;  3HPZ A;  4B3R E;  1WRJ A;  4R2E A;  4OOG C;  5A6J A;  3MSW A;  2G7H A;  1YPN A;  2EOI A;  2YTN A;  4X9J A;  1A1I A;  1TF3 A;  2B9D A;  5BR8 E;  2L2K B;  2JR1 A;  3THO B;  2EM3 A;  1X5W A;  3BF2 A;  1UN6 B;  2MDG A;  4OX9 E;  2DLQ A;  5KL5 A;  3ADL A;  4DV1 E;  1YYO A;  2EOS A;  1GQE A;  5LLQ A;  2H36 X;  4O24 A;  2EN3 A;  4DR6 E;  4RHB B;  2RS6 A;  1ZU1 A;  1N33 E;  5KL6 A;  2EPK X;  3DF6 A;  3EQ1 A;  4B3M E;  4NXN E;  2EM6 A;  1IQO A;  1A1G A;  3HTX A;  2NUE A;  2KHX A;  4F9C B;  1TF6 A;  1T4L B;  4F2J C;  2FTX B;  4F9A B;  3OTO E;  1HNX E;  4LF7 E;  4NXM E;  2YU8 A;  4ZYE A;  3KWR A;  2WBS A;  4R2D A;  2L6M A;  2VQE E;  2EM5 A;  2HJJ A;  2CTD A;  2B3T B;  1PJQ A;  3J81 C;  3H09 A;  1X49 A;  2ENC A;  4YY3 E;  2EMY A;  3P1X A;  4HEI A;  1X3C A;  5AE1 A;  3MHH C;  2NAB A;  3BGH A;  4L8N A;  4DV7 E;  1KJK A;  2DMY A;  2WBU A;  3LLH A;  2EMK A;  2V89 A;  3F6G A;  2RSM A;  2DMI A;  2LRS A;  2YZT A;  4JI0 E;  2LO3 A;  4NHR A;  1YUI A;  4F54 A;  2EJ4 A;  2YTF A;  2M1S A;  2VQF E;  2R76 A;  3C6K A;  4I8O A;  5T6J A;  1IBL E;  4JYA E;  1BBG A;  2M4I A;  4Q35 B;  2Q8U A;  4F9B B;  3T1Y E;  4R03 A;  1Z1B A;  2NA2 A;  1I94 E;  2EOX A;  1FJG E;  5LMN E;  3MHS C;  4LF6 E;  2V88 A;  4JI5 E;  2MKD A;  4BS9 A;  4RH8 A;  2LMZ A;  3HXL A;  2LT7 A;  1ZAA C;  3VHT B;  4JI3 E;  1JK1 A;  3FIG A;  4K0K E;  5AC4 A;  3TQM A;  2BB8 A;  1YFH A;  1YZ9 A;  3UK3 C;  1EH8 A;  4WXC A;  2YTE A;  1X47 A;  2YWQ A;  1DQ3 A;  2ENA A;  2LJU A;  2LTS A;  1N3G A;  2HGH A;  1FKA E;  1ZR9 A;  2WZO A;  1G2D C;  1PKP A;  2LVH A;  1SR9 A;  4O43 A;  2EE8 A;  2DLK A;  1TN9 A;  2DRP A;  4LF5 E;  1N32 E;  2EMC A;  2EOZ A;  3LML A;  4M30 A;  5IT9 C;  2EM0 A;  1HR0 E;  1YSA C;  4DKK A;  2UUC E;  2EL6 A;  4GKK E;  3EPH A;  5DNY A;  4X65 E;  2LTR A;  2V85 A;  4M0V A;  2EZ6 A;  3KZY A;  2YTQ A;  2NUG A;  5CFF E;  4JV5 E;  1ZBQ A;  2L3J A;  4DUY E;  1NEI A;  2YTJ A;  2DIX A;  4KHP E;  2YTP A;  3VK6 A;  4M2Z A;  1IQS A;  2E72 A;  2EM8 A;  2EOE A;  2EM9 A;  2EN1 A;  5AE2 A;  3EPJ A;  2EN6 A;  1T4O A;  2E5L E;  1ZBT A;  2UXD E;  5AE3 A;  4KWY A;  1X48 A;  2EN2 A;  1PJS A;  4R2P A;  1XNQ E;  4DV2 E;  2ADR A;  4X64 E;  1F2I G;  2EPX A;  4BC9 A;  2KOU A;  4MLV A;  3QG5 C;  2K7I A;  4WSP A;  1X6E A;  3L00 A;  1WHN A;  4DMI A;  2ZM6 E;  2JXP A;  2CSH A;  2ODR C;  4LU9 A;  4WYQ B;  5IWA E;  2EP3 A;  4X8W A;  2EM4 A;  2ELZ A;  1B69 A;  3DJW A;  2EML A;  5IXM B;  2JOB A;  2JP9 A;  1GZ6 A;  1A1H A;  4R2R A;  2EN4 A;  3K6Q A;  2JVA A;  2LE2 A;  1N34 E;  1SFE A;  4R2A A;  2BBG A;  5A6A A;  5AAS A;  2EQ0 A;  1RMD A;  2M7Q A;  4X66 E;  4O4K A;  4YHH E;  4WFT A;  3EPK A;  1EH6 A;  2N3G A;  2VF1 A;  3ADJ A;  1UBD C;  4LTY A;  5F3W A;  3J7Y p;  2EMA A;  4ZYH A;  4DV4 E;  2V87 A;  4DR2 E;  2V8Q B;  2EPM X;  2LUP B;  1YUJ A;  2B7T A;  4IJD A;  2F4V E;  3C6M A;  3HQ1 A;  5ADZ A;  2IHR 1;  3HPS A;  3BBG A;  1YYK A;  3J7A G;  3JTZ A;  1XMQ E;  1WHQ A;  4BCA A;  2B7V A;  2R1F A;  1RQ0 A;  4ZYG A;  2EM7 A;  2YT4 A;  2RSI A;  1X6H A;  2UXB E;  1LLM C;  2EM2 A;  2LUQ A;  4LF9 E;  2L33 A;  3ADG A;  1N36 E;  2JY9 A;  2EPR A;  3IWB A;  4F6M A;  2EOQ A;  4JI2 E;  2EOF A;  3VYX A;  2A25 A;  2EOR A;  4LFB E;  4BHB A;  2WCC 3;  2F8B A;  4O5G A;  4ZYD A;  1J26 A;  2L8T A;  4WPY A;  2D9H A;  2YRH A;  2EWL A;  2RTX A;  5KL7 A;  4KZS A;  1P47 A;  1EKZ A;  4WSG A;  4LF4 E;  4AQY E;  2EMB A;  3THN A;  2UU9 E;  2EOJ A;  2YU5 A;  4JI8 E;  2DGC A;  4DR1 E;  5A6B D;  3AV0 A;  2MC5 A;  1QU6 A;  2EOY A;  3JAM C;  2CT1 A;  2MC6 A;  2YSO A;  4JI1 E;  2LCE A;  4DV3 E;  2EN8 A;  2MKN A;  2YPN A;  1UHZ A;  2RPC A;  1RC7 A;  2LV2 A;  2NUF A;  4B3S E;  2N8X A;  3IWC A;  4P78 A;  4BBY A;  2EPC A;  2EPU A;  3RMP A;  4DR7 E;  1HNW E;  4N4R B;  4NZV A;  2DB2 A;  2YTD A;  4F6N A;  1L4S A;  1XNR E;  2EN7 A;  2CPN A;  3T1H E;  2UUA E;  1HNZ E;  2L92 A;  4JI6 E;  4JI4 E;  3F6H A;  3KZZ A;  4BHC A;  4IS1 C;  1AAY A;  4R2C A;  1BBO A;  2L2M A;  1GTK A;  2EPN A;  2EMF A;  4R2S A;  2EMX A;  4JI7 E;  5A6K A;  2EMZ A;  5FLX C;  4LFC E;  2ENH A;  4HTG A;  2LBS B;  2HHH E;  2JOX A;  2L3C A;  1J5E E;  2YRM A;  3C4T A;  2LJH A;  1WJP A;  1DGC A;  2YTI A;  5AC5 A;  4L5N C;  2RS7 A;  4P7D A;  2YTG A;  2FGG A;  2YRK A;  5KL4 A;  4TUI A;  1T38 A;  1O0W A;  4TUG A;  2V83 A;  2GLI A;  4X62 E;  4B3T E;  3ECR A;  2WBT A;  3OML A;  2JYA A;  5TSE A;  1A1F A;  2YSP A;  4DR3 E;  4DUZ E;  3BID A;  1MEY C;  2I9I A;  2MDR A;  2JPA A;  4DR5 E;  2EL4 A;  2FV4 B;  2EQ3 A;  4R2Q A;  2YTO A;  4LF8 E;  4GEQ B;  2V86 A;  2EPZ A;  1IMU A;  2J7J A;  5LMU E;  1WXR A;  2EOH A;  5A69 A;  2EOO A;  1DI2 A;  1PJT A;  1AH5 A;  2K4V A;  3ZOQ B;  4MLQ A;  1BB8 A;  1IBM E;  2UXC E;  1X6F A;  5IV8 B;  2I13 A;  4J8Z A;  3C4B A;  1JK2 A;  4GKJ E;  1KYQ A;  4WX9 A;  1XMO E;  4DR4 E;  5KL3 A;  2EMH A;  1T4N A;  4WXD A;  4GZN C;  1A1J A;  3M99 B;  2EOM A;  1G2F C;  2ODR D;  4BC7 A;  4FK5 C;  2VE7 C;  4DV0 E;  1STU A;  3AUZ A;  1EH7 A;  1IBK E;  2EMI A;  2L2N A;  5A6B A;  2M9A A;  5KL2 A;  4LFA E;  2E1M A;  1NCS A;  2EPA A;  2GPI A;  1QNT A;  3J80 C;  4R8O A;  2JWO A;  4Q28 A;  1MGT A;  2EPP A;  1T39 A;  2EPL X;  3VYY A;  2VRD A;  3JU0 A;  2PRT A;  1YYW A; 
#chains in the Genus database with same CATH homology
 4BMJ A;  2DSY A;  2DB2 A;  4DV5 E;  3K6Q A;  4DV6 E;  3IWD A;  2UUB E;  2JVA A;  2LE2 A;  1UIL A;  1N34 E;  1XNR E;  2CPN A;  4LF6 E;  2N3H A;  3ADI A;  3T1H E;  2V88 A;  2UUA E;  2KON A;  5A2Q C;  5LL6 R;  1HNZ E;  2L92 A;  3HPZ A;  4JI5 E;  4JI6 E;  4B3R E;  4OOG C;  5AAS A;  4BS9 A;  3MSW A;  2LMZ A;  2G7H A;  4JI4 E;  3F6H A;  3HXL A;  2M7Q A;  4X66 E;  4JI3 E;  2L2M A;  3FIG A;  4YHH E;  2B9D A;  4WFT A;  4K0K E;  2N3G A;  2VF1 A;  5BR8 E;  4JI7 E;  2L2K B;  5FLX C;  2JR1 A;  3ADJ A;  4LFC E;  2LBS B;  4LTY A;  5F3W A;  2HHH E;  3J7Y p;  2JOX A;  2L3C A;  1YZ9 A;  1X47 A;  1DQ3 A;  4DV4 E;  1J5E E;  2V87 A;  4DR2 E;  4OX9 E;  2LTS A;  3C4T A;  2LJH A;  2V8Q B;  3ADL A;  2LUP B;  2B7T A;  2F4V E;  5ADZ A;  3HQ1 A;  2IHR 1;  2RS7 A;  4L5N C;  4P7D A;  3HPS A;  4DV1 E;  2WZO A;  1YYO A;  1FKA E;  2FGG A;  4TUI A;  1GQE A;  1YYK A;  1O0W A;  4TUG A;  3J7A G;  3JTZ A;  2V83 A;  1XMQ E;  1WHQ A;  1PKP A;  2H36 X;  4BCA A;  2B7V A;  1SR9 A;  4X62 E;  4B3T E;  1RQ0 A;  4DR6 E;  3OML A;  4LF5 E;  2RS6 A;  2YT4 A;  1N33 E;  4DR3 E;  4DUZ E;  1N32 E;  3DF6 A;  3LML A;  4B3M E;  4NXN E;  4M30 A;  5IT9 C;  2UXB E;  1HR0 E;  2LUQ A;  4LF9 E;  2L33 A;  3ADG A;  2MDR A;  4DKK A;  2UUC E;  2KHX A;  4F9C B;  2NUE A;  3HTX A;  4DR5 E;  1T4L B;  4GKK E;  2FTX B;  4F9A B;  1N36 E;  3OTO E;  2JY9 A;  5DNY A;  2FV4 B;  3IWB A;  4X65 E;  1HNX E;  2LTR A;  4LF7 E;  4LF8 E;  4JI2 E;  2V85 A;  4GEQ B;  3VYX A;  2V86 A;  4NXM E;  4M0V A;  2EZ6 A;  3KWR A;  5LMU E;  1WXR A;  2NUG A;  4LFB E;  5CFF E;  2L6M A;  2VQE E;  1ZBQ A;  4JV5 E;  2L3J A;  2F8B A;  2B3T B;  4DUY E;  1DI2 A;  3J81 C;  3H09 A;  1X49 A;  1J26 A;  2DIX A;  2K4V A;  4YY3 E;  4KHP E;  2L8T A;  3P1X A;  4WPY A;  3ZOQ B;  3VK6 A;  4M2Z A;  4DR4 E;  5AE1 A;  1IBM E;  2EWL A;  2RTX A;  2UXC E;  4KZS A;  1EKZ A;  4J8Z A;  3C4B A;  5AE2 A;  4L8N A;  4GKJ E;  4DV7 E;  1XMO E;  1T4O A;  4LF4 E;  2DMY A;  1ZBT A;  2E5L E;  3LLH A;  5AE3 A;  1X48 A;  4AQY E;  2V89 A;  1XNQ E;  2UXD E;  4DV2 E;  1T4N A;  3F6G A;  2RSM A;  4X64 E;  2UU9 E;  2ODR D;  2LRS A;  4JI8 E;  2YZT A;  4BC7 A;  2KOU A;  4BC9 A;  4DR1 E;  2VE7 C;  3AV0 A;  4DV0 E;  4JI0 E;  1STU A;  4WSP A;  2MC5 A;  3AUZ A;  1QU6 A;  3JAM C;  2MC6 A;  1WHN A;  4DMI A;  4JI1 E;  4F54 A;  2ZM6 E;  1IBK E;  2L2N A;  4DV3 E;  2ODR C;  4LU9 A;  2M1S A;  2VQF E;  4WYQ B;  5IWA E;  1UHZ A;  4LFA E;  1RC7 A;  2E1M A;  4X8W A;  2NUF A;  4B3S E;  4I8O A;  3J80 C;  5T6J A;  4R8O A;  3IWC A;  2JWO A;  4Q28 A;  1IBL E;  4P78 A;  4BBY A;  4JYA E;  3VYY A;  2M4I A;  3DJW A;  3JU0 A;  4F9B B;  3RMP A;  3T1Y E;  2JOB A;  4R03 A;  4DR7 E;  1HNW E;  1GZ6 A;  2NA2 A;  1I94 E;  1YYW A;  1FJG E;  5LMN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...