1X6HA

Solution structures of the c2h2 type zinc finger domain of human transcriptional repressor ctcf
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional repressor CTCF
publication title Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF
rcsb
source organism Homo sapiens
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6hA00
2EM6A 2RSIA 5KL6A 2M9AA 2I13A 1DGCA 2LV2A 2YU8A 2YRKA 2EMGA 2EMHA 1A1IA 4R2DA 1BBOA 2EM2A 2EOEA 2CTDA 2EMCA 2EOXA 1X6HA 2YTNA 1A1LA 2EOQA 1BB8A 2EMKA 2EPPA 1YSAC 2EOFA 2DRPA 4R2PA 1Z1BA 2EMFA 2ADRA 2EQ3A 2YTEA 2EMXA 2DMIA 2EOJA 2YTOA 2BB8A 1UBDC 3EPJA 2EN1A 1ZR9A 2RPCA 2YU5A 2YTFA 2ELYA 1ZAAC 2DLQA 1NCSA 2EPXA 4F2JC 2EL6A 4IJDA 1MEYC 1YUIA 2EN7A 1JK2A 5KL7A 2EN8A 3EPHA 2EM7A 2EM3A 2EN2A 2EPRA 5KL4A 2EOMA 2EPZA 1A1GA 2EMBA 2LVHA 1B69A 1X5WA 1TF3A 2EM0A 2WBSA 4R2SA 1X6EA 3M99B 3MHSC 2EQ1A 2EMAA 1A1FA 2EP3A 1G2DC 2EPUA 1X3CA 2EM9A 2ENCA 1AAYA 2ENAA 2EMIA 4IS1C 2D9HA 2ENHA 1JK1A 2EN4A 2MDGA 1X6FA 4GZNC 1A1KA 2GLIA 2A25A 2EM5A 2EMZA 2EORA 2WCC3 1YUJA 2WBTA 2EJ4A 2J7JA 2CT1A 2JPAA 2R1FA 1F2IG 2YTJA 2YTQA 2EM8A 5KL2A 4R2AA 1P47A 1ZU1A 2EQ0A 1TF6A 4R2QA 2DLKA 2YTIA 2YRHA 2YSPA 3MHHC 4F6NA 2YSOA 5KL5A 2YTDA 4WSGA 5KL3A 2GHFA 2EOOA 1G2FC 2PRTA 1WJPA 2DGCA 4M9VC 4R2RA 2VRDA 1UN6B 2EE8A 2EN3A 2YRMA 1LLMC 2JP9A 2EN6A 2WBUA 3UK3C 2LO3A 3EPKA 2EMLA 2EOHA 2MKNA 4F6MA 4R2EA 2EPAA 4R2CA 2E72A 2YTGA 2EL4A 2EM4A 1A1JA 2EPCA 2LT7A 1RMDA 2EMWA 2YTPA 2NABA 2ELZA 2EMYA 2EOZA 3VHTB 2EOYA 2EL5A 2LCEA 2EOSA 4FK5C 2HGHA 1KJKA 3EPLA 1A1HA 1TN9A 4X9JA 2MKDA 2CSHA 2EOIA
chains in the Genus database with same CATH superfamily
2RSIA 2MDRA 2FGGA 2M1SA 2ODRD 2UUCE 4BS9A 5ADZA 5A69A 4Q28A 3HTXA 1SFEA 2LTSA 5F3WA 2LUPB 2EOEA 4LF5E 1T4NA 2CTDA 1IQSA 2EOXA 1X6HA 1A1LA 2G7HA 4WSPA 4JI3E 3AV0A 4JI2E 1XMOE 1Z1BA 1YYWA 2EQ3A 2YTEA 2EOJA 2YPNA 2VF1A 4N4RB 2UU9E 2N3GA 4NHRA 4AQYE 4JI0E 1J26A 4F2JC 2EPXA 1YUIA 1JK2A 2V89A 2EN2A 3L00A 3RMPA 4O24A 2V83A 1X5WA 5CFFE 4WXCA 3M99B 4NXNE 3HPSA 2EP3A 2EPUA 2EM9A 3JAMC 2UUAE 5FLXC 2EMIA 3DF6A 1XNRE 2ENHA 3T1YE 4R03A 2JYAA 1ZBQA 2A25A 2F4VE 3C6KA 1HNXE 2HC5A 2ZM6E 3LMLA 2H36X 1YUJA 4ZYGA 4KZSA 2EJ4A 4DV0E 3QG5C 2JPAA 3BBGA 4DR4E 1ZU1A 1TF6A 4R2QA 2DLKA 2YRHA 2YSPA 3MHHC 5KL3A 2YTDA 2BBGA 4WSGA 2M4IA 3IWCA 4WXDA 4BMJA 1WJPA 5AC4A 2YWQA 2V86A 2YRMA 4RH8A 2WBUA 2LUQA 2LO3A 3FIGA 2DMYA 2E72A 2V88A 1YZ9A 2JVAA 4OX9E 2ELZA 2EL5A 2LCEA 2EPMX 4X64E 1L4SA 2EOSA 2RQLA 4X9JA 4LF4E 2LJUA 5A6KA 4DV5E 2YU8A 2UUBE 2EMHA 2LE2A 5DNYA 1A1IA 2EWLA 1BBOA 2EM2A 1N36E 4P7DA 5IWAE 2V8QB 1WRJA 2LBSB 2Q8UA 5A6BA 4LFAE 4DR2E 2EOFA 1IQOA 2EPLX 5IXMB 4ZYHA 2DMIA 2EZ6A 1UBDC 3EPJA 1FKAE 4DR6E 2YU5A 4DR7E 2WZOA 2ELYA 1ZAAC 1NCSA 5LMNE 3JTZA 1ZBTA 5KL7A 4B3RE 4K0KE 2EPRA 5LL6R 1A1GA 2EMBA 1PJTA 3OTOE 3OMLA 4HTGA 1T4OA 1MGTA 3KZZA 2EM0A 4GKJE 5TSEA 1X6EA 3AUZA 4LFCE 2EMAA 2EPNA 2LTRA 1X3CA 2ENCA 1WHQA 3ECRA 4IS1C 2D9HA 5AE2A 2DIXA 2FTXB 1QNTA 1X6FA 3IWBA 4J8ZA 2B3TB 5T6JA 2GLIA 2EM5A 4DR5E 1N32E 2YZTA 1IBLE 2NUEA 3ADLA 2J7JA 2CT1A 4BC9A 2EM8A 4LU9A 5KL2A 4WFTA 2FV4B 2L33A 2YTIA 3BIDA 2YSOA 2LRSA 2RSMA 4WX9A 4LTYA 1DI2A 2GHFA 2MC6A 1WXRA 1G2FC 5A6BD 2L6MA 2B7VA 2PRTA 4JV5E 1N34E 4R2RA 2EN3A 1RC7A 4BCAA 2JR1A 4HEIA 2L3CA 4DV7E 2EMLA 2EOHA 2RS6A 2VE7C 1STUA 4F6MA 1GZ6A 3JU0A 2EPAA 1IBKE 2YTGA 2EL4A 2LT7A 1RMDA 2RS7A 3J7Yp 4GEQB 4F9BB 2EMYA 2YT4A 5AASA 4TUIA 4X8WA 1A1HA 1TN9A 2L2KB 2I9IA 5AE1A 2CSHA 2EM6A 3EQ1A 3F6GA 5KL6A 1XMQE 2N3HA 2DSYA 2E1MA 2LV2A 3MSWA 1DGCA 3J7AG 2YRKA 2NUFA 1SR9A 3VYYA 4R2DA 3F6HA 4YHHE 4ZYDA 4YY3E 4DR1E 2F8BA 4M30A 1BB8A 2L92A 4NXME 2B9DA 1WHNA 4BHBA 2EPPA 5AE3A 1YSAC 2DRPA 1KYQA 3BF2A 1YPNA 2N8XA 4R2PA 2M7QA 2ADRA 4BBYA 1X47A 2EPKX 2JXPA 2YTOA 2BB8A 1I94E 4F9AB 2RPCA 1ZR9A 4L8NA 1N3GA 4DV3E 2DLQA 4B3TE 4GKKE 2EL6A 2CPNA 2EN7A 4OOGC 3EPHA 2UXCE 1EKZA 4DV4E 2JOBA 2EM3A 5A2QC 2EPZA 4P78A 1B69A 3HQ1A 1GTKA 2ODRC 2IHR1 2WBSA 1AH5A 4O43A 4JI4E 4R2SA 4LF8E 3P1XA 4NZVA 1EH6A 2VQFE 3VK6A 2V87A 4DKKA 2LJHA 1HNZE 2K4VA 2EN4A 4BHCA 3J81C 2MDGA 2KHXA 1A1KA 5A6JA 1HR0E 3VYXA 2L3JA 1J5EE 2EMZA 2EORA 2JWOA 3H09A 2WBTA 3TQMA 2R1FA 1BBGA 4B3SE 2YTQA 4R2AA 4B3ME 4F6NA 5KL5A 4X66E 2RTXA 2E5LE 2DGCA 1UN6B 2VRDA 2MC5A 2JP9A 2EN6A 4DUYE 4KWYA 3UK3C 3EPKA 4I8OA 4O4KA 4WPYA 4R2EA 1DQ3A 3DJWA 2EMWA 2YTPA 4M2ZA 2JOXA 2NABA 4F9CB 1QU6A 4X65E 4KHPE 2EOYA 1IMUA 4FK5C 2HGHA 1KJKA 3EPLA 1FJGE 4JI1E 5LMUE 4DV1E 2M9AA 3HXLA 4RHBB 2I13A 4BC7A 1T39A 3ADJA 3K6QA 2EMGA 4X62E 4F54A 4LF7E 2KOUA 2JY9A 4MLQA 1UILA 4MLVA 1X48A 2GPIA 1N33E 1T38A 3HPZA 5BR8E 2EMCA 2YTNA 2EOQA 3THNA 1XNQE 2K7IA 4ZYEA 2EMKA 2HHHE 1EH7A 4JI5E 2EMFA 4JI6E 4R8OA 3THOB 2EMXA 1O0WA 5AC5A 2EN1A 4Q35B 2L2NA 1YYKA 2YTFA 1MEYC 4DV6E 4IJDA 4L5NC 2EN8A 2LMZA 2EM7A 2R76A 2EPOA 2NA2A 5KL4A 2EOMA 4DMIA 4DV2E 2LVHA 5LLQA 1TF3A 1X49A 5IT9C 3MHSC 1UHZA 1IBME 4WYQB 2EQ1A 5A6AA 2DB2A 1A1FA 1G2DC 1AAYA 1NEIA 2KONA 2ENAA 3C4TA 4DR3E 1T4LB 3ADGA 1JK1A 1RQ0A 2L2MA 2V85A 4GZNC 1PJSA 3IWDA 5IV8B 3T1HE 3ZOQB 3KZYA 2WCC3 4DUZE 4JI8E 4LFBE 3BGHA 3C6MA 3KWRA 3ADIA 1F2IG 2YTJA 2L8TA 1GQEA 1P47A 4TUGA 4JYAE 1YYOA 2EQ0A 1PJQA 2EOOA 4O5GA 4M9VC 2EE8A 4LF9E 1LLMC 4M0VA 2HJJA 2UXDE 1EH8A 2NUGA 1HNWE 2VQEE 2MKNA 1YFHA 4JI7E 1PDAA 4R2CA 1A1JA 1PKPA 2EM4A 2EPCA 3J80C 2EOZA 3VHTB 2UXBE 3C4BA 2B7TA 4LF6E 3LLHA 2MKDA 2EOIA
chains in the Genus database with same CATH topology
2EM6A 2RSIA 5KL6A 2M9AA 2I13A 1DGCA 2LV2A 2YU8A 2YRKA 2EMGA 2EMHA 1A1IA 4R2DA 1BBOA 2EM2A 2EOEA 2CTDA 2EMCA 2EOXA 1X6HA 2YTNA 1A1LA 2EOQA 1BB8A 2EMKA 2EPPA 1YSAC 2EOFA 2DRPA 4R2PA 1Z1BA 2EMFA 2ADRA 2EQ3A 2YTEA 2EMXA 2DMIA 2EOJA 2YTOA 2BB8A 1UBDC 3EPJA 2EN1A 1ZR9A 2RPCA 2YU5A 2YTFA 2ELYA 1ZAAC 2DLQA 1NCSA 2EPXA 4F2JC 2EL6A 4IJDA 1MEYC 1YUIA 2EN7A 1JK2A 5KL7A 2EN8A 3EPHA 2EM7A 2EM3A 2EN2A 2EPRA 5KL4A 2EOMA 2EPZA 1A1GA 2EMBA 2LVHA 1B69A 1X5WA 1TF3A 2EM0A 2WBSA 4R2SA 1X6EA 3M99B 3MHSC 2EQ1A 2EMAA 1A1FA 2EP3A 1G2DC 2EPUA 1X3CA 2EM9A 2ENCA 1AAYA 2ENAA 2EMIA 4IS1C 2D9HA 2ENHA 1JK1A 2EN4A 2MDGA 1X6FA 4GZNC 1A1KA 2GLIA 2A25A 2EM5A 2EMZA 2EORA 2WCC3 1YUJA 2WBTA 2EJ4A 2J7JA 2CT1A 2JPAA 2R1FA 1F2IG 2YTJA 2YTQA 2EM8A 5KL2A 4R2AA 1P47A 1ZU1A 2EQ0A 1TF6A 4R2QA 2DLKA 2YTIA 2YRHA 2YSPA 3MHHC 4F6NA 2YSOA 5KL5A 2YTDA 4WSGA 5KL3A 2GHFA 2EOOA 1G2FC 2PRTA 1WJPA 2DGCA 4M9VC 4R2RA 2VRDA 1UN6B 2EE8A 2EN3A 2YRMA 1LLMC 2JP9A 2EN6A 2WBUA 3UK3C 2LO3A 3EPKA 2EMLA 2EOHA 2MKNA 4F6MA 4R2EA 2EPAA 4R2CA 2E72A 2YTGA 2EL4A 2EM4A 1A1JA 2EPCA 2LT7A 1RMDA 2EMWA 2YTPA 2NABA 2ELZA 2EMYA 2EOZA 3VHTB 2EOYA 2EL5A 2LCEA 2EOSA 4FK5C 2HGHA 1KJKA 3EPLA 1A1HA 1TN9A 4X9JA 2MKDA 2CSHA 2EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM6 A;  2RSI A;  5KL6 A;  2M9A A;  2I13 A;  1DGC A;  2LV2 A;  2YU8 A;  2YRK A;  2EMG A;  2EMH A;  1A1I A;  4R2D A;  1BBO A;  2EM2 A;  2EOE A;  2CTD A;  2EMC A;  2EOX A;  1X6H A;  2YTN A;  1A1L A;  2EOQ A;  1BB8 A;  2EMK A;  2EPP A;  1YSA C;  2EOF A;  2DRP A;  4R2P A;  1Z1B A;  2EMF A;  2ADR A;  2EQ3 A;  2YTE A;  2EMX A;  2DMI A;  2EOJ A;  2YTO A;  2BB8 A;  1UBD C;  3EPJ A;  2EN1 A;  1ZR9 A;  2RPC A;  2YU5 A;  2YTF A;  2ELY A;  1ZAA C;  2DLQ A;  1NCS A;  2EPX A;  4F2J C;  2EL6 A;  4IJD A;  1MEY C;  1YUI A;  2EN7 A;  1JK2 A;  5KL7 A;  2EN8 A;  3EPH A;  2EM7 A;  2EM3 A;  2EN2 A;  2EPR A;  5KL4 A;  2EOM A;  2EPZ A;  1A1G A;  2EMB A;  2LVH A;  1B69 A;  1X5W A;  1TF3 A;  2EM0 A;  2WBS A;  4R2S A;  1X6E A;  3M99 B;  3MHS C;  2EQ1 A;  2EMA A;  1A1F A;  2EP3 A;  1G2D C;  2EPU A;  1X3C A;  2EM9 A;  2ENC A;  1AAY A;  2ENA A;  2EMI A;  4IS1 C;  2D9H A;  2ENH A;  1JK1 A;  2EN4 A;  2MDG A;  1X6F A;  4GZN C;  1A1K A;  2GLI A;  2A25 A;  2EM5 A;  2EMZ A;  2EOR A;  2WCC 3;  1YUJ A;  2WBT A;  2EJ4 A;  2J7J A;  2CT1 A;  2JPA A;  2R1F A;  1F2I G;  2YTJ A;  2YTQ A;  2EM8 A;  5KL2 A;  4R2A A;  1P47 A;  1ZU1 A;  2EQ0 A;  1TF6 A;  4R2Q A;  2DLK A;  2YTI A;  2YRH A;  2YSP A;  3MHH C;  4F6N A;  2YSO A;  5KL5 A;  2YTD A;  4WSG A;  5KL3 A;  2GHF A;  2EOO A;  1G2F C;  2PRT A;  1WJP A;  2DGC A;  4M9V C;  4R2R A;  2VRD A;  1UN6 B;  2EE8 A;  2EN3 A;  2YRM A;  1LLM C;  2JP9 A;  2EN6 A;  2WBU A;  3UK3 C;  2LO3 A;  3EPK A;  2EML A;  2EOH A;  2MKN A;  4F6M A;  4R2E A;  2EPA A;  4R2C A;  2E72 A;  2YTG A;  2EL4 A;  2EM4 A;  1A1J A;  2EPC A;  2LT7 A;  1RMD A;  2EMW A;  2YTP A;  2NAB A;  2ELZ A;  2EMY A;  2EOZ A;  3VHT B;  2EOY A;  2EL5 A;  2LCE A;  2EOS A;  4FK5 C;  2HGH A;  1KJK A;  3EPL A;  1A1H A;  1TN9 A;  4X9J A;  2MKD A;  2CSH A;  2EOI A; 
#chains in the Genus database with same CATH topology
 2RSI A;  2MDR A;  2FGG A;  2M1S A;  2ODR D;  2UUC E;  4BS9 A;  5ADZ A;  5A69 A;  4Q28 A;  3HTX A;  1SFE A;  2LTS A;  5F3W A;  2LUP B;  2EOE A;  4LF5 E;  1T4N A;  2CTD A;  1IQS A;  2EOX A;  1X6H A;  1A1L A;  2G7H A;  4WSP A;  4JI3 E;  3AV0 A;  4JI2 E;  1XMO E;  1Z1B A;  1YYW A;  2EQ3 A;  2YTE A;  2EOJ A;  2YPN A;  2VF1 A;  4N4R B;  2UU9 E;  2N3G A;  4NHR A;  4AQY E;  4JI0 E;  1J26 A;  4F2J C;  2EPX A;  1YUI A;  1JK2 A;  2V89 A;  2EN2 A;  3L00 A;  3RMP A;  4O24 A;  2V83 A;  1X5W A;  5CFF E;  4WXC A;  3M99 B;  4NXN E;  3HPS A;  2EP3 A;  2EPU A;  2EM9 A;  3JAM C;  2UUA E;  5FLX C;  2EMI A;  3DF6 A;  1XNR E;  2ENH A;  3T1Y E;  4R03 A;  2JYA A;  1ZBQ A;  2A25 A;  2F4V E;  3C6K A;  1HNX E;  2HC5 A;  2ZM6 E;  3LML A;  2H36 X;  1YUJ A;  4ZYG A;  4KZS A;  2EJ4 A;  4DV0 E;  3QG5 C;  2JPA A;  3BBG A;  4DR4 E;  1ZU1 A;  1TF6 A;  4R2Q A;  2DLK A;  2YRH A;  2YSP A;  3MHH C;  5KL3 A;  2YTD A;  2BBG A;  4WSG A;  2M4I A;  3IWC A;  4WXD A;  4BMJ A;  1WJP A;  5AC4 A;  2YWQ A;  2V86 A;  2YRM A;  4RH8 A;  2WBU A;  2LUQ A;  2LO3 A;  3FIG A;  2DMY A;  2E72 A;  2V88 A;  1YZ9 A;  2JVA A;  4OX9 E;  2ELZ A;  2EL5 A;  2LCE A;  2EPM X;  4X64 E;  1L4S A;  2EOS A;  2RQL A;  4X9J A;  4LF4 E;  2LJU A;  5A6K A;  4DV5 E;  2YU8 A;  2UUB E;  2EMH A;  2LE2 A;  5DNY A;  1A1I A;  2EWL A;  1BBO A;  2EM2 A;  1N36 E;  4P7D A;  5IWA E;  2V8Q B;  1WRJ A;  2LBS B;  2Q8U A;  5A6B A;  4LFA E;  4DR2 E;  2EOF A;  1IQO A;  2EPL X;  5IXM B;  4ZYH A;  2DMI A;  2EZ6 A;  1UBD C;  3EPJ A;  1FKA E;  4DR6 E;  2YU5 A;  4DR7 E;  2WZO A;  2ELY A;  1ZAA C;  1NCS A;  5LMN E;  3JTZ A;  1ZBT A;  5KL7 A;  4B3R E;  4K0K E;  2EPR A;  5LL6 R;  1A1G A;  2EMB A;  1PJT A;  3OTO E;  3OML A;  4HTG A;  1T4O A;  1MGT A;  3KZZ A;  2EM0 A;  4GKJ E;  5TSE A;  1X6E A;  3AUZ A;  4LFC E;  2EMA A;  2EPN A;  2LTR A;  1X3C A;  2ENC A;  1WHQ A;  3ECR A;  4IS1 C;  2D9H A;  5AE2 A;  2DIX A;  2FTX B;  1QNT A;  1X6F A;  3IWB A;  4J8Z A;  2B3T B;  5T6J A;  2GLI A;  2EM5 A;  4DR5 E;  1N32 E;  2YZT A;  1IBL E;  2NUE A;  3ADL A;  2J7J A;  2CT1 A;  4BC9 A;  2EM8 A;  4LU9 A;  5KL2 A;  4WFT A;  2FV4 B;  2L33 A;  2YTI A;  3BID A;  2YSO A;  2LRS A;  2RSM A;  4WX9 A;  4LTY A;  1DI2 A;  2GHF A;  2MC6 A;  1WXR A;  1G2F C;  5A6B D;  2L6M A;  2B7V A;  2PRT A;  4JV5 E;  1N34 E;  4R2R A;  2EN3 A;  1RC7 A;  4BCA A;  2JR1 A;  4HEI A;  2L3C A;  4DV7 E;  2EML A;  2EOH A;  2RS6 A;  2VE7 C;  1STU A;  4F6M A;  1GZ6 A;  3JU0 A;  2EPA A;  1IBK E;  2YTG A;  2EL4 A;  2LT7 A;  1RMD A;  2RS7 A;  3J7Y p;  4GEQ B;  4F9B B;  2EMY A;  2YT4 A;  5AAS A;  4TUI A;  4X8W A;  1A1H A;  1TN9 A;  2L2K B;  2I9I A;  5AE1 A;  2CSH A;  2EM6 A;  3EQ1 A;  3F6G A;  5KL6 A;  1XMQ E;  2N3H A;  2DSY A;  2E1M A;  2LV2 A;  3MSW A;  1DGC A;  3J7A G;  2YRK A;  2NUF A;  1SR9 A;  3VYY A;  4R2D A;  3F6H A;  4YHH E;  4ZYD A;  4YY3 E;  4DR1 E;  2F8B A;  4M30 A;  1BB8 A;  2L92 A;  4NXM E;  2B9D A;  1WHN A;  4BHB A;  2EPP A;  5AE3 A;  1YSA C;  2DRP A;  1KYQ A;  3BF2 A;  1YPN A;  2N8X A;  4R2P A;  2M7Q A;  2ADR A;  4BBY A;  1X47 A;  2EPK X;  2JXP A;  2YTO A;  2BB8 A;  1I94 E;  4F9A B;  2RPC A;  1ZR9 A;  4L8N A;  1N3G A;  4DV3 E;  2DLQ A;  4B3T E;  4GKK E;  2EL6 A;  2CPN A;  2EN7 A;  4OOG C;  3EPH A;  2UXC E;  1EKZ A;  4DV4 E;  2JOB A;  2EM3 A;  5A2Q C;  2EPZ A;  4P78 A;  1B69 A;  3HQ1 A;  1GTK A;  2ODR C;  2IHR 1;  2WBS A;  1AH5 A;  4O43 A;  4JI4 E;  4R2S A;  4LF8 E;  3P1X A;  4NZV A;  1EH6 A;  2VQF E;  3VK6 A;  2V87 A;  4DKK A;  2LJH A;  1HNZ E;  2K4V A;  2EN4 A;  4BHC A;  3J81 C;  2MDG A;  2KHX A;  1A1K A;  5A6J A;  1HR0 E;  3VYX A;  2L3J A;  1J5E E;  2EMZ A;  2EOR A;  2JWO A;  3H09 A;  2WBT A;  3TQM A;  2R1F A;  1BBG A;  4B3S E;  2YTQ A;  4R2A A;  4B3M E;  4F6N A;  5KL5 A;  4X66 E;  2RTX A;  2E5L E;  2DGC A;  1UN6 B;  2VRD A;  2MC5 A;  2JP9 A;  2EN6 A;  4DUY E;  4KWY A;  3UK3 C;  3EPK A;  4I8O A;  4O4K A;  4WPY A;  4R2E A;  1DQ3 A;  3DJW A;  2EMW A;  2YTP A;  4M2Z A;  2JOX A;  2NAB A;  4F9C B;  1QU6 A;  4X65 E;  4KHP E;  2EOY A;  1IMU A;  4FK5 C;  2HGH A;  1KJK A;  3EPL A;  1FJG E;  4JI1 E;  5LMU E;  4DV1 E;  2M9A A;  3HXL A;  4RHB B;  2I13 A;  4BC7 A;  1T39 A;  3ADJ A;  3K6Q A;  2EMG A;  4X62 E;  4F54 A;  4LF7 E;  2KOU A;  2JY9 A;  4MLQ A;  1UIL A;  4MLV A;  1X48 A;  2GPI A;  1N33 E;  1T38 A;  3HPZ A;  5BR8 E;  2EMC A;  2YTN A;  2EOQ A;  3THN A;  1XNQ E;  2K7I A;  4ZYE A;  2EMK A;  2HHH E;  1EH7 A;  4JI5 E;  2EMF A;  4JI6 E;  4R8O A;  3THO B;  2EMX A;  1O0W A;  5AC5 A;  2EN1 A;  4Q35 B;  2L2N A;  1YYK A;  2YTF A;  1MEY C;  4DV6 E;  4IJD A;  4L5N C;  2EN8 A;  2LMZ A;  2EM7 A;  2R76 A;  2EPO A;  2NA2 A;  5KL4 A;  2EOM A;  4DMI A;  4DV2 E;  2LVH A;  5LLQ A;  1TF3 A;  1X49 A;  5IT9 C;  3MHS C;  1UHZ A;  1IBM E;  4WYQ B;  2EQ1 A;  5A6A A;  2DB2 A;  1A1F A;  1G2D C;  1AAY A;  1NEI A;  2KON A;  2ENA A;  3C4T A;  4DR3 E;  1T4L B;  3ADG A;  1JK1 A;  1RQ0 A;  2L2M A;  2V85 A;  4GZN C;  1PJS A;  3IWD A;  5IV8 B;  3T1H E;  3ZOQ B;  3KZY A;  2WCC 3;  4DUZ E;  4JI8 E;  4LFB E;  3BGH A;  3C6M A;  3KWR A;  3ADI A;  1F2I G;  2YTJ A;  2L8T A;  1GQE A;  1P47 A;  4TUG A;  4JYA E;  1YYO A;  2EQ0 A;  1PJQ A;  2EOO A;  4O5G A;  4M9V C;  2EE8 A;  4LF9 E;  1LLM C;  4M0V A;  2HJJ A;  2UXD E;  1EH8 A;  2NUG A;  1HNW E;  2VQE E;  2MKN A;  1YFH A;  4JI7 E;  1PDA A;  4R2C A;  1A1J A;  1PKP A;  2EM4 A;  2EPC A;  3J80 C;  2EOZ A;  3VHT B;  2UXB E;  3C4B A;  2B7T A;  4LF6 E;  3LLH A;  2MKD A;  2EOI A; 
#chains in the Genus database with same CATH homology
 2EM6 A;  2RSI A;  5KL6 A;  2M9A A;  2I13 A;  1DGC A;  2LV2 A;  2YU8 A;  2YRK A;  2EMG A;  2EMH A;  1A1I A;  4R2D A;  1BBO A;  2EM2 A;  2EOE A;  2CTD A;  2EMC A;  2EOX A;  1X6H A;  2YTN A;  1A1L A;  2EOQ A;  1BB8 A;  2EMK A;  2EPP A;  1YSA C;  2EOF A;  2DRP A;  4R2P A;  1Z1B A;  2EMF A;  2ADR A;  2EQ3 A;  2YTE A;  2EMX A;  2DMI A;  2EOJ A;  2YTO A;  2BB8 A;  1UBD C;  3EPJ A;  2EN1 A;  1ZR9 A;  2RPC A;  2YU5 A;  2YTF A;  2ELY A;  1ZAA C;  2DLQ A;  1NCS A;  2EPX A;  4F2J C;  2EL6 A;  4IJD A;  1MEY C;  1YUI A;  2EN7 A;  1JK2 A;  5KL7 A;  2EN8 A;  3EPH A;  2EM7 A;  2EM3 A;  2EN2 A;  2EPR A;  5KL4 A;  2EOM A;  2EPZ A;  1A1G A;  2EMB A;  2LVH A;  1B69 A;  1X5W A;  1TF3 A;  2EM0 A;  2WBS A;  4R2S A;  1X6E A;  3M99 B;  3MHS C;  2EQ1 A;  2EMA A;  1A1F A;  2EP3 A;  1G2D C;  2EPU A;  1X3C A;  2EM9 A;  2ENC A;  1AAY A;  2ENA A;  2EMI A;  4IS1 C;  2D9H A;  2ENH A;  1JK1 A;  2EN4 A;  2MDG A;  1X6F A;  4GZN C;  1A1K A;  2GLI A;  2A25 A;  2EM5 A;  2EMZ A;  2EOR A;  2WCC 3;  1YUJ A;  2WBT A;  2EJ4 A;  2J7J A;  2CT1 A;  2JPA A;  2R1F A;  1F2I G;  2YTJ A;  2YTQ A;  2EM8 A;  5KL2 A;  4R2A A;  1P47 A;  1ZU1 A;  2EQ0 A;  1TF6 A;  4R2Q A;  2DLK A;  2YTI A;  2YRH A;  2YSP A;  3MHH C;  4F6N A;  2YSO A;  5KL5 A;  2YTD A;  4WSG A;  5KL3 A;  2GHF A;  2EOO A;  1G2F C;  2PRT A;  1WJP A;  2DGC A;  4M9V C;  4R2R A;  2VRD A;  1UN6 B;  2EE8 A;  2EN3 A;  2YRM A;  1LLM C;  2JP9 A;  2EN6 A;  2WBU A;  3UK3 C;  2LO3 A;  3EPK A;  2EML A;  2EOH A;  2MKN A;  4F6M A;  4R2E A;  2EPA A;  4R2C A;  2E72 A;  2YTG A;  2EL4 A;  2EM4 A;  1A1J A;  2EPC A;  2LT7 A;  1RMD A;  2EMW A;  2YTP A;  2NAB A;  2ELZ A;  2EMY A;  2EOZ A;  3VHT B;  2EOY A;  2EL5 A;  2LCE A;  2EOS A;  4FK5 C;  2HGH A;  1KJK A;  3EPL A;  1A1H A;  1TN9 A;  4X9J A;  2MKD A;  2CSH A;  2EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...