3ADLA

Structure of trbp2 and its molecule implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
b'GLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RISC-loading complex subunit TARBP2
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adlA01
1X47A 1HNWE 4LF5E 4DV3E 4LF6E 3J7Yp 1PKPA 1WHNA 2L33A 2N3HA 4GKJE 3P1XA 3ADLA 2VQFE 2KHXA 1GQEA 1YYOA 2JVAA 2B3TB 1UHZA 2LTRA 3C4TA 2F4VE 1N36E 2UUAE 2JY9A 3VYYA 1EKZA 4NXME 2B7VA 4B3ME 2LJHA 4X8WA 4DUZE 2RSMA 1ZBTA 4JI4E 4GKKE 1X49A 4X66E 4DKKA 4M2ZA 2CPNA 4DR7E 1QU6A 2EZ6A 4DR5E 2VQEE 1O0WA 4X65E 1RC7A 1RQ0A 2UXBE 1YYWA 2IHR1 4NXNE 4DR3E 1HR0E 3ADJA 4AQYE 4B3TE 4DV4E 1XNQE 4LFBE 1IBLE 3LLHA 2NUFA 4LF9E 4DR2E 5LMNE 4JI1E 4DV2E 4K0KE 4LFCE 4DR4E 2RTXA 2UXCE 3VYXA 1YZ9A 2RS7A 4DV6E 2B7TA 4DV1E 1XNRE 1N34E 1I94E 4B3RE 2DB2A 1XMQE 4LFAE 5CFFE 1T4OA 3HTXA 1FJGE 2MDRA 1T4LB 2L2NA 2LTSA 2UUBE 4LF4E 3ADGA 1IBME 5BR8E 5LMUE 4DR6E 1DI2A 1N33E 4LF7E 4WYQB 4X62E 4B3SE 3C4BA 4YHHE 4WFTA 4LF8E 1FKAE 1T4NA 2UU9E 4YY3E 3T1YE 4M30A 1UILA 1X48A 4DUYE 4JI6E 2RS6A 2YT4A 4KHPE 2DIXA 1J5EE 1N32E 2L2KB 2LRSA 4JV5E 4JI7E 1STUA 2UXDE 4OX9E 4X64E 2ZM6E 2LUPB 3T1HE 1WHQA 4JI5E 5IWAE 3OTOE 3ADIA 4JI0E 4OOGC 2N3GA 4JYAE 2UUCE 2L2MA 4DR1E 2NUGA 4JI8E 4DV7E 2NUEA 1HNZE 4JI2E 1YYKA 1J26A 1HNXE 4DV5E 2L3JA 2HHHE 2L3CA 1IBKE 2NA2A 2E5LE 2LBSB 2LUQA 4DV0E 2DMYA 1XMOE 4JI3E
chains in the Genus database with same CATH superfamily
2LJUA 1PKPA 1A1JA 4R2DA 1GZ6A 3KWRA 2EJ4A 2N3HA 4GKJE 2DRPA 2VQFE 2PRTA 2EMWA 1ZU1A 3IWCA 4KWYA 4LTYA 2WBUA 4F9CB 2YRKA 2EMIA 3C6KA 2LTRA 1PJSA 2EOSA 4BMJA 1N36E 1EKZA 4RH8A 2I9IA 2LJHA 2WBTA 2EN1A 4R8OA 2YTOA 4MLQA 3EPHA 2N8XA 3MHHC 1QU6A 4DR5E 1JK2A 2BBGA 2ELYA 1AAYA 3DJWA 1RC7A 2EMGA 1YYWA 2EM6A 2EMZA 3OMLA 4B3TE 5A2QC 2CTDA 4LF9E 1SR9A 3HQ1A 4R2RA 5AE1A 4O24A 3HPZA 2B7TA 4BHBA 2DLQA 5TSEA 4B3RE 2DB2A 1T4OA 5AC5A 2JWOA 2UUBE 2E72A 2EM0A 4R2EA 1IBME 5KL2A 1PJQA 2LVHA 2EMCA 2V85A 1X5WA 2JPAA 4YHHE 4LF8E 1A1GA 3L00A 2YU8A 2UU9E 2CSHA 1WXRA 3T1YE 3AV0A 4M30A 1UILA 1X48A 4DUYE 2GPIA 1MEYC 4JI6E 1GTKA 2EPLX 2L6MA 2D9HA 2DIXA 2L2KB 2EMXA 1TN9A 4HEIA 3C6MA 3T1HE 2YRHA 5IWAE 3OTOE 2EN4A 2YTFA 4JYAE 2K7IA 1AH5A 4MLVA 4DR1E 3J7AG 2NUGA 5A6BA 4JI8E 2EPRA 2RSIA 2L3CA 2NA2A 4IJDA 2LBSB 1X3CA 2V86A 2FTXB 5A6KA 3KZYA 3BF2A 3J7Yp 2KONA 1WHNA 3IWBA 4NZVA 3P1XA 4R2AA 4F6NA 2DMIA 1YYOA 2B3TB 5A69A 4R2PA 2EMLA 2B9DA 2EM5A 5F3WA 4GEQB 2EORA 2EOIA 3C4TA 4GZNC 2HGHA 2F4VE 2JY9A 2V87A 4M9VC 1NEIA 2B7VA 4B3ME 2EPZA 2EOMA 4DUZE 2M1SA 2EM3A 2RSMA 3J81C 5DNYA 4R2QA 4GKKE 1X49A 1X6HA 4DKKA 3THNA 2YRMA 2M7QA 2YTEA 2VQEE 3VHTB 3JAMC 2F8BA 4P78A 1YSAC 1ZBQA 1A1KA 1P47A 2EMHA 3H09A 5FLXC 2JYAA 3FIGA 2EN8A 2EPCA 3M99B 2YTGA 4LFBE 2V88A 2NUFA 4DR2E 1A1IA 4K0KE 4Q35B 4O43A 5KL4A 2RTXA 3LMLA 1A1HA 2UXCE 4I8OA 3VYXA 4DV6E 2EOFA 4DV1E 1I94E 3HXLA 3HPSA 1KYQA 5CFFE 2YPNA 1FJGE 2DGCA 4R03A 1T4LB 1RMDA 4LF4E 4F54A 2EWLA 4DR6E 1DI2A 4BC9A 4WXDA 2ODRD 2YSPA 1YUIA 5AASA 4LF7E 1N33E 4X9JA 4X62E 1TF6A 3QG5C 2A25A 1FKAE 4YY3E 1X6EA 1JK1A 2K4VA 4KZSA 2YTIA 2V8QB 4DMIA 4R2SA 3EPLA 5ADZA 4RHBB 2EMKA 2E1MA 4R2CA 1J5EE 1N32E 2H36X 1T38A 4HTGA 4Q28A 5AE3A 2LRSA 2LO3A 1UN6B 2EP3A 1DQ3A 4X64E 2LV2A 2J7JA 3ADIA 5IT9C 4OOGC 2HJJA 4DV7E 3BBGA 4F9BB 4JI2E 2EQ3A 1PDAA 2FGGA 2L3JA 1IBKE 4LU9A 2EPUA 2LUQA 4DV0E 4BS9A 1XMOE 1EH8A 4O4KA 4ZYHA 1N3GA 4DV3E 4LF6E 1LLMC 2EN2A 2EOXA 3ADLA 3DF6A 2KHXA 1ZAAC 2JVAA 1F2IG 2VF1A 1BBGA 5A6BD 1UHZA 4BHCA 2MC6A 1WJPA 1A1FA 4BBYA 1BB8A 2UUAE 2V83A 3JTZA 4FK5C 4X8WA 1BBOA 1ZBTA 1IQOA 4WX9A 1YFHA 4JI4E 2JR1A 3ECRA 4DR7E 2CPNA 2JOXA 3EPKA 2I13A 2DLKA 2EOYA 2EZ6A 3F6HA 1O0WA 4X65E 2EN6A 4WPYA 3BGHA 1SFEA 1RQ0A 1MGTA 4ZYDA 2EL6A 2LMZA 2IHR1 2LT7A 2EOQA 5KL3A 1HR0E 3ADJA 2EPKX 2GHFA 1UBDC 4L8NA 4DV4E 2KOUA 5AC4A 4JI1E 4DR4E 2LE2A 1YZ9A 2RS7A 3ZOQB 3MSWA 3UK3C 2ENCA 2L2NA 2LTSA 1QNTA 3THOB 5BR8E 5LMUE 2ENAA 2EPMX 2EOEA 2MC5A 2YTDA 1DGCA 2VE7C 1YUJA 2VRDA 2EOHA 2ENHA 2FV4B 2L92A 1EH6A 2YT4A 4M0VA 3K6QA 2EN3A 4KHPE 1EH7A 2YTPA 2Q8UA 2EM2A 5KL5A 3J80C 5IV8B 3MHSC 4JI7E 3RMPA 5A6JA 1T39A 1TF3A 1A1LA 1STUA 2EM7A 2ZM6E 2LUPB 1WHQA 2EPAA 2WCC3 4JI0E 2MKDA 2EMBA 2N3GA 3IWDA 2EL4A 2EMFA 2NUEA 2YTJA 5LL6R 1J26A 1IQSA 2BB8A 1HNXE 4ZYGA 2DSYA 2HHHE 2E5LE 3KZZA 2DMYA 1X47A 1HNWE 1YPNA 4LF5E 2EQ0A 2L33A 4J8ZA 3JU0A 1G2FC 2JOBA 1GQEA 2R1FA 4BCAA 4WSPA 1KJKA 2HC5A 4ZYEA 1NCSA 3VYYA 4NXME 2ODRC 2NABA 5LLQA 2MKNA 2CT1A 4F6MA 2EE8A 4WXCA 2R76A 5A6AA 4X66E 4M2ZA 4N4RB 3VK6A 2ELZA 4O5GA 2EPPA 2YTNA 2JP9A 2EM4A 2UXBE 2YWQA 4NXNE 3EQ1A 4DR3E 3EPJA 4AQYE 1XNQE 2M4IA 1IBLE 3LLHA 2EM9A 2EOOA 5LMNE 4DV2E 1X6FA 4L5NC 4LFCE 5KL7A 2MDGA 2EPNA 2YSOA 1WRJA 1XNRE 4BC7A 1N34E 2L8TA 1XMQE 2EMAA 4LFAE 3HTXA 2MDRA 2JXPA 4WSGA 2EN7A 3F6GA 1B69A 1G2DC 3ADGA 2YU5A 2WZOA 5AE2A 1IMUA 2EL5A 4NHRA 4TUGA 4F2JC 4WYQB 4B3SE 3C4BA 2WBSA 2EPXA 1Z1BA 4WFTA 1T4NA 2V89A 2RS6A 3BIDA 2M9AA 1PJTA 2YZTA 5IXMB 2LCEA 4P7DA 2EOZA 4JV5E 1L4SA 2RPCA 4IS1C 2EPOA 2UXDE 4OX9E 3TQMA 2EOJA 4JI5E 2EQ1A 2ADRA 2YTQA 2EM8A 2EMYA 5KL6A 2UUCE 2L2MA 2GLIA 1ZR9A 1HNZE 4TUIA 5T6JA 4F9AB 1YYKA 2RQLA 4DV5E 3AUZA 2G7HA 4JI3E
chains in the Genus database with same CATH topology
1X47A 1HNWE 4LF5E 4DV3E 4LF6E 3J7Yp 1PKPA 2KONA 1WHNA 1GZ6A 2L33A 3IWBA 3KWRA 2N3HA 4GKJE 3P1XA 3JU0A 4J8ZA 2VQFE 3DF6A 3ADLA 2JOBA 2KHXA 1GQEA 1YYOA 2JVAA 3IWCA 2B3TB 4BCAA 2VF1A 4WSPA 4LTYA 4F9CB 1UHZA 2B9DA 2MC6A 2LTRA 5F3WA 4GEQB 4BMJA 4LFBE 3C4TA 2F4VE 4BBYA 1N36E 2UUAE 2JY9A 2V87A 2V83A 3VYYA 1EKZA 4NXME 2ODRC 3JTZA 1YZ9A 2B7VA 4B3ME 2LJHA 4X8WA 4DUZE 2M1SA 2RSMA 3J81C 1ZBTA 5DNYA 4R8OA 4JI4E 2JR1A 1X49A 4X66E 1XMOE 4GKKE 4DKKA 4M2ZA 2CPNA 4DR7E 2JOXA 3VK6A 1QU6A 2EZ6A 4DR5E 2M7QA 3F6HA 2VQEE 1O0WA 4X65E 3JAMC 2F8BA 4P78A 4WPYA 1ZBQA 3DJWA 1RC7A 1RQ0A 2UXBE 2LMZA 1YYWA 2IHR1 3H09A 4NXNE 4DR3E 5FLXC 3FIGA 1HR0E 3ADJA 4AQYE 3OMLA 4B3TE 4L8NA 4DV4E 1XNQE 2M4IA 1IBLE 2V88A 2KOUA 3LLHA 5A2QC 2NUFA 4DR2E 5LMNE 4JI1E 4DV2E 4LF9E 4L5NC 4K0KE 1SR9A 3HQ1A 4LFCE 2G7HA 4DR4E 5AE1A 2LE2A 2RTXA 3LMLA 2UXCE 4I8OA 3VYXA 3HPZA 2RS7A 3ZOQB 2B7TA 4DV1E 4BC7A 4DV6E 1XNRE 1N34E 1I94E 2L8TA 3HXLA 3HPSA 4B3RE 2DB2A 1XMQE 3MSWA 4LFAE 5CFFE 1T4OA 3HTXA 1FJGE 4R03A 2MDRA 1T4LB 2JWOA 2L2NA 2LTSA 3F6GA 2UUBE 4LF4E 3ADGA 4F54A 1IBME 2EWLA 5BR8E 2WZOA 5LMUE 5AE2A 4DR6E 1DI2A 4BC9A 2ODRD 1N33E 4LF7E 5AASA 4TUGA 4WYQB 4X62E 2V85A 4B3SE 3C4BA 2MC5A 4YHHE 4WFTA 4LF8E 1FKAE 2VE7C 1T4NA 2V89A 2UU9E 4YY3E 1WXRA 3T1YE 3AV0A 4M30A 1UILA 1X48A 2K4VA 2FV4B 4KZSA 4DUYE 2V8QB 4DMIA 2L92A 4JI6E 5ADZA 2L6MA 2RS6A 2YT4A 4M0VA 2E1MA 3K6QA 4KHPE 2DIXA 1J5EE 1N32E 2H36X 2L2KB 2YZTA 4Q28A 5AE3A 2LRSA 4P7DA 3J80C 4JV5E 4JI7E 3RMPA 1DQ3A 1STUA 2UXDE 4OX9E 4X64E 2ZM6E 2LUPB 3T1HE 1WHQA 4JI5E 5IWAE 3OTOE 3ADIA 4JI0E 5IT9C 4OOGC 2N3GA 4JYAE 2UUCE 3J7AG 2L2MA 3IWDA 4DR1E 2NUGA 4JI8E 4DV7E 4F9BB 2NUEA 1HNZE 4TUIA 5LL6R 5T6JA 4F9AB 4JI2E 1HNXE 1YYKA 1J26A 2DSYA 4DV5E 2FGGA 2L3JA 2HHHE 2L3CA 1IBKE 4LU9A 2NA2A 3AUZA 2E5LE 2LBSB 2LUQA 4DV0E 2DMYA 2V86A 4BS9A 4JI3E 2FTXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X47 A;  1HNW E;  4LF5 E;  4DV3 E;  4LF6 E;  3J7Y p;  1PKP A;  1WHN A;  2L33 A;  2N3H A;  4GKJ E;  3P1X A;  3ADL A;  2VQF E;  2KHX A;  1GQE A;  1YYO A;  2JVA A;  2B3T B;  1UHZ A;  2LTR A;  3C4T A;  2F4V E;  1N36 E;  2UUA E;  2JY9 A;  3VYY A;  1EKZ A;  4NXM E;  2B7V A;  4B3M E;  2LJH A;  4X8W A;  4DUZ E;  2RSM A;  1ZBT A;  4JI4 E;  4GKK E;  1X49 A;  4X66 E;  4DKK A;  4M2Z A;  2CPN A;  4DR7 E;  1QU6 A;  2EZ6 A;  4DR5 E;  2VQE E;  1O0W A;  4X65 E;  1RC7 A;  1RQ0 A;  2UXB E;  1YYW A;  2IHR 1;  4NXN E;  4DR3 E;  1HR0 E;  3ADJ A;  4AQY E;  4B3T E;  4DV4 E;  1XNQ E;  4LFB E;  1IBL E;  3LLH A;  2NUF A;  4LF9 E;  4DR2 E;  5LMN E;  4JI1 E;  4DV2 E;  4K0K E;  4LFC E;  4DR4 E;  2RTX A;  2UXC E;  3VYX A;  1YZ9 A;  2RS7 A;  4DV6 E;  2B7T A;  4DV1 E;  1XNR E;  1N34 E;  1I94 E;  4B3R E;  2DB2 A;  1XMQ E;  4LFA E;  5CFF E;  1T4O A;  3HTX A;  1FJG E;  2MDR A;  1T4L B;  2L2N A;  2LTS A;  2UUB E;  4LF4 E;  3ADG A;  1IBM E;  5BR8 E;  5LMU E;  4DR6 E;  1DI2 A;  1N33 E;  4LF7 E;  4WYQ B;  4X62 E;  4B3S E;  3C4B A;  4YHH E;  4WFT A;  4LF8 E;  1FKA E;  1T4N A;  2UU9 E;  4YY3 E;  3T1Y E;  4M30 A;  1UIL A;  1X48 A;  4DUY E;  4JI6 E;  2RS6 A;  2YT4 A;  4KHP E;  2DIX A;  1J5E E;  1N32 E;  2L2K B;  2LRS A;  4JV5 E;  4JI7 E;  1STU A;  2UXD E;  4OX9 E;  4X64 E;  2ZM6 E;  2LUP B;  3T1H E;  1WHQ A;  4JI5 E;  5IWA E;  3OTO E;  3ADI A;  4JI0 E;  4OOG C;  2N3G A;  4JYA E;  2UUC E;  2L2M A;  4DR1 E;  2NUG A;  4JI8 E;  4DV7 E;  2NUE A;  1HNZ E;  4JI2 E;  1YYK A;  1J26 A;  1HNX E;  4DV5 E;  2L3J A;  2HHH E;  2L3C A;  1IBK E;  2NA2 A;  2E5L E;  2LBS B;  2LUQ A;  4DV0 E;  2DMY A;  1XMO E;  4JI3 E; 
#chains in the Genus database with same CATH topology
 2LJU A;  1PKP A;  1A1J A;  4R2D A;  1GZ6 A;  3KWR A;  2EJ4 A;  2N3H A;  4GKJ E;  2DRP A;  2VQF E;  2PRT A;  2EMW A;  1ZU1 A;  3IWC A;  4KWY A;  4LTY A;  2WBU A;  4F9C B;  2YRK A;  2EMI A;  3C6K A;  2LTR A;  1PJS A;  2EOS A;  4BMJ A;  1N36 E;  1EKZ A;  4RH8 A;  2I9I A;  2LJH A;  2WBT A;  2EN1 A;  4R8O A;  2YTO A;  4MLQ A;  3EPH A;  2N8X A;  3MHH C;  1QU6 A;  4DR5 E;  1JK2 A;  2BBG A;  2ELY A;  1AAY A;  3DJW A;  1RC7 A;  2EMG A;  1YYW A;  2EM6 A;  2EMZ A;  3OML A;  4B3T E;  5A2Q C;  2CTD A;  4LF9 E;  1SR9 A;  3HQ1 A;  4R2R A;  5AE1 A;  4O24 A;  3HPZ A;  2B7T A;  4BHB A;  2DLQ A;  5TSE A;  4B3R E;  2DB2 A;  1T4O A;  5AC5 A;  2JWO A;  2UUB E;  2E72 A;  2EM0 A;  4R2E A;  1IBM E;  5KL2 A;  1PJQ A;  2LVH A;  2EMC A;  2V85 A;  1X5W A;  2JPA A;  4YHH E;  4LF8 E;  1A1G A;  3L00 A;  2YU8 A;  2UU9 E;  2CSH A;  1WXR A;  3T1Y E;  3AV0 A;  4M30 A;  1UIL A;  1X48 A;  4DUY E;  2GPI A;  1MEY C;  4JI6 E;  1GTK A;  2EPL X;  2L6M A;  2D9H A;  2DIX A;  2L2K B;  2EMX A;  1TN9 A;  4HEI A;  3C6M A;  3T1H E;  2YRH A;  5IWA E;  3OTO E;  2EN4 A;  2YTF A;  4JYA E;  2K7I A;  1AH5 A;  4MLV A;  4DR1 E;  3J7A G;  2NUG A;  5A6B A;  4JI8 E;  2EPR A;  2RSI A;  2L3C A;  2NA2 A;  4IJD A;  2LBS B;  1X3C A;  2V86 A;  2FTX B;  5A6K A;  3KZY A;  3BF2 A;  3J7Y p;  2KON A;  1WHN A;  3IWB A;  4NZV A;  3P1X A;  4R2A A;  4F6N A;  2DMI A;  1YYO A;  2B3T B;  5A69 A;  4R2P A;  2EML A;  2B9D A;  2EM5 A;  5F3W A;  4GEQ B;  2EOR A;  2EOI A;  3C4T A;  4GZN C;  2HGH A;  2F4V E;  2JY9 A;  2V87 A;  4M9V C;  1NEI A;  2B7V A;  4B3M E;  2EPZ A;  2EOM A;  4DUZ E;  2M1S A;  2EM3 A;  2RSM A;  3J81 C;  5DNY A;  4R2Q A;  4GKK E;  1X49 A;  1X6H A;  4DKK A;  3THN A;  2YRM A;  2M7Q A;  2YTE A;  2VQE E;  3VHT B;  3JAM C;  2F8B A;  4P78 A;  1YSA C;  1ZBQ A;  1A1K A;  1P47 A;  2EMH A;  3H09 A;  5FLX C;  2JYA A;  3FIG A;  2EN8 A;  2EPC A;  3M99 B;  2YTG A;  4LFB E;  2V88 A;  2NUF A;  4DR2 E;  1A1I A;  4K0K E;  4Q35 B;  4O43 A;  5KL4 A;  2RTX A;  3LML A;  1A1H A;  2UXC E;  4I8O A;  3VYX A;  4DV6 E;  2EOF A;  4DV1 E;  1I94 E;  3HXL A;  3HPS A;  1KYQ A;  5CFF E;  2YPN A;  1FJG E;  2DGC A;  4R03 A;  1T4L B;  1RMD A;  4LF4 E;  4F54 A;  2EWL A;  4DR6 E;  1DI2 A;  4BC9 A;  4WXD A;  2ODR D;  2YSP A;  1YUI A;  5AAS A;  4LF7 E;  1N33 E;  4X9J A;  4X62 E;  1TF6 A;  3QG5 C;  2A25 A;  1FKA E;  4YY3 E;  1X6E A;  1JK1 A;  2K4V A;  4KZS A;  2YTI A;  2V8Q B;  4DMI A;  4R2S A;  3EPL A;  5ADZ A;  4RHB B;  2EMK A;  2E1M A;  4R2C A;  1J5E E;  1N32 E;  2H36 X;  1T38 A;  4HTG A;  4Q28 A;  5AE3 A;  2LRS A;  2LO3 A;  1UN6 B;  2EP3 A;  1DQ3 A;  4X64 E;  2LV2 A;  2J7J A;  3ADI A;  5IT9 C;  4OOG C;  2HJJ A;  4DV7 E;  3BBG A;  4F9B B;  4JI2 E;  2EQ3 A;  1PDA A;  2FGG A;  2L3J A;  1IBK E;  4LU9 A;  2EPU A;  2LUQ A;  4DV0 E;  4BS9 A;  1XMO E;  1EH8 A;  4O4K A;  4ZYH A;  1N3G A;  4DV3 E;  4LF6 E;  1LLM C;  2EN2 A;  2EOX A;  3ADL A;  3DF6 A;  2KHX A;  1ZAA C;  2JVA A;  1F2I G;  2VF1 A;  1BBG A;  5A6B D;  1UHZ A;  4BHC A;  2MC6 A;  1WJP A;  1A1F A;  4BBY A;  1BB8 A;  2UUA E;  2V83 A;  3JTZ A;  4FK5 C;  4X8W A;  1BBO A;  1ZBT A;  1IQO A;  4WX9 A;  1YFH A;  4JI4 E;  2JR1 A;  3ECR A;  4DR7 E;  2CPN A;  2JOX A;  3EPK A;  2I13 A;  2DLK A;  2EOY A;  2EZ6 A;  3F6H A;  1O0W A;  4X65 E;  2EN6 A;  4WPY A;  3BGH A;  1SFE A;  1RQ0 A;  1MGT A;  4ZYD A;  2EL6 A;  2LMZ A;  2IHR 1;  2LT7 A;  2EOQ A;  5KL3 A;  1HR0 E;  3ADJ A;  2EPK X;  2GHF A;  1UBD C;  4L8N A;  4DV4 E;  2KOU A;  5AC4 A;  4JI1 E;  4DR4 E;  2LE2 A;  1YZ9 A;  2RS7 A;  3ZOQ B;  3MSW A;  3UK3 C;  2ENC A;  2L2N A;  2LTS A;  1QNT A;  3THO B;  5BR8 E;  5LMU E;  2ENA A;  2EPM X;  2EOE A;  2MC5 A;  2YTD A;  1DGC A;  2VE7 C;  1YUJ A;  2VRD A;  2EOH A;  2ENH A;  2FV4 B;  2L92 A;  1EH6 A;  2YT4 A;  4M0V A;  3K6Q A;  2EN3 A;  4KHP E;  1EH7 A;  2YTP A;  2Q8U A;  2EM2 A;  5KL5 A;  3J80 C;  5IV8 B;  3MHS C;  4JI7 E;  3RMP A;  5A6J A;  1T39 A;  1TF3 A;  1A1L A;  1STU A;  2EM7 A;  2ZM6 E;  2LUP B;  1WHQ A;  2EPA A;  2WCC 3;  4JI0 E;  2MKD A;  2EMB A;  2N3G A;  3IWD A;  2EL4 A;  2EMF A;  2NUE A;  2YTJ A;  5LL6 R;  1J26 A;  1IQS A;  2BB8 A;  1HNX E;  4ZYG A;  2DSY A;  2HHH E;  2E5L E;  3KZZ A;  2DMY A;  1X47 A;  1HNW E;  1YPN A;  4LF5 E;  2EQ0 A;  2L33 A;  4J8Z A;  3JU0 A;  1G2F C;  2JOB A;  1GQE A;  2R1F A;  4BCA A;  4WSP A;  1KJK A;  2HC5 A;  4ZYE A;  1NCS A;  3VYY A;  4NXM E;  2ODR C;  2NAB A;  5LLQ A;  2MKN A;  2CT1 A;  4F6M A;  2EE8 A;  4WXC A;  2R76 A;  5A6A A;  4X66 E;  4M2Z A;  4N4R B;  3VK6 A;  2ELZ A;  4O5G A;  2EPP A;  2YTN A;  2JP9 A;  2EM4 A;  2UXB E;  2YWQ A;  4NXN E;  3EQ1 A;  4DR3 E;  3EPJ A;  4AQY E;  1XNQ E;  2M4I A;  1IBL E;  3LLH A;  2EM9 A;  2EOO A;  5LMN E;  4DV2 E;  1X6F A;  4L5N C;  4LFC E;  5KL7 A;  2MDG A;  2EPN A;  2YSO A;  1WRJ A;  1XNR E;  4BC7 A;  1N34 E;  2L8T A;  1XMQ E;  2EMA A;  4LFA E;  3HTX A;  2MDR A;  2JXP A;  4WSG A;  2EN7 A;  3F6G A;  1B69 A;  1G2D C;  3ADG A;  2YU5 A;  2WZO A;  5AE2 A;  1IMU A;  2EL5 A;  4NHR A;  4TUG A;  4F2J C;  4WYQ B;  4B3S E;  3C4B A;  2WBS A;  2EPX A;  1Z1B A;  4WFT A;  1T4N A;  2V89 A;  2RS6 A;  3BID A;  2M9A A;  1PJT A;  2YZT A;  5IXM B;  2LCE A;  4P7D A;  2EOZ A;  4JV5 E;  1L4S A;  2RPC A;  4IS1 C;  2EPO A;  2UXD E;  4OX9 E;  3TQM A;  2EOJ A;  4JI5 E;  2EQ1 A;  2ADR A;  2YTQ A;  2EM8 A;  2EMY A;  5KL6 A;  2UUC E;  2L2M A;  2GLI A;  1ZR9 A;  1HNZ E;  4TUI A;  5T6J A;  4F9A B;  1YYK A;  2RQL A;  4DV5 E;  3AUZ A;  2G7H A;  4JI3 E; 
#chains in the Genus database with same CATH homology
 1X47 A;  1HNW E;  4LF5 E;  4DV3 E;  4LF6 E;  3J7Y p;  1PKP A;  2KON A;  1WHN A;  1GZ6 A;  2L33 A;  3IWB A;  3KWR A;  2N3H A;  4GKJ E;  3P1X A;  3JU0 A;  4J8Z A;  2VQF E;  3DF6 A;  3ADL A;  2JOB A;  2KHX A;  1GQE A;  1YYO A;  2JVA A;  3IWC A;  2B3T B;  4BCA A;  2VF1 A;  4WSP A;  4LTY A;  4F9C B;  1UHZ A;  2B9D A;  2MC6 A;  2LTR A;  5F3W A;  4GEQ B;  4BMJ A;  4LFB E;  3C4T A;  2F4V E;  4BBY A;  1N36 E;  2UUA E;  2JY9 A;  2V87 A;  2V83 A;  3VYY A;  1EKZ A;  4NXM E;  2ODR C;  3JTZ A;  1YZ9 A;  2B7V A;  4B3M E;  2LJH A;  4X8W A;  4DUZ E;  2M1S A;  2RSM A;  3J81 C;  1ZBT A;  5DNY A;  4R8O A;  4JI4 E;  2JR1 A;  1X49 A;  4X66 E;  1XMO E;  4GKK E;  4DKK A;  4M2Z A;  2CPN A;  4DR7 E;  2JOX A;  3VK6 A;  1QU6 A;  2EZ6 A;  4DR5 E;  2M7Q A;  3F6H A;  2VQE E;  1O0W A;  4X65 E;  3JAM C;  2F8B A;  4P78 A;  4WPY A;  1ZBQ A;  3DJW A;  1RC7 A;  1RQ0 A;  2UXB E;  2LMZ A;  1YYW A;  2IHR 1;  3H09 A;  4NXN E;  4DR3 E;  5FLX C;  3FIG A;  1HR0 E;  3ADJ A;  4AQY E;  3OML A;  4B3T E;  4L8N A;  4DV4 E;  1XNQ E;  2M4I A;  1IBL E;  2V88 A;  2KOU A;  3LLH A;  5A2Q C;  2NUF A;  4DR2 E;  5LMN E;  4JI1 E;  4DV2 E;  4LF9 E;  4L5N C;  4K0K E;  1SR9 A;  3HQ1 A;  4LFC E;  2G7H A;  4DR4 E;  5AE1 A;  2LE2 A;  2RTX A;  3LML A;  2UXC E;  4I8O A;  3VYX A;  3HPZ A;  2RS7 A;  3ZOQ B;  2B7T A;  4DV1 E;  4BC7 A;  4DV6 E;  1XNR E;  1N34 E;  1I94 E;  2L8T A;  3HXL A;  3HPS A;  4B3R E;  2DB2 A;  1XMQ E;  3MSW A;  4LFA E;  5CFF E;  1T4O A;  3HTX A;  1FJG E;  4R03 A;  2MDR A;  1T4L B;  2JWO A;  2L2N A;  2LTS A;  3F6G A;  2UUB E;  4LF4 E;  3ADG A;  4F54 A;  1IBM E;  2EWL A;  5BR8 E;  2WZO A;  5LMU E;  5AE2 A;  4DR6 E;  1DI2 A;  4BC9 A;  2ODR D;  1N33 E;  4LF7 E;  5AAS A;  4TUG A;  4WYQ B;  4X62 E;  2V85 A;  4B3S E;  3C4B A;  2MC5 A;  4YHH E;  4WFT A;  4LF8 E;  1FKA E;  2VE7 C;  1T4N A;  2V89 A;  2UU9 E;  4YY3 E;  1WXR A;  3T1Y E;  3AV0 A;  4M30 A;  1UIL A;  1X48 A;  2K4V A;  2FV4 B;  4KZS A;  4DUY E;  2V8Q B;  4DMI A;  2L92 A;  4JI6 E;  5ADZ A;  2L6M A;  2RS6 A;  2YT4 A;  4M0V A;  2E1M A;  3K6Q A;  4KHP E;  2DIX A;  1J5E E;  1N32 E;  2H36 X;  2L2K B;  2YZT A;  4Q28 A;  5AE3 A;  2LRS A;  4P7D A;  3J80 C;  4JV5 E;  4JI7 E;  3RMP A;  1DQ3 A;  1STU A;  2UXD E;  4OX9 E;  4X64 E;  2ZM6 E;  2LUP B;  3T1H E;  1WHQ A;  4JI5 E;  5IWA E;  3OTO E;  3ADI A;  4JI0 E;  5IT9 C;  4OOG C;  2N3G A;  4JYA E;  2UUC E;  3J7A G;  2L2M A;  3IWD A;  4DR1 E;  2NUG A;  4JI8 E;  4DV7 E;  4F9B B;  2NUE A;  1HNZ E;  4TUI A;  5LL6 R;  5T6J A;  4F9A B;  4JI2 E;  1HNX E;  1YYK A;  1J26 A;  2DSY A;  4DV5 E;  2FGG A;  2L3J A;  2HHH E;  2L3C A;  1IBK E;  4LU9 A;  2NA2 A;  3AUZ A;  2E5L E;  2LBS B;  2LUQ A;  4DV0 E;  2DMY A;  2V86 A;  4BS9 A;  4JI3 E;  2FTX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...