1X6HA

Solution structures of the c2h2 type zinc finger domain of human transcriptional repressor ctcf
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor CTCF
publication title Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x6hA00
2EMAA 2EPAA 2MKNA 2EOHA 1UBDC 2YU5A 2EJ4A 2WBSA 2BB8A 2EM9A 4WSGA 2EQ3A 4IS1C 2LV2A 4FK5C 2RPCA 3MHHC 2ENAA 2EOZA 2EOMA 1DGCA 2PRTA 3UK3C 2YSPA 2EN6A 4X9JA 2EE8A 1ZAAC 1A1KA 2EM4A 2YTFA 2EMLA 2LO3A 1TF3A 2MKDA 2EQ0A 2EPZA 2EMKA 1YUIA 2GLIA 1A1GA 1YUJA 2EMIA 4R2SA 2YTJA 2EMXA 5KL3A 1F2IG 2RSIA 2LT7A 2VRDA 2LVHA 1MEYC 2EPPA 2EMBA 4R2RA 1B69A 3EPHA 2EMYA 2EPXA 2ENHA 1X6EA 2MDGA 1P47A 1X3CA 2CTDA 4R2PA 2EOXA 3EPKA 5KL5A 1JK2A 2EMWA 1ZR9A 4R2AA 4R2DA 4F2JC 2EOQA 2YTEA 5KL6A 3VHTB 3M99B 1X6FA 2DGCA 2LCEA 5KL7A 4R2QA 2ADRA 1JK1A 2D9HA 1AAYA 4R2EA 2EM0A 3EPLA 1A1JA 2EMZA 2EOIA 2YTGA 2EPUA 2JP9A 2CT1A 4F6NA 5KL4A 1X5WA 2ENCA 1WJPA 1NCSA 2A25A 2EN8A 2EM2A 2EL4A 1A1FA 2NABA 2EN4A 2EM6A 2EN1A 2EN7A 1LLMC 2HGHA 1TF6A 2YTOA 2E72A 2I13A 1G2DC 2WCC3 1BBOA 2DRPA 2EMHA 1G2FC 2ELYA 4IJDA 4M9VC 1Z1BA 2EM8A 2YRKA 2J7JA 1BB8A 2EM5A 3EPJA 2EQ1A 2EOFA 1KJKA 2GHFA 2DLKA 2YTNA 2EMCA 2ELZA 2YU8A 4GZNC 5KL2A 2JPAA 2DMIA 4R2CA 2EOEA 1A1LA 1A1IA 2YRHA 1YSAC 2EMFA 2YTPA 2YTDA 4F6MA 1UN6B 2EMGA 2EPCA 3MHSC 2YTIA 1RMDA 2YTQA 2EOOA 2EM3A 2EOSA 2EP3A 1X6HA 2EN3A 2EOYA 2EPRA 1ZU1A 2EL5A 2DLQA 2EN2A 2CSHA 2EM7A 2EL6A 2R1FA 1TN9A 2M9AA 2EORA 2WBTA 2YRMA 2EOJA 1A1HA 2WBUA 2YSOA
chains in the Genus database with same CATH superfamily
1KYQA 3TQMA 4WYQB 2BB8A 1EH8A 2EM9A 2ODRD 2UUAE 5FLXC 4TUIA 4FK5C 1PKPA 1T4OA 2ENAA 2EOMA 3UK3C 2YSPA 3HPSA 2EE8A 4Q35B 2DSYA 2KOUA 2YWQA 2L6MA 1QU6A 2L92A 3KZZA 4BS9A 1RC7A 4B3TE 2JY9A 2EM4A 4RHBB 5BR8E 1IBLE 2EMLA 4DV4E 2NUGA 5IT9C 1PJTA 2EQ0A 1YUIA 4JYAE 2GLIA 1X48A 2JR1A 5IV8B 2VQFE 2KONA 2RSIA 5DNYA 2UXBE 2NUEA 1XNRE 1N32E 2LVHA 2N3GA 2EPPA 2EMBA 3EPHA 3LMLA 2EPXA 1UHZA 3J81C 4WX9A 1MGTA 1YYWA 2HHHE 4JI7E 1T39A 4DR1E 3IWDA 4ZYGA 5KL6A 1RQ0A 4JI3E 1X6FA 1X49A 1JK1A 3EPLA 2EM0A 2UU9E 1PJSA 1NEIA 3BF2A 3FIGA 2CT1A 4F6NA 5KL4A 4ZYDA 4M30A 2A25A 1NCSA 4J8ZA 2EM2A 2RS7A 3BBGA 5T6JA 4NZVA 1SFEA 2EM6A 2EN1A 1LLMC 1XNQE 4HTGA 4JI8E 2EMHA 3HTXA 1Z1BA 2E5LE 1BB8A 2L33A 2EM5A 2EQ1A 2V83A 2GHFA 4X8WA 2EMCA 3OMLA 2YU8A 5KL2A 4R2CA 1T38A 2YTDA 3RMPA 2F4VE 2ODRC 2YTIA 4GEQB 2EOOA 4MLQA 5IWAE 4DV1E 4DV6E 4Q28A 4JI5E 2F8BA 2DIXA 2LUPB 4ZYHA 2RSMA 5AASA 2M9AA 4DKKA 2EORA 1A1HA 2V87A 3DJWA 2EPAA 1STUA 2MKNA 1ZBTA 2JXPA 2L3JA 1ZBQA 2EJ4A 1EKZA 2WBSA 1O0WA 5LMUE 4IS1C 2EZ6A 4JI4E 5AC4A 3HPZA 3T1YE 1HNXE 3MHHC 3ECRA 4NHRA 1T4LB 2LJUA 4GKKE 1ZAAC 4DR2E 4WFTA 1IBKE 4YY3E 1DQ3A 2LRSA 3K6QA 4DV2E 2EPLX 4DV5E 4L5NC 1QNTA 2B3TB 4AQYE 2MKDA 2B7VA 2EMKA 3HXLA 1YYOA 2YTJA 2EMXA 2N3HA 4DR3E 1I94E 5LL6R 4DR5E 4JI2E 2EMYA 1X6EA 1P47A 2EOXA 5LLQA 5KL5A 3T1HE 4R2AA 2M4IA 3ADGA 4R2DA 4LFBE 4JV5E 5A6AA 2YTEA 1N33E 2JYAA 1J26A 4X66E 4DV7E 5A6JA 5AC5A 2RS6A 5KL7A 3LLHA 2V89A 4BC7A 3J7AG 2LMZA 2D9HA 1YZ9A 2LBSB 1X47A 2Q8UA 2RQLA 3ADJA 4O24A 4LU9A 2YTGA 4K0KE 2V86A 2B7TA 2JP9A 4JI0E 2M1SA 4NXNE 3J80C 2UUCE 2K4VA 3F6GA 2NABA 4X65E 3VK6A 1BBOA 4WPYA 1XMOE 4WXDA 2DRPA 4DV0E 1G2FC 1T4NA 3BGHA 4BCAA 4X64E 2FGGA 2YT4A 1HNWE 3C6KA 4P78A 3EPJA 2GPIA 1HNZE 3IWBA 3JU0A 1BBGA 2DLKA 2UXDE 2DMIA 2NA2A 4F9BB 5A6BA 3ADIA 1A1LA 2YRHA 2EMFA 2YTPA 2I9IA 4DUYE 3JTZA 4BHCA 3MHSC 2UUBE 2LTSA 2EM3A 2EP3A 1YPNA 4NXME 1AH5A 4MLVA 1X6HA 5A69A 3VYXA 3IWCA 1EH6A 4LF8E 1J5EE 2R1FA 1TN9A 5IXMB 1SR9A 2LUQA 2V8QB 2YRMA 2WBUA 2YSOA 2KHXA 4DR7E 2EOHA 4N4RB 4ZYEA 1N34E 5AE3A 4LF4E 3EQ1A 4WSGA 4O5GA 2V85A 4KZSA 4WXCA 2VQEE 4LTYA 2B9DA 4LF7E 2L2KB 2RPCA 2EOZA 3C4TA 1XMQE 1WHNA 2PRTA 2EN6A 2JVAA 4X9JA 2LJHA 2EPMX 1IQOA 1GZ6A 2L3CA 3F6HA 2LO3A 1TF3A 3OTOE 3AV0A 2EPZA 2E1MA 1IQSA 1YUJA 2EMIA 5KL3A 2LT7A 2VRDA 4O4KA 1MEYC 3C6MA 1WRJA 4P7DA 1B69A 4F54A 2ENHA 2JOXA 2MDGA 4DV3E 1X3CA 2CTDA 4R2PA 3EPKA 2MDRA 2EMWA 2IHR1 4LFAE 2BBGA 4BHBA 4DR4E 4F2JC 2EOQA 2JOBA 3VHTB 1FKAE 3M99B 3HQ1A 4R2QA 2ADRA 2EWLA 2FTXB 4R2EA 1A1JA 3JAMC 2EMZA 2EOIA 4DMIA 4GKJE 2EPUA 1GQEA 1WHQA 4LFCE 2ZM6E 2ENCA 1UILA 4M0VA 2RTXA 2EL4A 1A1FA 2EPNA 2EN4A 2EN7A 1IBME 2HGHA 2K7IA 2E72A 2EPKX 2M7QA 2VE7C 2ELYA 4M9VC 2VF1A 2G7HA 2EM8A 2YZTA 4X62E 1EH7A 1KJKA 2ELZA 4LF9E 1FJGE 3P1XA 2JPAA 1A1IA 5A6BD 2EMGA 2EPCA 2CPNA 1RMDA 2YTQA 4F9AB 3ZOQB 2MC6A 2EOSA 4KHPE 3H09A 1YFHA 2EOYA 3C4BA 1ZU1A 2JWOA 2EN2A 2DMYA 2EM7A 2EL6A 4JI6E 1N36E 4TUGA 4HEIA 1PDAA 4BBYA 1JK2A 3DF6A 2EMAA 1UBDC 1L4SA 2YU5A 2MC5A 4KWYA 2EQ3A 2LE2A 2LV2A 4M2ZA 3BIDA 4BMJA 1DGCA 2NUFA 3QG5C 3KWRA 1A1KA 2YTFA 2N8XA 1IMUA 2L8TA 1A1GA 1GTKA 5F3WA 4OX9E 4R2SA 1F2IG 4L8NA 4R2RA 2HJJA 5LMNE 5AE1A 5AE2A 4RH8A 4LF6E 1PJQA 1ZR9A 4DUZE 2DGCA 5CFFE 2LCEA 2WZOA 1AAYA 1N3GA 2UXCE 2DB2A 5TSEA 3J7Yp 1DI2A 2H36X 2L2MA 3L00A 1X5WA 1WJPA 2EN8A 4B3ME 4YHHE 3VYYA 2EPOA 1TF6A 2YTOA 4I8OA 2I13A 2HC5A 1G2DC 2WCC3 1YYKA 4OOGC 4IJDA 2FV4B 4R03A 5A2QC 5A6KA 2YRKA 2YPNA 4B3SE 2J7JA 1HR0E 4LF5E 2LTRA 2EOFA 4JI1E 4F9CB 2YTNA 3THOB 4GZNC 4O43A 2EOEA 3ADLA 4BC9A 1YSAC 4F6MA 1UN6B 3THNA 4WSPA 4B3RE 2V88A 3AUZA 1WXRA 3KZYA 2EN3A 2EPRA 2EL5A 2DLQA 2CSHA 2L2NA 3MSWA 4DR6E 2WBTA 4R8OA 2EOJA 5ADZA 2R76A
chains in the Genus database with same CATH topology
2EMAA 2EPAA 2MKNA 2EOHA 1UBDC 2YU5A 2EJ4A 2WBSA 2BB8A 2EM9A 4WSGA 2EQ3A 4IS1C 2LV2A 4FK5C 2RPCA 3MHHC 2ENAA 2EOZA 2EOMA 1DGCA 2PRTA 3UK3C 2YSPA 2EN6A 4X9JA 2EE8A 1ZAAC 1A1KA 2EM4A 2YTFA 2EMLA 2LO3A 1TF3A 2MKDA 2EQ0A 2EPZA 2EMKA 1YUIA 2GLIA 1A1GA 1YUJA 2EMIA 4R2SA 2YTJA 2EMXA 5KL3A 1F2IG 2RSIA 2LT7A 2VRDA 2LVHA 1MEYC 2EPPA 2EMBA 4R2RA 1B69A 3EPHA 2EMYA 2EPXA 2ENHA 1X6EA 2MDGA 1P47A 1X3CA 2CTDA 4R2PA 2EOXA 3EPKA 5KL5A 1JK2A 2EMWA 1ZR9A 4R2AA 4R2DA 4F2JC 2EOQA 2YTEA 5KL6A 3VHTB 3M99B 1X6FA 2DGCA 2LCEA 5KL7A 4R2QA 2ADRA 1JK1A 2D9HA 1AAYA 4R2EA 2EM0A 3EPLA 1A1JA 2EMZA 2EOIA 2YTGA 2EPUA 2JP9A 2CT1A 4F6NA 5KL4A 1X5WA 2ENCA 1WJPA 1NCSA 2A25A 2EN8A 2EM2A 2EL4A 1A1FA 2NABA 2EN4A 2EM6A 2EN1A 2EN7A 1LLMC 2HGHA 1TF6A 2YTOA 2E72A 2I13A 1G2DC 2WCC3 1BBOA 2DRPA 2EMHA 1G2FC 2ELYA 4IJDA 4M9VC 1Z1BA 2EM8A 2YRKA 2J7JA 1BB8A 2EM5A 3EPJA 2EQ1A 2EOFA 1KJKA 2GHFA 2DLKA 2YTNA 2EMCA 2ELZA 2YU8A 4GZNC 5KL2A 2JPAA 2DMIA 4R2CA 2EOEA 1A1LA 1A1IA 2YRHA 1YSAC 2EMFA 2YTPA 2YTDA 4F6MA 1UN6B 2EMGA 2EPCA 3MHSC 2YTIA 1RMDA 2YTQA 2EOOA 2EM3A 2EOSA 2EP3A 1X6HA 2EN3A 2EOYA 2EPRA 1ZU1A 2EL5A 2DLQA 2EN2A 2CSHA 2EM7A 2EL6A 2R1FA 1TN9A 2M9AA 2EORA 2WBTA 2YRMA 2EOJA 1A1HA 2WBUA 2YSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMA A;  2EPA A;  2MKN A;  2EOH A;  1UBD C;  2YU5 A;  2EJ4 A;  2WBS A;  2BB8 A;  2EM9 A;  4WSG A;  2EQ3 A;  4IS1 C;  2LV2 A;  4FK5 C;  2RPC A;  3MHH C;  2ENA A;  2EOZ A;  2EOM A;  1DGC A;  2PRT A;  3UK3 C;  2YSP A;  2EN6 A;  4X9J A;  2EE8 A;  1ZAA C;  1A1K A;  2EM4 A;  2YTF A;  2EML A;  2LO3 A;  1TF3 A;  2MKD A;  2EQ0 A;  2EPZ A;  2EMK A;  1YUI A;  2GLI A;  1A1G A;  1YUJ A;  2EMI A;  4R2S A;  2YTJ A;  2EMX A;  5KL3 A;  1F2I G;  2RSI A;  2LT7 A;  2VRD A;  2LVH A;  1MEY C;  2EPP A;  2EMB A;  4R2R A;  1B69 A;  3EPH A;  2EMY A;  2EPX A;  2ENH A;  1X6E A;  2MDG A;  1P47 A;  1X3C A;  2CTD A;  4R2P A;  2EOX A;  3EPK A;  5KL5 A;  1JK2 A;  2EMW A;  1ZR9 A;  4R2A A;  4R2D A;  4F2J C;  2EOQ A;  2YTE A;  5KL6 A;  3VHT B;  3M99 B;  1X6F A;  2DGC A;  2LCE A;  5KL7 A;  4R2Q A;  2ADR A;  1JK1 A;  2D9H A;  1AAY A;  4R2E A;  2EM0 A;  3EPL A;  1A1J A;  2EMZ A;  2EOI A;  2YTG A;  2EPU A;  2JP9 A;  2CT1 A;  4F6N A;  5KL4 A;  1X5W A;  2ENC A;  1WJP A;  1NCS A;  2A25 A;  2EN8 A;  2EM2 A;  2EL4 A;  1A1F A;  2NAB A;  2EN4 A;  2EM6 A;  2EN1 A;  2EN7 A;  1LLM C;  2HGH A;  1TF6 A;  2YTO A;  2E72 A;  2I13 A;  1G2D C;  2WCC 3;  1BBO A;  2DRP A;  2EMH A;  1G2F C;  2ELY A;  4IJD A;  4M9V C;  1Z1B A;  2EM8 A;  2YRK A;  2J7J A;  1BB8 A;  2EM5 A;  3EPJ A;  2EQ1 A;  2EOF A;  1KJK A;  2GHF A;  2DLK A;  2YTN A;  2EMC A;  2ELZ A;  2YU8 A;  4GZN C;  5KL2 A;  2JPA A;  2DMI A;  4R2C A;  2EOE A;  1A1L A;  1A1I A;  2YRH A;  1YSA C;  2EMF A;  2YTP A;  2YTD A;  4F6M A;  1UN6 B;  2EMG A;  2EPC A;  3MHS C;  2YTI A;  1RMD A;  2YTQ A;  2EOO A;  2EM3 A;  2EOS A;  2EP3 A;  1X6H A;  2EN3 A;  2EOY A;  2EPR A;  1ZU1 A;  2EL5 A;  2DLQ A;  2EN2 A;  2CSH A;  2EM7 A;  2EL6 A;  2R1F A;  1TN9 A;  2M9A A;  2EOR A;  2WBT A;  2YRM A;  2EOJ A;  1A1H A;  2WBU A;  2YSO A; 
#chains in the Genus database with same CATH topology
 1KYQ A;  3TQM A;  4WYQ B;  2BB8 A;  1EH8 A;  2EM9 A;  2ODR D;  2UUA E;  5FLX C;  4TUI A;  4FK5 C;  1PKP A;  1T4O A;  2ENA A;  2EOM A;  3UK3 C;  2YSP A;  3HPS A;  2EE8 A;  4Q35 B;  2DSY A;  2KOU A;  2YWQ A;  2L6M A;  1QU6 A;  2L92 A;  3KZZ A;  4BS9 A;  1RC7 A;  4B3T E;  2JY9 A;  2EM4 A;  4RHB B;  5BR8 E;  1IBL E;  2EML A;  4DV4 E;  2NUG A;  5IT9 C;  1PJT A;  2EQ0 A;  1YUI A;  4JYA E;  2GLI A;  1X48 A;  2JR1 A;  5IV8 B;  2VQF E;  2KON A;  2RSI A;  5DNY A;  2UXB E;  2NUE A;  1XNR E;  1N32 E;  2LVH A;  2N3G A;  2EPP A;  2EMB A;  3EPH A;  3LML A;  2EPX A;  1UHZ A;  3J81 C;  4WX9 A;  1MGT A;  1YYW A;  2HHH E;  4JI7 E;  1T39 A;  4DR1 E;  3IWD A;  4ZYG A;  5KL6 A;  1RQ0 A;  4JI3 E;  1X6F A;  1X49 A;  1JK1 A;  3EPL A;  2EM0 A;  2UU9 E;  1PJS A;  1NEI A;  3BF2 A;  3FIG A;  2CT1 A;  4F6N A;  5KL4 A;  4ZYD A;  4M30 A;  2A25 A;  1NCS A;  4J8Z A;  2EM2 A;  2RS7 A;  3BBG A;  5T6J A;  4NZV A;  1SFE A;  2EM6 A;  2EN1 A;  1LLM C;  1XNQ E;  4HTG A;  4JI8 E;  2EMH A;  3HTX A;  1Z1B A;  2E5L E;  1BB8 A;  2L33 A;  2EM5 A;  2EQ1 A;  2V83 A;  2GHF A;  4X8W A;  2EMC A;  3OML A;  2YU8 A;  5KL2 A;  4R2C A;  1T38 A;  2YTD A;  3RMP A;  2F4V E;  2ODR C;  2YTI A;  4GEQ B;  2EOO A;  4MLQ A;  5IWA E;  4DV1 E;  4DV6 E;  4Q28 A;  4JI5 E;  2F8B A;  2DIX A;  2LUP B;  4ZYH A;  2RSM A;  5AAS A;  2M9A A;  4DKK A;  2EOR A;  1A1H A;  2V87 A;  3DJW A;  2EPA A;  1STU A;  2MKN A;  1ZBT A;  2JXP A;  2L3J A;  1ZBQ A;  2EJ4 A;  1EKZ A;  2WBS A;  1O0W A;  5LMU E;  4IS1 C;  2EZ6 A;  4JI4 E;  5AC4 A;  3HPZ A;  3T1Y E;  1HNX E;  3MHH C;  3ECR A;  4NHR A;  1T4L B;  2LJU A;  4GKK E;  1ZAA C;  4DR2 E;  4WFT A;  1IBK E;  4YY3 E;  1DQ3 A;  2LRS A;  3K6Q A;  4DV2 E;  2EPL X;  4DV5 E;  4L5N C;  1QNT A;  2B3T B;  4AQY E;  2MKD A;  2B7V A;  2EMK A;  3HXL A;  1YYO A;  2YTJ A;  2EMX A;  2N3H A;  4DR3 E;  1I94 E;  5LL6 R;  4DR5 E;  4JI2 E;  2EMY A;  1X6E A;  1P47 A;  2EOX A;  5LLQ A;  5KL5 A;  3T1H E;  4R2A A;  2M4I A;  3ADG A;  4R2D A;  4LFB E;  4JV5 E;  5A6A A;  2YTE A;  1N33 E;  2JYA A;  1J26 A;  4X66 E;  4DV7 E;  5A6J A;  5AC5 A;  2RS6 A;  5KL7 A;  3LLH A;  2V89 A;  4BC7 A;  3J7A G;  2LMZ A;  2D9H A;  1YZ9 A;  2LBS B;  1X47 A;  2Q8U A;  2RQL A;  3ADJ A;  4O24 A;  4LU9 A;  2YTG A;  4K0K E;  2V86 A;  2B7T A;  2JP9 A;  4JI0 E;  2M1S A;  4NXN E;  3J80 C;  2UUC E;  2K4V A;  3F6G A;  2NAB A;  4X65 E;  3VK6 A;  1BBO A;  4WPY A;  1XMO E;  4WXD A;  2DRP A;  4DV0 E;  1G2F C;  1T4N A;  3BGH A;  4BCA A;  4X64 E;  2FGG A;  2YT4 A;  1HNW E;  3C6K A;  4P78 A;  3EPJ A;  2GPI A;  1HNZ E;  3IWB A;  3JU0 A;  1BBG A;  2DLK A;  2UXD E;  2DMI A;  2NA2 A;  4F9B B;  5A6B A;  3ADI A;  1A1L A;  2YRH A;  2EMF A;  2YTP A;  2I9I A;  4DUY E;  3JTZ A;  4BHC A;  3MHS C;  2UUB E;  2LTS A;  2EM3 A;  2EP3 A;  1YPN A;  4NXM E;  1AH5 A;  4MLV A;  1X6H A;  5A69 A;  3VYX A;  3IWC A;  1EH6 A;  4LF8 E;  1J5E E;  2R1F A;  1TN9 A;  5IXM B;  1SR9 A;  2LUQ A;  2V8Q B;  2YRM A;  2WBU A;  2YSO A;  2KHX A;  4DR7 E;  2EOH A;  4N4R B;  4ZYE A;  1N34 E;  5AE3 A;  4LF4 E;  3EQ1 A;  4WSG A;  4O5G A;  2V85 A;  4KZS A;  4WXC A;  2VQE E;  4LTY A;  2B9D A;  4LF7 E;  2L2K B;  2RPC A;  2EOZ A;  3C4T A;  1XMQ E;  1WHN A;  2PRT A;  2EN6 A;  2JVA A;  4X9J A;  2LJH A;  2EPM X;  1IQO A;  1GZ6 A;  2L3C A;  3F6H A;  2LO3 A;  1TF3 A;  3OTO E;  3AV0 A;  2EPZ A;  2E1M A;  1IQS A;  1YUJ A;  2EMI A;  5KL3 A;  2LT7 A;  2VRD A;  4O4K A;  1MEY C;  3C6M A;  1WRJ A;  4P7D A;  1B69 A;  4F54 A;  2ENH A;  2JOX A;  2MDG A;  4DV3 E;  1X3C A;  2CTD A;  4R2P A;  3EPK A;  2MDR A;  2EMW A;  2IHR 1;  4LFA E;  2BBG A;  4BHB A;  4DR4 E;  4F2J C;  2EOQ A;  2JOB A;  3VHT B;  1FKA E;  3M99 B;  3HQ1 A;  4R2Q A;  2ADR A;  2EWL A;  2FTX B;  4R2E A;  1A1J A;  3JAM C;  2EMZ A;  2EOI A;  4DMI A;  4GKJ E;  2EPU A;  1GQE A;  1WHQ A;  4LFC E;  2ZM6 E;  2ENC A;  1UIL A;  4M0V A;  2RTX A;  2EL4 A;  1A1F A;  2EPN A;  2EN4 A;  2EN7 A;  1IBM E;  2HGH A;  2K7I A;  2E72 A;  2EPK X;  2M7Q A;  2VE7 C;  2ELY A;  4M9V C;  2VF1 A;  2G7H A;  2EM8 A;  2YZT A;  4X62 E;  1EH7 A;  1KJK A;  2ELZ A;  4LF9 E;  1FJG E;  3P1X A;  2JPA A;  1A1I A;  5A6B D;  2EMG A;  2EPC A;  2CPN A;  1RMD A;  2YTQ A;  4F9A B;  3ZOQ B;  2MC6 A;  2EOS A;  4KHP E;  3H09 A;  1YFH A;  2EOY A;  3C4B A;  1ZU1 A;  2JWO A;  2EN2 A;  2DMY A;  2EM7 A;  2EL6 A;  4JI6 E;  1N36 E;  4TUG A;  4HEI A;  1PDA A;  4BBY A;  1JK2 A;  3DF6 A;  2EMA A;  1UBD C;  1L4S A;  2YU5 A;  2MC5 A;  4KWY A;  2EQ3 A;  2LE2 A;  2LV2 A;  4M2Z A;  3BID A;  4BMJ A;  1DGC A;  2NUF A;  3QG5 C;  3KWR A;  1A1K A;  2YTF A;  2N8X A;  1IMU A;  2L8T A;  1A1G A;  1GTK A;  5F3W A;  4OX9 E;  4R2S A;  1F2I G;  4L8N A;  4R2R A;  2HJJ A;  5LMN E;  5AE1 A;  5AE2 A;  4RH8 A;  4LF6 E;  1PJQ A;  1ZR9 A;  4DUZ E;  2DGC A;  5CFF E;  2LCE A;  2WZO A;  1AAY A;  1N3G A;  2UXC E;  2DB2 A;  5TSE A;  3J7Y p;  1DI2 A;  2H36 X;  2L2M A;  3L00 A;  1X5W A;  1WJP A;  2EN8 A;  4B3M E;  4YHH E;  3VYY A;  2EPO A;  1TF6 A;  2YTO A;  4I8O A;  2I13 A;  2HC5 A;  1G2D C;  2WCC 3;  1YYK A;  4OOG C;  4IJD A;  2FV4 B;  4R03 A;  5A2Q C;  5A6K A;  2YRK A;  2YPN A;  4B3S E;  2J7J A;  1HR0 E;  4LF5 E;  2LTR A;  2EOF A;  4JI1 E;  4F9C B;  2YTN A;  3THO B;  4GZN C;  4O43 A;  2EOE A;  3ADL A;  4BC9 A;  1YSA C;  4F6M A;  1UN6 B;  3THN A;  4WSP A;  4B3R E;  2V88 A;  3AUZ A;  1WXR A;  3KZY A;  2EN3 A;  2EPR A;  2EL5 A;  2DLQ A;  2CSH A;  2L2N A;  3MSW A;  4DR6 E;  2WBT A;  4R8O A;  2EOJ A;  5ADZ A;  2R76 A; 
#chains in the Genus database with same CATH homology
 2EMA A;  2EPA A;  2MKN A;  2EOH A;  1UBD C;  2YU5 A;  2EJ4 A;  2WBS A;  2BB8 A;  2EM9 A;  4WSG A;  2EQ3 A;  4IS1 C;  2LV2 A;  4FK5 C;  2RPC A;  3MHH C;  2ENA A;  2EOZ A;  2EOM A;  1DGC A;  2PRT A;  3UK3 C;  2YSP A;  2EN6 A;  4X9J A;  2EE8 A;  1ZAA C;  1A1K A;  2EM4 A;  2YTF A;  2EML A;  2LO3 A;  1TF3 A;  2MKD A;  2EQ0 A;  2EPZ A;  2EMK A;  1YUI A;  2GLI A;  1A1G A;  1YUJ A;  2EMI A;  4R2S A;  2YTJ A;  2EMX A;  5KL3 A;  1F2I G;  2RSI A;  2LT7 A;  2VRD A;  2LVH A;  1MEY C;  2EPP A;  2EMB A;  4R2R A;  1B69 A;  3EPH A;  2EMY A;  2EPX A;  2ENH A;  1X6E A;  2MDG A;  1P47 A;  1X3C A;  2CTD A;  4R2P A;  2EOX A;  3EPK A;  5KL5 A;  1JK2 A;  2EMW A;  1ZR9 A;  4R2A A;  4R2D A;  4F2J C;  2EOQ A;  2YTE A;  5KL6 A;  3VHT B;  3M99 B;  1X6F A;  2DGC A;  2LCE A;  5KL7 A;  4R2Q A;  2ADR A;  1JK1 A;  2D9H A;  1AAY A;  4R2E A;  2EM0 A;  3EPL A;  1A1J A;  2EMZ A;  2EOI A;  2YTG A;  2EPU A;  2JP9 A;  2CT1 A;  4F6N A;  5KL4 A;  1X5W A;  2ENC A;  1WJP A;  1NCS A;  2A25 A;  2EN8 A;  2EM2 A;  2EL4 A;  1A1F A;  2NAB A;  2EN4 A;  2EM6 A;  2EN1 A;  2EN7 A;  1LLM C;  2HGH A;  1TF6 A;  2YTO A;  2E72 A;  2I13 A;  1G2D C;  2WCC 3;  1BBO A;  2DRP A;  2EMH A;  1G2F C;  2ELY A;  4IJD A;  4M9V C;  1Z1B A;  2EM8 A;  2YRK A;  2J7J A;  1BB8 A;  2EM5 A;  3EPJ A;  2EQ1 A;  2EOF A;  1KJK A;  2GHF A;  2DLK A;  2YTN A;  2EMC A;  2ELZ A;  2YU8 A;  4GZN C;  5KL2 A;  2JPA A;  2DMI A;  4R2C A;  2EOE A;  1A1L A;  1A1I A;  2YRH A;  1YSA C;  2EMF A;  2YTP A;  2YTD A;  4F6M A;  1UN6 B;  2EMG A;  2EPC A;  3MHS C;  2YTI A;  1RMD A;  2YTQ A;  2EOO A;  2EM3 A;  2EOS A;  2EP3 A;  1X6H A;  2EN3 A;  2EOY A;  2EPR A;  1ZU1 A;  2EL5 A;  2DLQ A;  2EN2 A;  2CSH A;  2EM7 A;  2EL6 A;  2R1F A;  1TN9 A;  2M9A A;  2EOR A;  2WBT A;  2YRM A;  2EOJ A;  1A1H A;  2WBU A;  2YSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...