4N4RB

Structure basis of lipopolysaccharide biogenesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
151
structure length
151
Chain Sequence
CGWHLRSTTQVPASMKTMILDSGDPNGPLSRAVRNQLRLNNVNLLDKDTTRKDVPSLRLGTVTILQDTASVFQDGQTAEYQMVMTVNASVLIPGHDIYPISTKVYRSFFDNPQMALAKDNEQAMIVQEMYDKAAEQLIRKLTSVRAADIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for outer membrane lipopolysaccharide insertion.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
molecule keywords LPS-assembly protein LptD
total genus 29
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4n4rB00
4RHBB 4KWYA 4NHRA 3BF2A 5IXMB 4Q35B 2R76A 4N4RB 2JXPA 4RH8A 5IV8B 5TSEA 2N8XA
chains in the Genus database with same CATH superfamily
3C4TA 2LE2A 2L6MA 4LF5E 2UXBE 1QNTA 1J5EE 2L3CA 4X9JA 4R2SA 4GKKE 2RSMA 2UU9E 2YTIA 1KYQA 1EH7A 3QG5C 2DSYA 1X6FA 2YTNA 3ADIA 2EP3A 4R2AA 1NEIA 2EOEA 1YYKA 3HQ1A 1STUA 2JVAA 2ADRA 5AC4A 2H36X 1PJSA 1EH6A 2RPCA 1IBME 2EMBA 4KZSA 3DF6A 2ENAA 3IWCA 2LRSA 5KL7A 3HXLA 2MDRA 2HJJA 2YTQA 2ELYA 1EH8A 4X65E 3LMLA 5DNYA 3ADGA 3MHSC 4DUYE 2VQFE 2EPZA 4OX9E 1DI2A 4DR2E 2EN3A 2EN8A 2I13A 3BBGA 4O4KA 2R1FA 2EPLX 4LF6E 2YTOA 2EPXA 4YHHE 2EOXA 1N32E 4ZYEA 5A6AA 4LF4E 2EPNA 5A2QC 4WSGA 2EOYA 2F8BA 4DV3E 2DRPA 2HHHE 2ELZA 2EM7A 2VE7C 4WXDA 1A1LA 1JK1A 2EM8A 2N3GA 4X66E 1FKAE 2LVHA 2YSOA 2JR1A 4X64E 4MLQA 3JAMC 1P47A 2DLKA 5AE3A 3OMLA 3P1XA 5A6BD 5IT9C 1YPNA 4NXME 3F6HA 1YSAC 2EN1A 3IWBA 1A1JA 4L8NA 1DQ3A 1WJPA 1SR9A 4GEQB 1JK2A 2K7IA 2LTRA 4I8OA 2EM2A 2LJUA 4L5NC 4JV5E 3VK6A 4R2QA 1ZU1A 4RH8A 4DKKA 2GLIA 1XMQE 1HR0E 2MKNA 4X8WA 3EPLA 1ZR9A 4R2CA 1MEYC 3C6MA 4B3SE 1UN6B 5LMNE 1HNZE 4O24A 3LLHA 4BS9A 5FLXC 1FJGE 1J26A 1YFHA 4N4RB 2EORA 1AAYA 4R2EA 2VF1A 2B3TB 2WCC3 2V89A 2ENCA 3KWRA 2NUEA 1ZBTA 4WFTA 1B69A 4NXNE 2L2NA 1GQEA 1A1IA 1UHZA 3JU0A 2YU5A 2EM5A 4R2RA 3AV0A 2RQLA 2IHR1 4ZYHA 1SFEA 5ADZA 1XNRE 4HEIA 3THNA 2UXDE 2UXCE 2B9DA 4F54A 1WHQA 2EOOA 1GTKA 2EN4A 4Q28A 4JI1E 4M2ZA 2EMCA 4FK5C 1AH5A 1WXRA 1X6HA 2WBUA 2JXPA 2JWOA 2EMIA 2ODRD 2YU8A 2YZTA 3VHTB 5KL2A 2EM6A 3VYXA 3EPJA 2EQ1A 2EPRA 2M4IA 3THOB 3OTOE 5KL6A 2EOZA 4AQYE 1TF3A 2YRKA 2LCEA 2R76A 5IV8B 4WSPA 2E5LE 2JPAA 2CTDA 2EMGA 3BGHA 1RMDA 3H09A 1ZBQA 4LFBE 3T1YE 3ADLA 2EN2A 2EOIA 2EPKX 1TF6A 2EMWA 2YTFA 1XMOE 2HC5A 2LBSB 2CT1A 2EPOA 4LF7E 4DR5E 1DGCA 1RQ0A 1X6EA 2EOFA 1HNWE 2D9HA 2GHFA 3RMPA 1L4SA 2EMHA 4X62E 2G7HA 2VQEE 3J7AG 1WRJA 1IMUA 2VRDA 4WX9A 4DR4E 2MKDA 4Q35B 4R2DA 5A69A 4F9CB 2UUCE 1T38A 3M99B 3ADJA 2BBGA 2JOBA 2EJ4A 2EN7A 2V8QB 2LUPB 4JI3E 2DMYA 5T6JA 2CPNA 1F2IG 2M1SA 4DMIA 5AC5A 4P7DA 1GZ6A 3ECRA 2J7JA 2EN6A 4JI5E 2LMZA 4M30A 4JI7E 4O5GA 4YY3E 3J7Yp 4DR6E 4JYAE 2V87A 4TUGA 5AE1A 1IQOA 2YTDA 2EOHA 3HPSA 4BC7A 5BR8E 2DB2A 4P78A 2B7TA 3HTXA 2CSHA 2EMXA 2EPAA 1BBGA 4B3TE 4LFAE 4TUIA 2V88A 1X5WA 1BBOA 2M7QA 5CFFE 1RC7A 2UUAE 1KJKA 2E1MA 3IWDA 4DV6E 2EPPA 3JTZA 4B3ME 4DR7E 2ODRC 2YTGA 2RS7A 4LF8E 5LMUE 3DJWA 5AE2A 3VYYA 2RS6A 3EPKA 3BIDA 5A6KA 4LU9A 3C6KA 2NA2A 4DV0E 3UK3C 1X49A 2FGGA 1UILA 2LJHA 2NABA 5A6BA 4F9BB 4DR1E 1N34E 4DR3E 2YT4A 2BB8A 3BF2A 4F6MA 2EOQA 1YUJA 2KONA 1T4LB 1LLMC 1TN9A 3J80C 2B7VA 1BB8A 5KL4A 2M9AA 2DGCA 4BC9A 2RTXA 3K6QA 2F4VE 2KOUA 1PKPA 2ZM6E 3F6GA 2JOXA 4BHCA 2EWLA 4IS1C 2EMLA 2EQ0A 2I9IA 1O0WA 5KL5A 5KL3A 1T39A 2L33A 3KZYA 4BHBA 4LF9E 2GPIA 1PJQA 2YSPA 1Z1BA 1A1GA 3J81C 4R8OA 2HGHA 2EM3A 4DV7E 2E72A 4M0VA 2EL5A 4JI0E 4LFCE 2L2KB 5AASA 4HTGA 3T1HE 1ZAAC 2MDGA 4KWYA 4F6NA 4O43A 2DMIA 3KZZA 2EOJA 2YPNA 2JP9A 2YTPA 5IXMB 4WYQB 1PDAA 2DIXA 2EPMX 1YYOA 1A1FA 2YRMA 4DV2E 1WHNA 2FTXB 1HNXE 2NUGA 4JI8E 4F9AB 2EOMA 1PJTA 3C4BA 5IWAE 1UBDC 2EMFA 4GZNC 4M9VC 2L92A 1IBLE 2LT7A 2EL6A 4NHRA 2EMKA 2N3HA 4MLVA 2JY9A 2YRHA 3MHHC 2UUBE 4RHBB 4DV4E 1T4OA 2DLQA 4JI2E 2EE8A 1IBKE 1MGTA 1N3GA 2V86A 2EPUA 2FV4B 2A25A 2WBSA 2PRTA 4BMJA 3ZOQB 4F2JC 2EMAA 1G2FC 1NCSA 2YTEA 4WXCA 1X3CA 2LUQA 5F3WA 3EPHA 3FIGA 2LO3A 4KHPE 3L00A 2L3JA 2L8TA 2EM9A 4J8ZA 3MSWA 2K4VA 2EZ6A 4BCAA 1T4NA 4IJDA 3TQMA 4DV1E 5LLQA 4JI6E 2YWQA 1QU6A 4JI4E 2YTJA 3HPZA 3AUZA 2LTSA 2V83A 1N33E 1N36E 4DV5E 1XNQE 2EOSA 1EKZA 2EQ3A 1G2DC 1X47A 2NUFA 4LTYA 2WZOA 2JYAA 1YYWA 2EM0A 2ENHA 5LL6R 4GKJE 2RSIA 4BBYA 1X48A 5A6JA 1YZ9A 1YUIA 1IQSA 4WPYA 4ZYDA 4NZVA 1I94E 1A1KA 5TSEA 2N8XA 2Q8UA 4B3RE 2EMYA 2MC5A 4DUZE 2EPCA 2LV2A 4OOGC 2L2MA 4K0KE 4ZYGA 2MC6A 2KHXA 2EL4A 2WBTA 3EQ1A 2V85A 2EM4A 4R03A 4R2PA 1A1HA 2EMZA
chains in the Genus database with same CATH topology
4RHBB 4KWYA 4NHRA 3BF2A 5IXMB 4Q35B 2R76A 4N4RB 2JXPA 4RH8A 5IV8B 5TSEA 2N8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHB B;  4KWY A;  4NHR A;  3BF2 A;  5IXM B;  4Q35 B;  2R76 A;  4N4R B;  2JXP A;  4RH8 A;  5IV8 B;  5TSE A;  2N8X A; 
#chains in the Genus database with same CATH topology
 3C4T A;  2LE2 A;  2L6M A;  4LF5 E;  2UXB E;  1QNT A;  1J5E E;  2L3C A;  4X9J A;  4R2S A;  4GKK E;  2RSM A;  2UU9 E;  2YTI A;  1KYQ A;  1EH7 A;  3QG5 C;  2DSY A;  1X6F A;  2YTN A;  3ADI A;  2EP3 A;  4R2A A;  1NEI A;  2EOE A;  1YYK A;  3HQ1 A;  1STU A;  2JVA A;  2ADR A;  5AC4 A;  2H36 X;  1PJS A;  1EH6 A;  2RPC A;  1IBM E;  2EMB A;  4KZS A;  3DF6 A;  2ENA A;  3IWC A;  2LRS A;  5KL7 A;  3HXL A;  2MDR A;  2HJJ A;  2YTQ A;  2ELY A;  1EH8 A;  4X65 E;  3LML A;  5DNY A;  3ADG A;  3MHS C;  4DUY E;  2VQF E;  2EPZ A;  4OX9 E;  1DI2 A;  4DR2 E;  2EN3 A;  2EN8 A;  2I13 A;  3BBG A;  4O4K A;  2R1F A;  2EPL X;  4LF6 E;  2YTO A;  2EPX A;  4YHH E;  2EOX A;  1N32 E;  4ZYE A;  5A6A A;  4LF4 E;  2EPN A;  5A2Q C;  4WSG A;  2EOY A;  2F8B A;  4DV3 E;  2DRP A;  2HHH E;  2ELZ A;  2EM7 A;  2VE7 C;  4WXD A;  1A1L A;  1JK1 A;  2EM8 A;  2N3G A;  4X66 E;  1FKA E;  2LVH A;  2YSO A;  2JR1 A;  4X64 E;  4MLQ A;  3JAM C;  1P47 A;  2DLK A;  5AE3 A;  3OML A;  3P1X A;  5A6B D;  5IT9 C;  1YPN A;  4NXM E;  3F6H A;  1YSA C;  2EN1 A;  3IWB A;  1A1J A;  4L8N A;  1DQ3 A;  1WJP A;  1SR9 A;  4GEQ B;  1JK2 A;  2K7I A;  2LTR A;  4I8O A;  2EM2 A;  2LJU A;  4L5N C;  4JV5 E;  3VK6 A;  4R2Q A;  1ZU1 A;  4RH8 A;  4DKK A;  2GLI A;  1XMQ E;  1HR0 E;  2MKN A;  4X8W A;  3EPL A;  1ZR9 A;  4R2C A;  1MEY C;  3C6M A;  4B3S E;  1UN6 B;  5LMN E;  1HNZ E;  4O24 A;  3LLH A;  4BS9 A;  5FLX C;  1FJG E;  1J26 A;  1YFH A;  4N4R B;  2EOR A;  1AAY A;  4R2E A;  2VF1 A;  2B3T B;  2WCC 3;  2V89 A;  2ENC A;  3KWR A;  2NUE A;  1ZBT A;  4WFT A;  1B69 A;  4NXN E;  2L2N A;  1GQE A;  1A1I A;  1UHZ A;  3JU0 A;  2YU5 A;  2EM5 A;  4R2R A;  3AV0 A;  2RQL A;  2IHR 1;  4ZYH A;  1SFE A;  5ADZ A;  1XNR E;  4HEI A;  3THN A;  2UXD E;  2UXC E;  2B9D A;  4F54 A;  1WHQ A;  2EOO A;  1GTK A;  2EN4 A;  4Q28 A;  4JI1 E;  4M2Z A;  2EMC A;  4FK5 C;  1AH5 A;  1WXR A;  1X6H A;  2WBU A;  2JXP A;  2JWO A;  2EMI A;  2ODR D;  2YU8 A;  2YZT A;  3VHT B;  5KL2 A;  2EM6 A;  3VYX A;  3EPJ A;  2EQ1 A;  2EPR A;  2M4I A;  3THO B;  3OTO E;  5KL6 A;  2EOZ A;  4AQY E;  1TF3 A;  2YRK A;  2LCE A;  2R76 A;  5IV8 B;  4WSP A;  2E5L E;  2JPA A;  2CTD A;  2EMG A;  3BGH A;  1RMD A;  3H09 A;  1ZBQ A;  4LFB E;  3T1Y E;  3ADL A;  2EN2 A;  2EOI A;  2EPK X;  1TF6 A;  2EMW A;  2YTF A;  1XMO E;  2HC5 A;  2LBS B;  2CT1 A;  2EPO A;  4LF7 E;  4DR5 E;  1DGC A;  1RQ0 A;  1X6E A;  2EOF A;  1HNW E;  2D9H A;  2GHF A;  3RMP A;  1L4S A;  2EMH A;  4X62 E;  2G7H A;  2VQE E;  3J7A G;  1WRJ A;  1IMU A;  2VRD A;  4WX9 A;  4DR4 E;  2MKD A;  4Q35 B;  4R2D A;  5A69 A;  4F9C B;  2UUC E;  1T38 A;  3M99 B;  3ADJ A;  2BBG A;  2JOB A;  2EJ4 A;  2EN7 A;  2V8Q B;  2LUP B;  4JI3 E;  2DMY A;  5T6J A;  2CPN A;  1F2I G;  2M1S A;  4DMI A;  5AC5 A;  4P7D A;  1GZ6 A;  3ECR A;  2J7J A;  2EN6 A;  4JI5 E;  2LMZ A;  4M30 A;  4JI7 E;  4O5G A;  4YY3 E;  3J7Y p;  4DR6 E;  4JYA E;  2V87 A;  4TUG A;  5AE1 A;  1IQO A;  2YTD A;  2EOH A;  3HPS A;  4BC7 A;  5BR8 E;  2DB2 A;  4P78 A;  2B7T A;  3HTX A;  2CSH A;  2EMX A;  2EPA A;  1BBG A;  4B3T E;  4LFA E;  4TUI A;  2V88 A;  1X5W A;  1BBO A;  2M7Q A;  5CFF E;  1RC7 A;  2UUA E;  1KJK A;  2E1M A;  3IWD A;  4DV6 E;  2EPP A;  3JTZ A;  4B3M E;  4DR7 E;  2ODR C;  2YTG A;  2RS7 A;  4LF8 E;  5LMU E;  3DJW A;  5AE2 A;  3VYY A;  2RS6 A;  3EPK A;  3BID A;  5A6K A;  4LU9 A;  3C6K A;  2NA2 A;  4DV0 E;  3UK3 C;  1X49 A;  2FGG A;  1UIL A;  2LJH A;  2NAB A;  5A6B A;  4F9B B;  4DR1 E;  1N34 E;  4DR3 E;  2YT4 A;  2BB8 A;  3BF2 A;  4F6M A;  2EOQ A;  1YUJ A;  2KON A;  1T4L B;  1LLM C;  1TN9 A;  3J80 C;  2B7V A;  1BB8 A;  5KL4 A;  2M9A A;  2DGC A;  4BC9 A;  2RTX A;  3K6Q A;  2F4V E;  2KOU A;  1PKP A;  2ZM6 E;  3F6G A;  2JOX A;  4BHC A;  2EWL A;  4IS1 C;  2EML A;  2EQ0 A;  2I9I A;  1O0W A;  5KL5 A;  5KL3 A;  1T39 A;  2L33 A;  3KZY A;  4BHB A;  4LF9 E;  2GPI A;  1PJQ A;  2YSP A;  1Z1B A;  1A1G A;  3J81 C;  4R8O A;  2HGH A;  2EM3 A;  4DV7 E;  2E72 A;  4M0V A;  2EL5 A;  4JI0 E;  4LFC E;  2L2K B;  5AAS A;  4HTG A;  3T1H E;  1ZAA C;  2MDG A;  4KWY A;  4F6N A;  4O43 A;  2DMI A;  3KZZ A;  2EOJ A;  2YPN A;  2JP9 A;  2YTP A;  5IXM B;  4WYQ B;  1PDA A;  2DIX A;  2EPM X;  1YYO A;  1A1F A;  2YRM A;  4DV2 E;  1WHN A;  2FTX B;  1HNX E;  2NUG A;  4JI8 E;  4F9A B;  2EOM A;  1PJT A;  3C4B A;  5IWA E;  1UBD C;  2EMF A;  4GZN C;  4M9V C;  2L92 A;  1IBL E;  2LT7 A;  2EL6 A;  4NHR A;  2EMK A;  2N3H A;  4MLV A;  2JY9 A;  2YRH A;  3MHH C;  2UUB E;  4RHB B;  4DV4 E;  1T4O A;  2DLQ A;  4JI2 E;  2EE8 A;  1IBK E;  1MGT A;  1N3G A;  2V86 A;  2EPU A;  2FV4 B;  2A25 A;  2WBS A;  2PRT A;  4BMJ A;  3ZOQ B;  4F2J C;  2EMA A;  1G2F C;  1NCS A;  2YTE A;  4WXC A;  1X3C A;  2LUQ A;  5F3W A;  3EPH A;  3FIG A;  2LO3 A;  4KHP E;  3L00 A;  2L3J A;  2L8T A;  2EM9 A;  4J8Z A;  3MSW A;  2K4V A;  2EZ6 A;  4BCA A;  1T4N A;  4IJD A;  3TQM A;  4DV1 E;  5LLQ A;  4JI6 E;  2YWQ A;  1QU6 A;  4JI4 E;  2YTJ A;  3HPZ A;  3AUZ A;  2LTS A;  2V83 A;  1N33 E;  1N36 E;  4DV5 E;  1XNQ E;  2EOS A;  1EKZ A;  2EQ3 A;  1G2D C;  1X47 A;  2NUF A;  4LTY A;  2WZO A;  2JYA A;  1YYW A;  2EM0 A;  2ENH A;  5LL6 R;  4GKJ E;  2RSI A;  4BBY A;  1X48 A;  5A6J A;  1YZ9 A;  1YUI A;  1IQS A;  4WPY A;  4ZYD A;  4NZV A;  1I94 E;  1A1K A;  5TSE A;  2N8X A;  2Q8U A;  4B3R E;  2EMY A;  2MC5 A;  4DUZ E;  2EPC A;  2LV2 A;  4OOG C;  2L2M A;  4K0K E;  4ZYG A;  2MC6 A;  2KHX A;  2EL4 A;  2WBT A;  3EQ1 A;  2V85 A;  2EM4 A;  4R03 A;  4R2P A;  1A1H A;  2EMZ A; 
#chains in the Genus database with same CATH homology
 4RHB B;  4KWY A;  4NHR A;  3BF2 A;  5IXM B;  4Q35 B;  2R76 A;  4N4R B;  2JXP A;  4RH8 A;  5IV8 B;  5TSE A;  2N8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...