3ADLA

Structure of trbp2 and its molecule implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
GLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RISC-loading complex subunit TARBP2
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adlA01
2L2KB 1T4OA 2UXCE 4DUZE 3P1XA 4KHPE 1HNWE 1XMOE 2ZM6E 3ADJA 1XNRE 1IBKE 1PKPA 4AQYE 4JYAE 2RS7A 2B3TB 1IBME 4OOGC 2CPNA 4B3SE 3ADGA 3OTOE 4JI4E 2VQFE 2LUPB 2UUBE 2NUFA 4DV2E 4DV4E 2RS6A 5BR8E 2LTSA 4DV1E 1WHNA 1RC7A 1QU6A 2RSMA 4GKJE 1HNZE 4LF5E 3VYXA 4DR7E 1UHZA 4X62E 2UUCE 1N32E 3C4BA 1XMQE 2L2MA 1FKAE 2N3HA 2YT4A 4DV0E 1IBLE 4JI0E 1ZBTA 1UILA 4DV6E 4LF7E 4LFCE 1YYOA 5IWAE 2UUAE 4K0KE 4NXME 4JI3E 2DIXA 1EKZA 4JI5E 1YYKA 4LF6E 4DUYE 4DR1E 2NUGA 2B7TA 1XNQE 3ADIA 2N3GA 1X48A 2UXBE 1I94E 2KHXA 3ADLA 2JVAA 4LF9E 2MDRA 3HTXA 4JV5E 1HR0E 4GKKE 3LLHA 3J7Yp 1X49A 4M30A 1N33E 2L3JA 1O0WA 1DI2A 4DV3E 3VYYA 1J5EE 2LBSB 4X8WA 4LFAE 3T1YE 1N34E 1J26A 4DR4E 2LTRA 5CFFE 4JI1E 4X66E 1RQ0A 4B3ME 2UXDE 1WHQA 1STUA 4YY3E 2NUEA 2L33A 4DR6E 3T1HE 2F4VE 4X64E 2E5LE 4M2ZA 4NXNE 2LRSA 4YHHE 4JI8E 5LMNE 1YYWA 4LF8E 4DV7E 4WFTA 2HHHE 1YZ9A 2IHR1 4JI2E 2DB2A 2NA2A 4DR2E 1HNXE 4JI6E 2LUQA 4X65E 1X47A 2L3CA 2LJHA 4WYQB 2L2NA 4DKKA 4LF4E 2B7VA 1N36E 3C4TA 2DMYA 2RTXA 1GQEA 4JI7E 2VQEE 5LMUE 1FJGE 4DR5E 4B3RE 2JY9A 4OX9E 4LFBE 1T4LB 2EZ6A 4DV5E 4B3TE 2UU9E 4DR3E 1T4NA
chains in the Genus database with same CATH superfamily
2YTIA 1KJKA 2DRPA 2EMKA 2UXCE 3P1XA 1HNWE 2V85A 2ZM6E 1PJSA 1TF3A 1N3GA 1WRJA 3MSWA 2EN6A 4WX9A 5AE1A 4KWYA 3M99B 3OTOE 2EOOA 2RS6A 2YRMA 5BR8E 2LTSA 4DV1E 3H09A 1RC7A 1WJPA 4Q28A 3FIGA 5AASA 4GKJE 2MDGA 1BB8A 1T39A 2CTDA 4X62E 4I8OA 1FKAE 2L2MA 1ZAAC 2YTFA 1MGTA 2V83A 4P78A 2YU8A 1ZBTA 3EPJA 1QNTA 1UILA 2EL5A 2MC6A 2F8BA 2YTPA 3JAMC 1L4SA 4DV6E 2ENCA 4MLVA 4WXCA 2M7QA 2V86A 3JU0A 1NCSA 4TUIA 4JI3E 3TQMA 1EKZA 2EMFA 2LJUA 2EMXA 1A1GA 1IQSA 2YTEA 1SR9A 2LCEA 2V89A 2EMWA 2KHXA 2EPPA 3C6MA 2EOMA 2EPMX 4JV5E 2L6MA 4M0VA 1BBGA 2EPLX 3LLHA 3J7Yp 1O0WA 2YTOA 4LU9A 2EPKX 3ZOQB 2JWOA 2RQLA 4LTYA 4R8OA 4R2RA 1N34E 2LO3A 4DR4E 3MHHC 4JI1E 4WXDA 5A6AA 2ENAA 4B3ME 3KWRA 4DR6E 2F4VE 4NXNE 4YHHE 2EOFA 2EQ3A 2EMYA 1SFEA 1BBOA 2KOUA 5IV8B 2EL4A 2HHHE 1IMUA 2NA2A 1P47A 5TSEA 2EN3A 2EOEA 2K7IA 4X65E 1X47A 4WYQB 1N36E 2DMYA 2RTXA 3AUZA 5KL4A 4JI7E 3DF6A 4B3RE 4LFBE 1TN9A 2EZ6A 3HPSA 2EQ1A 4J8ZA 2L2KB 1ZBQA 1JK2A 1IQOA 4KHPE 2JYAA 5KL7A 2ELYA 5IXMB 3EPHA 1PKPA 4AQYE 2YWQA 4JYAE 2B3TB 2E72A 4OOGC 3ADGA 2EM2A 4L5NC 4RHBB 1A1JA 2VQFE 2LUPB 1UN6B 2UUBE 4DV4E 3F6GA 1GZ6A 1QU6A 2JPAA 3MHSC 2GLIA 2G7HA 2KONA 4Q35B 1HNZE 4LF5E 2NABA 3VYXA 4N4RB 4DR7E 2DMIA 2EOSA 3EPKA 3J81C 1XMQE 2EN2A 2N3HA 4DV0E 1IBLE 2K4VA 2EMIA 3JTZA 5A6JA 2EOZA 4FK5C 2EMBA 4ZYDA 2HJJA 3VK6A 4LF7E 2EPUA 3AV0A 1YYOA 2I9IA 4K0KE 2M9AA 2ENHA 2Q8UA 4LF6E 4DUYE 1A1HA 4BC7A 5F3WA 4F6MA 2L92A 4O5GA 5KL3A 3ADIA 3IWBA 2N3GA 5AE3A 2UXBE 2EJ4A 2WZOA 5A6KA 4LF9E 2MDRA 3HTXA 2YPNA 1YFHA 4ZYGA 4TUGA 5AC5A 4F2JC 4RH8A 2M1SA 4O24A 3C6KA 4R2AA 1DI2A 4HEIA 1ZR9A 4F54A 2WCC3 1J5EE 4X8WA 4WSGA 1WXRA 4F9CB 4IS1C 2LVHA 2LTRA 2YU5A 3QG5C 2EPXA 1WHQA 2EOHA 1X6EA 2DLKA 2GPIA 3KZZA 4M2ZA 1YUIA 2J7JA 1YZ9A 1ZU1A 3DJWA 4BS9A 1HNXE 4BC9A 2YSOA 2JXPA 2L2NA 4DKKA 2B7VA 2EWLA 3C4TA 1GQEA 1T38A 2VRDA 2EPOA 2DSYA 2JY9A 1UBDC 3BGHA 4DV5E 4DR3E 1T4NA 2EPAA 3F6HA 2GHFA 1T4OA 2EPRA 2JOXA 4BMJA 5KL2A 1XNRE 2MKNA 2EMGA 2LV2A 3THNA 3BIDA 2EOIA 4ZYHA 2EOXA 4B3SE 2FTXB 3RMPA 5ADZA 4NZVA 3IWDA 2HC5A 1Z1BA 1KYQA 1UHZA 1YUJA 1N32E 2CSHA 3C4BA 2L8TA 2YT4A 2EE8A 5LL6R 4O4KA 4JI0E 4WPYA 3OMLA 2EQ0A 1YPNA 1PDAA 5A2QC 2CT1A 4KZSA 2EPCA 2EN8A 3KZYA 2EOQA 1YYKA 4DMIA 1G2FC 4M9VC 2NUGA 5A69A 1X5WA 2JVAA 1NEIA 4BBYA 4R2CA 1HR0E 2EPZA 4M30A 2EOJA 2LE2A 2ELZA 2YTGA 4DV3E 2R1FA 2BB8A 2FGGA 2DGCA 4X9JA 2H36X 2EL6A 2M4IA 3T1YE 1A1KA 2E1MA 1RQ0A 3HXLA 1A1LA 3EPLA 1JK1A 1STUA 2L33A 1DQ3A 1EH7A 2YRKA 4X64E 2E5LE 2LRSA 1PJTA 4F9AB 2I13A 2B9DA 5LMNE 2EM3A 3UK3C 4DV7E 4WFTA 1RMDA 4WSPA 2IHR1 4DR2E 2HGHA 4JI6E 4GEQB 2LT7A 2LJHA 3K6QA 4LF4E 2YTDA 4R03A 1AH5A 1G2DC 3J7AG 2VQEE 2EPNA 1FJGE 4ZYEA 4DR5E 4OX9E 2VF1A 2YZTA 2YTNA 5LLQA 2EN7A 4NHRA 5KL5A 4DUZE 4GZNC 1B69A 3LMLA 2D9HA 3ADJA 1X6FA 1IBKE 2RS7A 2EM9A 2BBGA 1IBME 2WBTA 5KL6A 4BCAA 2CPNA 3EQ1A 3J80C 4JI4E 2NUFA 4DV2E 2EMZA 1WHNA 1EH8A 2MKDA 4IJDA 1DGCA 2RSMA 4R2SA 2V8QB 4HTGA 1YSAC 1F2IG 2ODRD 2JR1A 2UUCE 2EM6A 2RSIA 2R76A 2YSPA 4O43A 2A25A 2YTJA 2JOBA 4F9BB 3L00A 5AE2A 2DLQA 4MLQA 3THOB 4R2EA 4LFCE 5IWAE 2YTQA 2PRTA 2V88A 2UUAE 2EMLA 3IWCA 1AAYA 4NXME 2RPCA 2DIXA 4JI5E 5FLXC 4BHBA 1TF6A 4DR1E 5DNYA 2B7TA 1XNQE 1X48A 2EM7A 4BHCA 1I94E 1A1FA 2EOYA 3ADLA 4P7DA 3ECRA 4R2QA 2N8XA 2WBSA 4GKKE 1X49A 2V87A 2EN1A 5T6JA 1N33E 4L8NA 5A6BA 2L3JA 2EMCA 2EORA 3HPZA 3VYYA 2LBSB 2EM4A 4LFAE 3BF2A 1MEYC 1X3CA 3BBGA 2YRHA 1J26A 2EM5A 5CFFE 2EMHA 4X66E 5IT9C 3VHTB 2EP3A 2EMAA 2UXDE 4YY3E 2NUEA 2ADRA 3T1HE 4JI8E 3HQ1A 1A1IA 2EN4A 2LMZA 4LF8E 1YYWA 5A6BD 2EM8A 4JI2E 2DB2A 4R2PA 5AC4A 2LUQA 2MC5A 2VE7C 2FV4B 2L3CA 2WBUA 2JP9A 1X6HA 2ODRC 4R2DA 2EM0A 1LLMC 5LMUE 4F6NA 1PJQA 1T4LB 1XMOE 4B3TE 2UU9E 1EH6A 1GTKA
chains in the Genus database with same CATH topology
3F6HA 2L2KB 1ZBQA 1T4OA 2UXCE 4DUZE 3P1XA 4KHPE 1HNWE 2JOXA 2V85A 4BMJA 2ZM6E 1XMOE 3LMLA 3ADJA 1XNRE 1IBKE 3MSWA 1PKPA 4AQYE 4JYAE 2RS7A 2B3TB 1IBME 4OOGC 4BCAA 5AE1A 2CPNA 4B3SE 3ADGA 2FTXB 4L5NC 3J80C 3OTOE 4JI4E 2VQFE 2LUPB 3RMPA 2UUBE 2NUFA 4DV2E 4DV4E 2RS6A 5ADZA 3F6GA 2LTSA 5BR8E 4DV1E 1WHNA 3H09A 1QU6A 1GZ6A 3IWDA 1RC7A 2RSMA 4Q28A 2V8QB 3FIGA 5AASA 2G7HA 4GKJE 2KONA 1HNZE 4LF5E 3VYXA 4DR7E 1UHZA 4X62E 2ODRD 2JR1A 2UUCE 1N32E 4I8OA 3J81C 3C4BA 1XMQE 2L2MA 2L8TA 2N3HA 2YT4A 1FKAE 5LL6R 4DV0E 2K4VA 1IBLE 2UU9E 4JI0E 2JOBA 4F9BB 2V83A 3JTZA 4P78A 5AE2A 1ZBTA 1UILA 4WPYA 2MC6A 2F8BA 3JAMC 3OMLA 4DV6E 3VK6A 4LF7E 3AV0A 4LFCE 1YYOA 5IWAE 2M7QA 2V88A 5A2QC 2V86A 2UUAE 3IWCA 4KZSA 4K0KE 3JU0A 4TUIA 4JI3E 4NXME 2DIXA 1EKZA 5FLXC 4JI5E 1YYKA 4LF6E 4DMIA 4DUYE 4DR1E 5DNYA 4BC7A 5F3WA 2L92A 2NUGA 2B7TA 1XNQE 3ADIA 3IWBA 2N3GA 1X48A 5AE3A 2UXBE 1SR9A 1I94E 2WZOA 2V89A 2KHXA 3ADLA 2JVAA 4P7DA 2MDRA 4LF9E 3HTXA 4JV5E 2L6MA 4M0VA 4TUGA 4BBYA 1HR0E 4GKKE 3LLHA 3J7Yp 1X49A 2V87A 2M1SA 5T6JA 4M30A 4L8NA 2L3JA 1N33E 1O0WA 2LE2A 4LU9A 3ZOQB 3HPZA 1DI2A 2JWOA 4LTYA 4F54A 4DV3E 4R8OA 3VYYA 1J5EE 2LBSB 2FGGA 4X8WA 1WXRA 4LFAE 3T1YE 2H36X 2M4IA 4F9CB 1N34E 1J26A 4DR4E 2E1MA 2LTRA 5CFFE 4JI1E 4X66E 1RQ0A 3HXLA 5IT9C 4B3ME 2UXDE 1WHQA 3KWRA 1STUA 4YY3E 2NUEA 2L33A 1DQ3A 4DR6E 3T1HE 2F4VE 4X64E 2E5LE 4M2ZA 4NXNE 2LRSA 4YHHE 4JI8E 3HQ1A 4F9AB 2B9DA 2LMZA 2KOUA 5LMNE 4DV7E 4LF8E 1YYWA 4WFTA 2HHHE 1YZ9A 4WSPA 2IHR1 4JI2E 2DB2A 3DJWA 2NA2A 4BS9A 4DR2E 4BC9A 1HNXE 4JI6E 2LUQA 2MC5A 2VE7C 4GEQB 2FV4B 1X47A 4X65E 2L3CA 2LJHA 3K6QA 4WYQB 2L2NA 4DKKA 4LF4E 2B7VA 2EWLA 1N36E 2ODRC 2DMYA 2RTXA 1GQEA 3C4TA 4R03A 3AUZA 4JI7E 2VQEE 3J7AG 5LMUE 2DSYA 1FJGE 3DF6A 4DR5E 2JY9A 4OX9E 4B3RE 4LFBE 2VF1A 1T4LB 2EZ6A 4DV5E 4B3TE 3HPSA 2YZTA 4DR3E 1T4NA 4J8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2K B;  1T4O A;  2UXC E;  4DUZ E;  3P1X A;  4KHP E;  1HNW E;  1XMO E;  2ZM6 E;  3ADJ A;  1XNR E;  1IBK E;  1PKP A;  4AQY E;  4JYA E;  2RS7 A;  2B3T B;  1IBM E;  4OOG C;  2CPN A;  4B3S E;  3ADG A;  3OTO E;  4JI4 E;  2VQF E;  2LUP B;  2UUB E;  2NUF A;  4DV2 E;  4DV4 E;  2RS6 A;  5BR8 E;  2LTS A;  4DV1 E;  1WHN A;  1RC7 A;  1QU6 A;  2RSM A;  4GKJ E;  1HNZ E;  4LF5 E;  3VYX A;  4DR7 E;  1UHZ A;  4X62 E;  2UUC E;  1N32 E;  3C4B A;  1XMQ E;  2L2M A;  1FKA E;  2N3H A;  2YT4 A;  4DV0 E;  1IBL E;  4JI0 E;  1ZBT A;  1UIL A;  4DV6 E;  4LF7 E;  4LFC E;  1YYO A;  5IWA E;  2UUA E;  4K0K E;  4NXM E;  4JI3 E;  2DIX A;  1EKZ A;  4JI5 E;  1YYK A;  4LF6 E;  4DUY E;  4DR1 E;  2NUG A;  2B7T A;  1XNQ E;  3ADI A;  2N3G A;  1X48 A;  2UXB E;  1I94 E;  2KHX A;  3ADL A;  2JVA A;  4LF9 E;  2MDR A;  3HTX A;  4JV5 E;  1HR0 E;  4GKK E;  3LLH A;  3J7Y p;  1X49 A;  4M30 A;  1N33 E;  2L3J A;  1O0W A;  1DI2 A;  4DV3 E;  3VYY A;  1J5E E;  2LBS B;  4X8W A;  4LFA E;  3T1Y E;  1N34 E;  1J26 A;  4DR4 E;  2LTR A;  5CFF E;  4JI1 E;  4X66 E;  1RQ0 A;  4B3M E;  2UXD E;  1WHQ A;  1STU A;  4YY3 E;  2NUE A;  2L33 A;  4DR6 E;  3T1H E;  2F4V E;  4X64 E;  2E5L E;  4M2Z A;  4NXN E;  2LRS A;  4YHH E;  4JI8 E;  5LMN E;  1YYW A;  4LF8 E;  4DV7 E;  4WFT A;  2HHH E;  1YZ9 A;  2IHR 1;  4JI2 E;  2DB2 A;  2NA2 A;  4DR2 E;  1HNX E;  4JI6 E;  2LUQ A;  4X65 E;  1X47 A;  2L3C A;  2LJH A;  4WYQ B;  2L2N A;  4DKK A;  4LF4 E;  2B7V A;  1N36 E;  3C4T A;  2DMY A;  2RTX A;  1GQE A;  4JI7 E;  2VQE E;  5LMU E;  1FJG E;  4DR5 E;  4B3R E;  2JY9 A;  4OX9 E;  4LFB E;  1T4L B;  2EZ6 A;  4DV5 E;  4B3T E;  2UU9 E;  4DR3 E;  1T4N A; 
#chains in the Genus database with same CATH topology
 2YTI A;  1KJK A;  2DRP A;  2EMK A;  2UXC E;  3P1X A;  1HNW E;  2V85 A;  2ZM6 E;  1PJS A;  1TF3 A;  1N3G A;  1WRJ A;  3MSW A;  2EN6 A;  4WX9 A;  5AE1 A;  4KWY A;  3M99 B;  3OTO E;  2EOO A;  2RS6 A;  2YRM A;  5BR8 E;  2LTS A;  4DV1 E;  3H09 A;  1RC7 A;  1WJP A;  4Q28 A;  3FIG A;  5AAS A;  4GKJ E;  2MDG A;  1BB8 A;  1T39 A;  2CTD A;  4X62 E;  4I8O A;  1FKA E;  2L2M A;  1ZAA C;  2YTF A;  1MGT A;  2V83 A;  4P78 A;  2YU8 A;  1ZBT A;  3EPJ A;  1QNT A;  1UIL A;  2EL5 A;  2MC6 A;  2F8B A;  2YTP A;  3JAM C;  1L4S A;  4DV6 E;  2ENC A;  4MLV A;  4WXC A;  2M7Q A;  2V86 A;  3JU0 A;  1NCS A;  4TUI A;  4JI3 E;  3TQM A;  1EKZ A;  2EMF A;  2LJU A;  2EMX A;  1A1G A;  1IQS A;  2YTE A;  1SR9 A;  2LCE A;  2V89 A;  2EMW A;  2KHX A;  2EPP A;  3C6M A;  2EOM A;  2EPM X;  4JV5 E;  2L6M A;  4M0V A;  1BBG A;  2EPL X;  3LLH A;  3J7Y p;  1O0W A;  2YTO A;  4LU9 A;  2EPK X;  3ZOQ B;  2JWO A;  2RQL A;  4LTY A;  4R8O A;  4R2R A;  1N34 E;  2LO3 A;  4DR4 E;  3MHH C;  4JI1 E;  4WXD A;  5A6A A;  2ENA A;  4B3M E;  3KWR A;  4DR6 E;  2F4V E;  4NXN E;  4YHH E;  2EOF A;  2EQ3 A;  2EMY A;  1SFE A;  1BBO A;  2KOU A;  5IV8 B;  2EL4 A;  2HHH E;  1IMU A;  2NA2 A;  1P47 A;  5TSE A;  2EN3 A;  2EOE A;  2K7I A;  4X65 E;  1X47 A;  4WYQ B;  1N36 E;  2DMY A;  2RTX A;  3AUZ A;  5KL4 A;  4JI7 E;  3DF6 A;  4B3R E;  4LFB E;  1TN9 A;  2EZ6 A;  3HPS A;  2EQ1 A;  4J8Z A;  2L2K B;  1ZBQ A;  1JK2 A;  1IQO A;  4KHP E;  2JYA A;  5KL7 A;  2ELY A;  5IXM B;  3EPH A;  1PKP A;  4AQY E;  2YWQ A;  4JYA E;  2B3T B;  2E72 A;  4OOG C;  3ADG A;  2EM2 A;  4L5N C;  4RHB B;  1A1J A;  2VQF E;  2LUP B;  1UN6 B;  2UUB E;  4DV4 E;  3F6G A;  1GZ6 A;  1QU6 A;  2JPA A;  3MHS C;  2GLI A;  2G7H A;  2KON A;  4Q35 B;  1HNZ E;  4LF5 E;  2NAB A;  3VYX A;  4N4R B;  4DR7 E;  2DMI A;  2EOS A;  3EPK A;  3J81 C;  1XMQ E;  2EN2 A;  2N3H A;  4DV0 E;  1IBL E;  2K4V A;  2EMI A;  3JTZ A;  5A6J A;  2EOZ A;  4FK5 C;  2EMB A;  4ZYD A;  2HJJ A;  3VK6 A;  4LF7 E;  2EPU A;  3AV0 A;  1YYO A;  2I9I A;  4K0K E;  2M9A A;  2ENH A;  2Q8U A;  4LF6 E;  4DUY E;  1A1H A;  4BC7 A;  5F3W A;  4F6M A;  2L92 A;  4O5G A;  5KL3 A;  3ADI A;  3IWB A;  2N3G A;  5AE3 A;  2UXB E;  2EJ4 A;  2WZO A;  5A6K A;  4LF9 E;  2MDR A;  3HTX A;  2YPN A;  1YFH A;  4ZYG A;  4TUG A;  5AC5 A;  4F2J C;  4RH8 A;  2M1S A;  4O24 A;  3C6K A;  4R2A A;  1DI2 A;  4HEI A;  1ZR9 A;  4F54 A;  2WCC 3;  1J5E E;  4X8W A;  4WSG A;  1WXR A;  4F9C B;  4IS1 C;  2LVH A;  2LTR A;  2YU5 A;  3QG5 C;  2EPX A;  1WHQ A;  2EOH A;  1X6E A;  2DLK A;  2GPI A;  3KZZ A;  4M2Z A;  1YUI A;  2J7J A;  1YZ9 A;  1ZU1 A;  3DJW A;  4BS9 A;  1HNX E;  4BC9 A;  2YSO A;  2JXP A;  2L2N A;  4DKK A;  2B7V A;  2EWL A;  3C4T A;  1GQE A;  1T38 A;  2VRD A;  2EPO A;  2DSY A;  2JY9 A;  1UBD C;  3BGH A;  4DV5 E;  4DR3 E;  1T4N A;  2EPA A;  3F6H A;  2GHF A;  1T4O A;  2EPR A;  2JOX A;  4BMJ A;  5KL2 A;  1XNR E;  2MKN A;  2EMG A;  2LV2 A;  3THN A;  3BID A;  2EOI A;  4ZYH A;  2EOX A;  4B3S E;  2FTX B;  3RMP A;  5ADZ A;  4NZV A;  3IWD A;  2HC5 A;  1Z1B A;  1KYQ A;  1UHZ A;  1YUJ A;  1N32 E;  2CSH A;  3C4B A;  2L8T A;  2YT4 A;  2EE8 A;  5LL6 R;  4O4K A;  4JI0 E;  4WPY A;  3OML A;  2EQ0 A;  1YPN A;  1PDA A;  5A2Q C;  2CT1 A;  4KZS A;  2EPC A;  2EN8 A;  3KZY A;  2EOQ A;  1YYK A;  4DMI A;  1G2F C;  4M9V C;  2NUG A;  5A69 A;  1X5W A;  2JVA A;  1NEI A;  4BBY A;  4R2C A;  1HR0 E;  2EPZ A;  4M30 A;  2EOJ A;  2LE2 A;  2ELZ A;  2YTG A;  4DV3 E;  2R1F A;  2BB8 A;  2FGG A;  2DGC A;  4X9J A;  2H36 X;  2EL6 A;  2M4I A;  3T1Y E;  1A1K A;  2E1M A;  1RQ0 A;  3HXL A;  1A1L A;  3EPL A;  1JK1 A;  1STU A;  2L33 A;  1DQ3 A;  1EH7 A;  2YRK A;  4X64 E;  2E5L E;  2LRS A;  1PJT A;  4F9A B;  2I13 A;  2B9D A;  5LMN E;  2EM3 A;  3UK3 C;  4DV7 E;  4WFT A;  1RMD A;  4WSP A;  2IHR 1;  4DR2 E;  2HGH A;  4JI6 E;  4GEQ B;  2LT7 A;  2LJH A;  3K6Q A;  4LF4 E;  2YTD A;  4R03 A;  1AH5 A;  1G2D C;  3J7A G;  2VQE E;  2EPN A;  1FJG E;  4ZYE A;  4DR5 E;  4OX9 E;  2VF1 A;  2YZT A;  2YTN A;  5LLQ A;  2EN7 A;  4NHR A;  5KL5 A;  4DUZ E;  4GZN C;  1B69 A;  3LML A;  2D9H A;  3ADJ A;  1X6F A;  1IBK E;  2RS7 A;  2EM9 A;  2BBG A;  1IBM E;  2WBT A;  5KL6 A;  4BCA A;  2CPN A;  3EQ1 A;  3J80 C;  4JI4 E;  2NUF A;  4DV2 E;  2EMZ A;  1WHN A;  1EH8 A;  2MKD A;  4IJD A;  1DGC A;  2RSM A;  4R2S A;  2V8Q B;  4HTG A;  1YSA C;  1F2I G;  2ODR D;  2JR1 A;  2UUC E;  2EM6 A;  2RSI A;  2R76 A;  2YSP A;  4O43 A;  2A25 A;  2YTJ A;  2JOB A;  4F9B B;  3L00 A;  5AE2 A;  2DLQ A;  4MLQ A;  3THO B;  4R2E A;  4LFC E;  5IWA E;  2YTQ A;  2PRT A;  2V88 A;  2UUA E;  2EML A;  3IWC A;  1AAY A;  4NXM E;  2RPC A;  2DIX A;  4JI5 E;  5FLX C;  4BHB A;  1TF6 A;  4DR1 E;  5DNY A;  2B7T A;  1XNQ E;  1X48 A;  2EM7 A;  4BHC A;  1I94 E;  1A1F A;  2EOY A;  3ADL A;  4P7D A;  3ECR A;  4R2Q A;  2N8X A;  2WBS A;  4GKK E;  1X49 A;  2V87 A;  2EN1 A;  5T6J A;  1N33 E;  4L8N A;  5A6B A;  2L3J A;  2EMC A;  2EOR A;  3HPZ A;  3VYY A;  2LBS B;  2EM4 A;  4LFA E;  3BF2 A;  1MEY C;  1X3C A;  3BBG A;  2YRH A;  1J26 A;  2EM5 A;  5CFF E;  2EMH A;  4X66 E;  5IT9 C;  3VHT B;  2EP3 A;  2EMA A;  2UXD E;  4YY3 E;  2NUE A;  2ADR A;  3T1H E;  4JI8 E;  3HQ1 A;  1A1I A;  2EN4 A;  2LMZ A;  4LF8 E;  1YYW A;  5A6B D;  2EM8 A;  4JI2 E;  2DB2 A;  4R2P A;  5AC4 A;  2LUQ A;  2MC5 A;  2VE7 C;  2FV4 B;  2L3C A;  2WBU A;  2JP9 A;  1X6H A;  2ODR C;  4R2D A;  2EM0 A;  1LLM C;  5LMU E;  4F6N A;  1PJQ A;  1T4L B;  1XMO E;  4B3T E;  2UU9 E;  1EH6 A;  1GTK A; 
#chains in the Genus database with same CATH homology
 3F6H A;  2L2K B;  1ZBQ A;  1T4O A;  2UXC E;  4DUZ E;  3P1X A;  4KHP E;  1HNW E;  2JOX A;  2V85 A;  4BMJ A;  2ZM6 E;  1XMO E;  3LML A;  3ADJ A;  1XNR E;  1IBK E;  3MSW A;  1PKP A;  4AQY E;  4JYA E;  2RS7 A;  2B3T B;  1IBM E;  4OOG C;  4BCA A;  5AE1 A;  2CPN A;  4B3S E;  3ADG A;  2FTX B;  4L5N C;  3J80 C;  3OTO E;  4JI4 E;  2VQF E;  2LUP B;  3RMP A;  2UUB E;  2NUF A;  4DV2 E;  4DV4 E;  2RS6 A;  5ADZ A;  3F6G A;  2LTS A;  5BR8 E;  4DV1 E;  1WHN A;  3H09 A;  1QU6 A;  1GZ6 A;  3IWD A;  1RC7 A;  2RSM A;  4Q28 A;  2V8Q B;  3FIG A;  5AAS A;  2G7H A;  4GKJ E;  2KON A;  1HNZ E;  4LF5 E;  3VYX A;  4DR7 E;  1UHZ A;  4X62 E;  2ODR D;  2JR1 A;  2UUC E;  1N32 E;  4I8O A;  3J81 C;  3C4B A;  1XMQ E;  2L2M A;  2L8T A;  2N3H A;  2YT4 A;  1FKA E;  5LL6 R;  4DV0 E;  2K4V A;  1IBL E;  2UU9 E;  4JI0 E;  2JOB A;  4F9B B;  2V83 A;  3JTZ A;  4P78 A;  5AE2 A;  1ZBT A;  1UIL A;  4WPY A;  2MC6 A;  2F8B A;  3JAM C;  3OML A;  4DV6 E;  3VK6 A;  4LF7 E;  3AV0 A;  4LFC E;  1YYO A;  5IWA E;  2M7Q A;  2V88 A;  5A2Q C;  2V86 A;  2UUA E;  3IWC A;  4KZS A;  4K0K E;  3JU0 A;  4TUI A;  4JI3 E;  4NXM E;  2DIX A;  1EKZ A;  5FLX C;  4JI5 E;  1YYK A;  4LF6 E;  4DMI A;  4DUY E;  4DR1 E;  5DNY A;  4BC7 A;  5F3W A;  2L92 A;  2NUG A;  2B7T A;  1XNQ E;  3ADI A;  3IWB A;  2N3G A;  1X48 A;  5AE3 A;  2UXB E;  1SR9 A;  1I94 E;  2WZO A;  2V89 A;  2KHX A;  3ADL A;  2JVA A;  4P7D A;  2MDR A;  4LF9 E;  3HTX A;  4JV5 E;  2L6M A;  4M0V A;  4TUG A;  4BBY A;  1HR0 E;  4GKK E;  3LLH A;  3J7Y p;  1X49 A;  2V87 A;  2M1S A;  5T6J A;  4M30 A;  4L8N A;  2L3J A;  1N33 E;  1O0W A;  2LE2 A;  4LU9 A;  3ZOQ B;  3HPZ A;  1DI2 A;  2JWO A;  4LTY A;  4F54 A;  4DV3 E;  4R8O A;  3VYY A;  1J5E E;  2LBS B;  2FGG A;  4X8W A;  1WXR A;  4LFA E;  3T1Y E;  2H36 X;  2M4I A;  4F9C B;  1N34 E;  1J26 A;  4DR4 E;  2E1M A;  2LTR A;  5CFF E;  4JI1 E;  4X66 E;  1RQ0 A;  3HXL A;  5IT9 C;  4B3M E;  2UXD E;  1WHQ A;  3KWR A;  1STU A;  4YY3 E;  2NUE A;  2L33 A;  1DQ3 A;  4DR6 E;  3T1H E;  2F4V E;  4X64 E;  2E5L E;  4M2Z A;  4NXN E;  2LRS A;  4YHH E;  4JI8 E;  3HQ1 A;  4F9A B;  2B9D A;  2LMZ A;  2KOU A;  5LMN E;  4DV7 E;  4LF8 E;  1YYW A;  4WFT A;  2HHH E;  1YZ9 A;  4WSP A;  2IHR 1;  4JI2 E;  2DB2 A;  3DJW A;  2NA2 A;  4BS9 A;  4DR2 E;  4BC9 A;  1HNX E;  4JI6 E;  2LUQ A;  2MC5 A;  2VE7 C;  4GEQ B;  2FV4 B;  1X47 A;  4X65 E;  2L3C A;  2LJH A;  3K6Q A;  4WYQ B;  2L2N A;  4DKK A;  4LF4 E;  2B7V A;  2EWL A;  1N36 E;  2ODR C;  2DMY A;  2RTX A;  1GQE A;  3C4T A;  4R03 A;  3AUZ A;  4JI7 E;  2VQE E;  3J7A G;  5LMU E;  2DSY A;  1FJG E;  3DF6 A;  4DR5 E;  2JY9 A;  4OX9 E;  4B3R E;  4LFB E;  2VF1 A;  1T4L B;  2EZ6 A;  4DV5 E;  4B3T E;  3HPS A;  2YZT A;  4DR3 E;  1T4N A;  4J8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...