4N4RB

Structure basis of lipopolysaccharide biogenesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
151
structure length
151
Chain Sequence
CGWHLRSTTQVPASMKTMILDSGDPNGPLSRAVRNQLRLNNVNLLDKDTTRKDVPSLRLGTVTILQDTASVFQDGQTAEYQMVMTVNASVLIPGHDIYPISTKVYRSFFDNPQMALAKDNEQAMIVQEMYDKAAEQLIRKLTSVRAADIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords LPS-assembly protein LptD
publication title Structural basis for outer membrane lipopolysaccharide insertion.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 29
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4n4rB00
5TSEA 5IXMB 3BF2A 2JXPA 4RH8A 4N4RB 2R76A 5IV8B 4RHBB 2N8XA 4NHRA 4Q35B 4KWYA
chains in the Genus database with same CATH superfamily
4X62E 2J7JA 4BS9A 2EMZA 3KWRA 1A1LA 2B9DA 2EPRA 2LUQA 3IWDA 3J7AG 2YTNA 4M9VC 2DIXA 2JOBA 4DV6E 3LMLA 2N3HA 4F6NA 2RQLA 2EMKA 2EE8A 4P7DA 2FGGA 1FJGE 2L33A 1WHNA 1NEIA 3EQ1A 2V8QB 2DSYA 4JI5E 4DMIA 1PDAA 2VRDA 1GZ6A 3J80C 2L6MA 1HNWE 2MDGA 2EOFA 4LFAE 1IQOA 2MKNA 1HNXE 1WJPA 2EM6A 4DR7E 1L4SA 1IBME 2EM8A 3ADIA 2V87A 3JTZA 1YYKA 5LMUE 2YT4A 3AUZA 2YRKA 3K6QA 2EM7A 1PKPA 2EMAA 2N3GA 4F6MA 4NXME 2EPNA 2K4VA 4F9BB 3LLHA 2V88A 2EZ6A 2LJHA 1PJSA 1DQ3A 1ZR9A 2B3TB 4BC9A 5A6KA 2E5LE 2MKDA 1JK1A 2YRMA 5AASA 2EPPA 1HR0E 1X47A 4X66E 1GTKA 2MC5A 2MDRA 1G2FC 1T39A 2EMCA 1XMOE 2YTJA 3HPSA 2UU9E 2E1MA 2JPAA 2LV2A 4F2JC 4MLVA 2UXDE 4I8OA 2UXCE 5LL6R 2EOYA 1B69A 1ZBTA 4R2RA 2EOQA 2CT1A 2V89A 2RSIA 4WSPA 2ENHA 4BC7A 2EL5A 2YU5A 2V83A 5AC5A 1N32E 4NZVA 4Q28A 1J5EE 1QU6A 4BMJA 1EH7A 2WCC3 4JI6E 4JV5E 5IWAE 4Q35B 1YZ9A 2LTSA 2EPXA 4ZYDA 4JI3E 4LF6E 2JP9A 2EPZA 2EN7A 2DMYA 1BBGA 2EOMA 4M2ZA 2LE2A 5AC4A 2N8XA 4BBYA 2BBGA 1G2DC 2FTXB 4R2DA 2EMWA 2NA2A 1QNTA 5BR8E 2ELZA 1UBDC 1UHZA 2HC5A 1HNZE 2NUEA 1X6FA 2EOHA 2LRSA 5IV8B 2EORA 3ECRA 3ADLA 5KL4A 4GKJE 3FIGA 1YUJA 1N36E 2DGCA 5KL3A 2WBSA 3C6KA 2RTXA 3ADGA 2RSMA 4IS1C 2ADRA 2F8BA 4WX9A 2WBUA 2R76A 1RMDA 4LF7E 5AE1A 3VYXA 4TUGA 1J26A 2VE7C 2UUCE 2NABA 2EM4A 2G7HA 2FV4B 2LCEA 2YZTA 2BB8A 2YTGA 4X65E 2YSOA 1YUIA 2YPNA 3JAMC 2B7VA 5KL7A 1IBKE 2YRHA 2EPMX 4LF9E 2YTIA 1A1KA 2JWOA 2LVHA 1WRJA 4DR2E 4WXDA 4TUIA 1NCSA 4DV3E 4NXNE 4JI1E 1YPNA 2EMXA 4DV0E 2GLIA 2EN1A 1YFHA 1X49A 1WHQA 4R2AA 1FKAE 3T1HE 4ZYHA 1XNRE 3ZOQB 4JI4E 2EMBA 4DR4E 4R03A 3HTXA 3JU0A 1A1FA 1O0WA 2V86A 1TF6A 1YYWA 3KZYA 2EN6A 3L00A 2F4VE 2L2KB 2RS6A 4LF5E 2D9HA 4O5GA 4OOGC 3HXLA 4JI0E 3RMPA 1N3GA 3T1YE 5A6BD 4DV7E 4KHPE 2YTQA 2NUFA 4RH8A 5DNYA 2EOXA 4F9AB 3DJWA 4WYQB 2DB2A 1DGCA 2ELYA 2EMHA 2EN4A 3MHHC 4LF8E 1AH5A 1WXRA 2WZOA 2EMLA 1DI2A 2E72A 2LTRA 4DV4E 4O4KA 1EH6A 2DRPA 4F9CB 1SR9A 1YYOA 4DV5E 2EM0A 4IJDA 2L2NA 1X48A 1N34E 4B3ME 5CFFE 4R2EA 4B3SE 3QG5C 2EOOA 2B7TA 4L8NA 2DLKA 4GEQB 2EQ3A 2KHXA 1X3CA 2K7IA 2JOXA 2EQ0A 2JY9A 1A1IA 1PJQA 3UK3C 5F3WA 1KJKA 2JYAA 2YTOA 4DR6E 2CPNA 5TSEA 4HTGA 4YHHE 2YTFA 4FK5C 2MC6A 2YWQA 2CTDA 2EPKX 4BHBA 4JI7E 2EMYA 2EPAA 3BF2A 3C6MA 2LO3A 4RHBB 4LU9A 1IBLE 2GHFA 2YTPA 4P78A 2CSHA 2EOIA 2EN2A 4GKKE 1F2IG 2ODRC 3DF6A 4BHCA 2Q8UA 3VHTB 3TQMA 4M30A 2M4IA 1AAYA 1A1HA 4KWYA 4JI2E 2PRTA 5LLQA 3IWBA 3ADJA 3EPLA 5LMNE 1X5WA 2EJ4A 1N33E 4KZSA 5AE2A 1YSAC 4R2CA 3IWCA 4NHRA 3THNA 2L3JA 2VF1A 2EOZA 4B3RE 4BCAA 4F54A 2KOUA 4ZYGA 4DR5E 4B3TE 2LBSB 1EKZA 2HGHA 4OX9E 3VK6A 1I94E 2EMGA 4DR1E 2M9AA 1JK2A 5ADZA 2JVAA 2YU8A 4LFCE 5AE3A 3EPHA 3J81C 4R2QA 3F6GA 4MLQA 4JI8E 1LLMC 2YTEA 1UN6B 1KYQA 4R2SA 2EN8A 2H36X 1MGTA 2VQEE 2EMFA 1TN9A 3OMLA 1XNQE 2A25A 2L92A 4AQYE 3F6HA 3C4TA 2M7QA 2IHR1 1SFEA 2JXPA 1RC7A 2VQFE 4LF4E 2EL4A 4X64E 4K0KE 2EPOA 1PJTA 5IT9C 2ENCA 2I13A 2HJJA 2I9IA 1IQSA 4R2PA 4WFTA 4M0VA 4ZYEA 3HPZA 3BIDA 3EPJA 5KL5A 2ZM6E 1P47A 1MEYC 1ZU1A 2EOJA 1XMQE 1TF3A 2UUBE 3P1XA 4X9JA 4L5NC 3KZZA 3THOB 2DLQA 2EPLX 2EOEA 4DUZE 3M99B 2EMIA 2EM2A 1BB8A 1BBOA 1T4NA 1GQEA 4WXCA 5A6JA 2DMIA 1ZAAC 2M1SA 2EOSA 4HEIA 4LFBE 1X6EA 2ODRD 2L8TA 2EP3A 5T6JA 3C4BA 4DV2E 2EQ1A 2JR1A 4DKKA 2EL6A 3HQ1A 1Z1BA 3H09A 2UXBE 2EM5A 5A6AA 4J8ZA 2YSPA 2WBTA 2EN3A 1IMUA 3MHSC 4YY3E 3EPKA 3VYYA 4N4RB 5A2QC 2LT7A 2LMZA 4O24A 4GZNC 2LUPB 3AV0A 1EH8A 3BBGA 4WPYA 3BGHA 5KL2A 4DR3E 2EPUA 2L3CA 2YTDA 2HHHE 5IXMB 4WSGA 2EPCA 2LJUA 3OTOE 1A1GA 3MSWA 2GPIA 2EM3A 4O43A 1STUA 1A1JA 1T4OA 2R1FA 4R8OA 2EWLA 2V85A 4X8WA 5A6BA 4JYAE 5FLXC 3J7Yp 4DUYE 2UUAE 1X6HA 2ENAA 2RS7A 2L2MA 2RPCA 1RQ0A 4LTYA 1ZBQA 1UILA 5A69A 1T4LB 2NUGA 2KONA 4DV1E 1T38A 5KL6A 2EM9A
chains in the Genus database with same CATH topology
5TSEA 5IXMB 3BF2A 2JXPA 4RH8A 4N4RB 2R76A 5IV8B 4RHBB 2N8XA 4NHRA 4Q35B 4KWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSE A;  5IXM B;  3BF2 A;  2JXP A;  4RH8 A;  4N4R B;  2R76 A;  5IV8 B;  4RHB B;  2N8X A;  4NHR A;  4Q35 B;  4KWY A; 
#chains in the Genus database with same CATH topology
 4X62 E;  2J7J A;  4BS9 A;  2EMZ A;  3KWR A;  1A1L A;  2B9D A;  2EPR A;  2LUQ A;  3IWD A;  3J7A G;  2YTN A;  4M9V C;  2DIX A;  2JOB A;  4DV6 E;  3LML A;  2N3H A;  4F6N A;  2RQL A;  2EMK A;  2EE8 A;  4P7D A;  2FGG A;  1FJG E;  2L33 A;  1WHN A;  1NEI A;  3EQ1 A;  2V8Q B;  2DSY A;  4JI5 E;  4DMI A;  1PDA A;  2VRD A;  1GZ6 A;  3J80 C;  2L6M A;  1HNW E;  2MDG A;  2EOF A;  4LFA E;  1IQO A;  2MKN A;  1HNX E;  1WJP A;  2EM6 A;  4DR7 E;  1L4S A;  1IBM E;  2EM8 A;  3ADI A;  2V87 A;  3JTZ A;  1YYK A;  5LMU E;  2YT4 A;  3AUZ A;  2YRK A;  3K6Q A;  2EM7 A;  1PKP A;  2EMA A;  2N3G A;  4F6M A;  4NXM E;  2EPN A;  2K4V A;  4F9B B;  3LLH A;  2V88 A;  2EZ6 A;  2LJH A;  1PJS A;  1DQ3 A;  1ZR9 A;  2B3T B;  4BC9 A;  5A6K A;  2E5L E;  2MKD A;  1JK1 A;  2YRM A;  5AAS A;  2EPP A;  1HR0 E;  1X47 A;  4X66 E;  1GTK A;  2MC5 A;  2MDR A;  1G2F C;  1T39 A;  2EMC A;  1XMO E;  2YTJ A;  3HPS A;  2UU9 E;  2E1M A;  2JPA A;  2LV2 A;  4F2J C;  4MLV A;  2UXD E;  4I8O A;  2UXC E;  5LL6 R;  2EOY A;  1B69 A;  1ZBT A;  4R2R A;  2EOQ A;  2CT1 A;  2V89 A;  2RSI A;  4WSP A;  2ENH A;  4BC7 A;  2EL5 A;  2YU5 A;  2V83 A;  5AC5 A;  1N32 E;  4NZV A;  4Q28 A;  1J5E E;  1QU6 A;  4BMJ A;  1EH7 A;  2WCC 3;  4JI6 E;  4JV5 E;  5IWA E;  4Q35 B;  1YZ9 A;  2LTS A;  2EPX A;  4ZYD A;  4JI3 E;  4LF6 E;  2JP9 A;  2EPZ A;  2EN7 A;  2DMY A;  1BBG A;  2EOM A;  4M2Z A;  2LE2 A;  5AC4 A;  2N8X A;  4BBY A;  2BBG A;  1G2D C;  2FTX B;  4R2D A;  2EMW A;  2NA2 A;  1QNT A;  5BR8 E;  2ELZ A;  1UBD C;  1UHZ A;  2HC5 A;  1HNZ E;  2NUE A;  1X6F A;  2EOH A;  2LRS A;  5IV8 B;  2EOR A;  3ECR A;  3ADL A;  5KL4 A;  4GKJ E;  3FIG A;  1YUJ A;  1N36 E;  2DGC A;  5KL3 A;  2WBS A;  3C6K A;  2RTX A;  3ADG A;  2RSM A;  4IS1 C;  2ADR A;  2F8B A;  4WX9 A;  2WBU A;  2R76 A;  1RMD A;  4LF7 E;  5AE1 A;  3VYX A;  4TUG A;  1J26 A;  2VE7 C;  2UUC E;  2NAB A;  2EM4 A;  2G7H A;  2FV4 B;  2LCE A;  2YZT A;  2BB8 A;  2YTG A;  4X65 E;  2YSO A;  1YUI A;  2YPN A;  3JAM C;  2B7V A;  5KL7 A;  1IBK E;  2YRH A;  2EPM X;  4LF9 E;  2YTI A;  1A1K A;  2JWO A;  2LVH A;  1WRJ A;  4DR2 E;  4WXD A;  4TUI A;  1NCS A;  4DV3 E;  4NXN E;  4JI1 E;  1YPN A;  2EMX A;  4DV0 E;  2GLI A;  2EN1 A;  1YFH A;  1X49 A;  1WHQ A;  4R2A A;  1FKA E;  3T1H E;  4ZYH A;  1XNR E;  3ZOQ B;  4JI4 E;  2EMB A;  4DR4 E;  4R03 A;  3HTX A;  3JU0 A;  1A1F A;  1O0W A;  2V86 A;  1TF6 A;  1YYW A;  3KZY A;  2EN6 A;  3L00 A;  2F4V E;  2L2K B;  2RS6 A;  4LF5 E;  2D9H A;  4O5G A;  4OOG C;  3HXL A;  4JI0 E;  3RMP A;  1N3G A;  3T1Y E;  5A6B D;  4DV7 E;  4KHP E;  2YTQ A;  2NUF A;  4RH8 A;  5DNY A;  2EOX A;  4F9A B;  3DJW A;  4WYQ B;  2DB2 A;  1DGC A;  2ELY A;  2EMH A;  2EN4 A;  3MHH C;  4LF8 E;  1AH5 A;  1WXR A;  2WZO A;  2EML A;  1DI2 A;  2E72 A;  2LTR A;  4DV4 E;  4O4K A;  1EH6 A;  2DRP A;  4F9C B;  1SR9 A;  1YYO A;  4DV5 E;  2EM0 A;  4IJD A;  2L2N A;  1X48 A;  1N34 E;  4B3M E;  5CFF E;  4R2E A;  4B3S E;  3QG5 C;  2EOO A;  2B7T A;  4L8N A;  2DLK A;  4GEQ B;  2EQ3 A;  2KHX A;  1X3C A;  2K7I A;  2JOX A;  2EQ0 A;  2JY9 A;  1A1I A;  1PJQ A;  3UK3 C;  5F3W A;  1KJK A;  2JYA A;  2YTO A;  4DR6 E;  2CPN A;  5TSE A;  4HTG A;  4YHH E;  2YTF A;  4FK5 C;  2MC6 A;  2YWQ A;  2CTD A;  2EPK X;  4BHB A;  4JI7 E;  2EMY A;  2EPA A;  3BF2 A;  3C6M A;  2LO3 A;  4RHB B;  4LU9 A;  1IBL E;  2GHF A;  2YTP A;  4P78 A;  2CSH A;  2EOI A;  2EN2 A;  4GKK E;  1F2I G;  2ODR C;  3DF6 A;  4BHC A;  2Q8U A;  3VHT B;  3TQM A;  4M30 A;  2M4I A;  1AAY A;  1A1H A;  4KWY A;  4JI2 E;  2PRT A;  5LLQ A;  3IWB A;  3ADJ A;  3EPL A;  5LMN E;  1X5W A;  2EJ4 A;  1N33 E;  4KZS A;  5AE2 A;  1YSA C;  4R2C A;  3IWC A;  4NHR A;  3THN A;  2L3J A;  2VF1 A;  2EOZ A;  4B3R E;  4BCA A;  4F54 A;  2KOU A;  4ZYG A;  4DR5 E;  4B3T E;  2LBS B;  1EKZ A;  2HGH A;  4OX9 E;  3VK6 A;  1I94 E;  2EMG A;  4DR1 E;  2M9A A;  1JK2 A;  5ADZ A;  2JVA A;  2YU8 A;  4LFC E;  5AE3 A;  3EPH A;  3J81 C;  4R2Q A;  3F6G A;  4MLQ A;  4JI8 E;  1LLM C;  2YTE A;  1UN6 B;  1KYQ A;  4R2S A;  2EN8 A;  2H36 X;  1MGT A;  2VQE E;  2EMF A;  1TN9 A;  3OML A;  1XNQ E;  2A25 A;  2L92 A;  4AQY E;  3F6H A;  3C4T A;  2M7Q A;  2IHR 1;  1SFE A;  2JXP A;  1RC7 A;  2VQF E;  4LF4 E;  2EL4 A;  4X64 E;  4K0K E;  2EPO A;  1PJT A;  5IT9 C;  2ENC A;  2I13 A;  2HJJ A;  2I9I A;  1IQS A;  4R2P A;  4WFT A;  4M0V A;  4ZYE A;  3HPZ A;  3BID A;  3EPJ A;  5KL5 A;  2ZM6 E;  1P47 A;  1MEY C;  1ZU1 A;  2EOJ A;  1XMQ E;  1TF3 A;  2UUB E;  3P1X A;  4X9J A;  4L5N C;  3KZZ A;  3THO B;  2DLQ A;  2EPL X;  2EOE A;  4DUZ E;  3M99 B;  2EMI A;  2EM2 A;  1BB8 A;  1BBO A;  1T4N A;  1GQE A;  4WXC A;  5A6J A;  2DMI A;  1ZAA C;  2M1S A;  2EOS A;  4HEI A;  4LFB E;  1X6E A;  2ODR D;  2L8T A;  2EP3 A;  5T6J A;  3C4B A;  4DV2 E;  2EQ1 A;  2JR1 A;  4DKK A;  2EL6 A;  3HQ1 A;  1Z1B A;  3H09 A;  2UXB E;  2EM5 A;  5A6A A;  4J8Z A;  2YSP A;  2WBT A;  2EN3 A;  1IMU A;  3MHS C;  4YY3 E;  3EPK A;  3VYY A;  4N4R B;  5A2Q C;  2LT7 A;  2LMZ A;  4O24 A;  4GZN C;  2LUP B;  3AV0 A;  1EH8 A;  3BBG A;  4WPY A;  3BGH A;  5KL2 A;  4DR3 E;  2EPU A;  2L3C A;  2YTD A;  2HHH E;  5IXM B;  4WSG A;  2EPC A;  2LJU A;  3OTO E;  1A1G A;  3MSW A;  2GPI A;  2EM3 A;  4O43 A;  1STU A;  1A1J A;  1T4O A;  2R1F A;  4R8O A;  2EWL A;  2V85 A;  4X8W A;  5A6B A;  4JYA E;  5FLX C;  3J7Y p;  4DUY E;  2UUA E;  1X6H A;  2ENA A;  2RS7 A;  2L2M A;  2RPC A;  1RQ0 A;  4LTY A;  1ZBQ A;  1UIL A;  5A69 A;  1T4L B;  2NUG A;  2KON A;  4DV1 E;  1T38 A;  5KL6 A;  2EM9 A; 
#chains in the Genus database with same CATH homology
 5TSE A;  5IXM B;  3BF2 A;  2JXP A;  4RH8 A;  4N4R B;  2R76 A;  5IV8 B;  4RHB B;  2N8X A;  4NHR A;  4Q35 B;  4KWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...