3ADLA

Structure of trbp2 and its molecule implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
GLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/rna
molecule keywords RISC-loading complex subunit TARBP2
publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adlA01
1WHQA 1PKPA 2LTSA 3ADIA 1N32E 3ADLA 1XMQE 4DV2E 4JI0E 2F4VE 2DIXA 1FKAE 3VYXA 1J26A 1GQEA 1N36E 4DV7E 2NUEA 2L3JA 1XNQE 2VQFE 2B3TB 4DR2E 1HNWE 1X49A 2DB2A 3T1YE 3J7Yp 2JVAA 2EZ6A 2JY9A 4X65E 5CFFE 4DUZE 4K0KE 4DR4E 2L2MA 4JYAE 3C4TA 3P1XA 4JI2E 2RSMA 4DKKA 4JI6E 1DI2A 2HHHE 4OX9E 2LUPB 1HNXE 1UHZA 4LF4E 1XNRE 4OOGC 3T1HE 2DMYA 5LMUE 1N34E 2YT4A 1N33E 4LF7E 2LTRA 2RS6A 1EKZA 2N3GA 4B3SE 2B7VA 3ADGA 1RQ0A 5IWAE 1YYKA 4JI8E 2ZM6E 4LF9E 4B3RE 1O0WA 1X47A 2RTXA 4DV1E 2L3CA 4DV4E 1UILA 2B7TA 2UUBE 2UXBE 2UUCE 4DR6E 2IHR1 4DUYE 4WFTA 2CPNA 4JV5E 4M2ZA 4NXME 4DR5E 1HR0E 1X48A 2E5LE 1T4OA 2LJHA 3VYYA 2UU9E 4DR7E 3C4BA 1YZ9A 2NA2A 4B3ME 5BR8E 4B3TE 3HTXA 4WYQB 2UUAE 4X62E 1RC7A 2N3HA 2L33A 1T4NA 1FJGE 4DV5E 1YYOA 1HNZE 2UXCE 4DV0E 2VQEE 2NUGA 2RS7A 1XMOE 2NUFA 4KHPE 4NXNE 4JI7E 2UXDE 3LLHA 4JI3E 1ZBTA 1IBME 2LBSB 4DV6E 4GKKE 2L2NA 4JI4E 1IBLE 1T4LB 4LFCE 1J5EE 4LF8E 1I94E 1YYWA 4YY3E 2KHXA 4X64E 4DR1E 2L2KB 4X66E 1IBKE 2LUQA 1STUA 2MDRA 4JI5E 4LFAE 4LF6E 4M30A 3OTOE 4DR3E 1WHNA 3ADJA 4LFBE 4LF5E 4YHHE 1QU6A 2LRSA 5LMNE 4JI1E 4X8WA 4GKJE 4DV3E 4AQYE
chains in the Genus database with same CATH superfamily
4HTGA 4WSPA 3BF2A 2EMZA 4BBYA 1XMQE 2CTDA 2EPUA 5AC5A 1X6EA 2DSYA 3VYXA 3KWRA 1N36E 2L3JA 4DR2E 2B3TB 2EM2A 1JK2A 1X49A 2DB2A 2EOJA 2N8XA 3T1YE 4NHRA 2B9DA 2YSOA 3THOB 2EPCA 1SFEA 2K4VA 4DKKA 1DI2A 2HHHE 2EM3A 2EN1A 2R1FA 4GZNC 1UHZA 5T6JA 5A6BD 2EMBA 1UBDC 2PRTA 1ZU1A 2YT4A 2H36X 4WX9A 1N33E 3IWDA 3THNA 1EKZA 2EOYA 2EPXA 2WCC3 1LLMC 1GTKA 5AASA 3FIGA 5IWAE 2M4IA 2V89A 2MKNA 4JI8E 3JTZA 4B3RE 4R2EA 1Z1BA 1TF3A 2L3CA 4DV4E 2B7TA 2UUBE 2UXBE 1B69A 2IHR1 4J8ZA 2YU8A 1PDAA 1NEIA 4R2CA 2EOIA 3C6KA 2E5LE 3IWBA 1WRJA 2UU9E 4DR7E 2EMWA 1AH5A 3HPZA 4WYQB 5TSEA 1SR9A 2EM8A 2N3HA 1A1HA 1T4NA 4DV0E 5IXMB 1A1GA 4O43A 1T39A 2J7JA 3VHTB 1JK1A 1RMDA 4R2SA 4R2RA 1ZAAC 4R8OA 1YYWA 4YY3E 2E1MA 2L2KB 4F54A 4X66E 4F9BB 1STUA 4HEIA 4KZSA 4LFAE 4LF6E 4IS1C 1EH7A 3ADJA 1A1IA 2EL5A 5LMNE 4JI1E 4X8WA 4GKJE 4ZYEA 2EMLA 1WHQA 1PKPA 2LTSA 3ADLA 2EMKA 4N4RB 4DV2E 4JI0E 5DNYA 3K6QA 2M1SA 2DIXA 2YTQA 5F3WA 2L92A 1J26A 1BB8A 4DV7E 2GLIA 1G2FC 5IT9C 1XNQE 4NZVA 5IV8B 4TUGA 2EZ6A 1PJTA 2JY9A 4X65E 5CFFE 2YSPA 2EL6A 3BGHA 2RPCA 4R2DA 2L2MA 1YSAC 3C4TA 3P1XA 2RSMA 3MHSC 2EPOA 2MC6A 2EM5A 4DMIA 4BC9A 4F9AB 2YRHA 5AE3A 2BB8A 2EOFA 2DMYA 5LMUE 2EMCA 1X6FA 3BIDA 2VRDA 1N34E 2EPKX 4LF7E 2YRKA 3KZYA 2K7IA 2EMYA 2EQ0A 3AV0A 4O4KA 5AC4A 2EMAA 4LF9E 1TN9A 2RTXA 3DF6A 2V87A 2YWQA 3L00A 5KL3A 4DV1E 2G7HA 4L8NA 2EOEA 3J81C 1YPNA 4DUYE 2JOBA 2ODRC 4F9CB 2EPAA 4DR5E 2DLQA 1PJSA 3VYYA 3C4BA 1YZ9A 4I8OA 4B3ME 2YTFA 2ADRA 4LTYA 3HTXA 1MGTA 2EOSA 2YTJA 2EMIA 2RQLA 5FLXC 2LO3A 5A2QC 2EN6A 4F6NA 1BBGA 2JWOA 2V86A 5ADZA 2MKDA 1HNZE 2YTOA 2F8BA 2RS7A 2GHFA 2GPIA 2LJUA 4BMJA 2EM0A 1YFHA 1KJKA 4RH8A 1ZBTA 2YTNA 1A1LA 1A1FA 2I13A 2LBSB 2L2NA 3HXLA 5LL6R 2M7QA 2EJ4A 2EQ3A 2EMXA 2V8QB 4P78A 5A6KA 4ZYHA 2EOXA 1QNTA 1EH8A 1A1KA 1KYQA 1ZBQA 1X3CA 3UK3C 1WHNA 2DLKA 2JP9A 4LFBE 1QU6A 1IQOA 2R76A 3TQMA 1AAYA 2EE8A 2EP3A 2FV4B 3F6HA 1N32E 4WXDA 3BBGA 5KL4A 4MLVA 1FKAE 4BC7A 1GQEA 2WBTA 3KZZA 2YTIA 2YU5A 2YTEA 3ZOQB 3IWCA 3J7Yp 2JVAA 2LE2A 3MSWA 2DRPA 1L4SA 2ENHA 2YTPA 4DR4E 2LCEA 2DMIA 4F6MA 2YZTA 4MLQA 5KL2A 4JI6E 5LLQA 1BBOA 4OX9E 1HNXE 1X6HA 4OOGC 1X5WA 2EN2A 2EOMA 2L8TA 2EPMX 4GEQB 4L5NC 2EPLX 2FTXB 2RSIA 2DGCA 3EPLA 1RQ0A 1YYKA 1WJPA 2ZM6E 2YTGA 5A6JA 2NABA 1O0WA 1X47A 2LV2A 2V85A 4R2AA 1MEYC 2WZOA 3C6MA 3AUZA 2EN7A 4DR6E 4WFTA 3EPKA 4M0VA 4M2ZA 1DGCA 1HR0E 1X48A 3MHHC 4P7DA 2LMZA 2NA2A 4ZYGA 4RHBB 4B3TE 2UUAE 2EORA 2CSHA 4X62E 1RC7A 4F2JC 5KL5A 2JYAA 2L33A 1FJGE 2KONA 2UXCE 2MDGA 2VQEE 3J7AG 2JPAA 4O5GA 4KHPE 2UXDE 2EPRA 1P47A 3EQ1A 3LLHA 1TF6A 2JR1A 2JOXA 1N3GA 2E72A 4DV6E 3F6GA 1IBLE 5A6BA 1T4LB 1IMUA 1J5EE 3HPSA 4LF8E 2EPNA 1I94E 3RMPA 4X64E 2EOHA 2YRMA 2EMFA 2EM6A 3EPHA 1A1JA 3J80C 2LUQA 2MDRA 5AE2A 5KL7A 3OTOE 4DR3E 4BHBA 2EPPA 2EOOA 2WBSA 3VK6A 1DQ3A 4DV3E 2EWLA 2CT1A 2HGHA 1UN6B 2EM4A 3ECRA 3ADIA 2BBGA 2YPNA 2F4VE 2VE7C 2ELYA 2A25A 4TUIA 2NUEA 2EM9A 2KOUA 3M99B 2VQFE 1HNWE 4KWYA 4DUZE 4Q35B 4K0KE 4FK5C 2EOZA 1F2IG 4WPYA 4JYAE 4JI2E 2L6MA 2EQ1A 2HC5A 2LUPB 4BS9A 2LT7A 1T38A 4LF4E 4BCAA 4O24A 1XNRE 3H09A 2EN3A 2WBUA 3T1HE 4R2PA 3QG5C 4WXCA 4M9VC 2LTRA 2RS6A 3JAMC 2ENCA 2N3GA 4B3SE 2B7VA 3ADGA 2LVHA 2VF1A 1UILA 2UUCE 2D9HA 4R03A 2CPNA 4JV5E 2HJJA 2EMHA 4NXME 3DJWA 3LMLA 4WSGA 1T4OA 2LJHA 1YUIA 4R2QA 1GZ6A 1WXRA 5BR8E 1IQSA 1NCSA 5AE1A 4X9JA 2M9AA 2MC5A 2EPZA 3HQ1A 2V83A 4DV5E 1YYOA 1ZR9A 2EL4A 2NUGA 2EM7A 1YUJA 1XMOE 2NUFA 2EMGA 4NXNE 4JI7E 2JXPA 2I9IA 4JI3E 5A69A 1IBME 4GKKE 4Q28A 4IJDA 3EPJA 4JI4E 4LFCE 2Q8UA 1PJQA 2FGGA 4BHCA 4ZYDA 2V88A 5KL6A 2KHXA 2YTDA 4LU9A 3OMLA 2EOQA 4DR1E 5A6AA 2ENAA 2EN4A 1IBKE 1EH6A 4JI5E 1G2DC 2ELZA 2EN8A 3JU0A 4M30A 4LF5E 4YHHE 2LRSA 2ODRD 4AQYE
chains in the Genus database with same CATH topology
1WHQA 1PKPA 2FV4B 2LTSA 3F6HA 4WSPA 3ADIA 1N32E 3ADLA 4BBYA 1XMQE 4DV2E 4JI0E 5DNYA 4JI1E 2F4VE 3K6QA 2VE7C 2M1SA 2DIXA 5F3WA 1FKAE 2DSYA 4BC7A 4TUIA 2L92A 3VYXA 1J26A 1GQEA 3KWRA 4DV7E 1N36E 2KOUA 2L3JA 2NUEA 5IT9C 3ZOQB 2VQFE 2B3TB 4DR2E 3IWCA 1XNQE 1HNWE 1X49A 2DB2A 4TUGA 3J7Yp 2JVAA 1DQ3A 3T1YE 2EZ6A 2JY9A 4X65E 5CFFE 2LE2A 3MSWA 4DUZE 4K0KE 2B9DA 4DR4E 2L2MA 4GKJE 4WPYA 4JYAE 3C4TA 3P1XA 4JI2E 2YZTA 2RSMA 2L6MA 2K4VA 4DKKA 4JI6E 1DI2A 2HHHE 2MC6A 4DMIA 4OX9E 4BC9A 2LUPB 1UHZA 5T6JA 4F9AB 4BS9A 1HNXE 4LF4E 5AE3A 4BCAA 4OOGC 1XNRE 3H09A 3T1HE 4AQYE 2DMYA 5LMUE 2L8TA 1N34E 2YT4A 2H36X 4GEQB 4LF7E 2LTRA 1N33E 3IWDA 2RS6A 3JAMC 4L5NC 1EKZA 2N3GA 4B3SE 2FTXB 2B7VA 5AASA 3ADGA 3AV0A 1RQ0A 3FIGA 2M4IA 2V89A 5IWAE 4JI8E 2ZM6E 3JTZA 1YYKA 4DR7E 4LF9E 4B3RE 1O0WA 1X47A 2RTXA 2V85A 3DF6A 2V87A 2L3CA 2VF1A 1UILA 4DV1E 2B7TA 4DV4E 2UUBE 2G7HA 2WZOA 4L8NA 2UXBE 2UUCE 3AUZA 3J81C 4R03A 4DR6E 2IHR1 4J8ZA 4DUYE 4WFTA 4M0VA 2CPNA 4JV5E 2JOBA 2ODRC 4F9CB 4M2ZA 4NXME 3DJWA 4DR5E 1HR0E 1X48A 3IWBA 1T4OA 2LJHA 3LMLA 3VYYA 2E5LE 1GZ6A 2UU9E 4P7DA 3C4BA 2LMZA 2NA2A 4I8OA 3HPZA 5BR8E 1WXRA 4B3ME 1YZ9A 4B3TE 4LTYA 3HTXA 4WYQB 2UUAE 5AE1A 4X62E 5FLXC 2MC5A 1SR9A 5A2QC 1RC7A 3HQ1A 2N3HA 2L33A 1T4NA 2V83A 2JWOA 2V86A 5ADZA 2KONA 4DV5E 1YYOA 1HNZE 4DV0E 2UXCE 2VQEE 2NUGA 2F8BA 2RS7A 3J7AG 4BMJA 1XMOE 2NUFA 4KHPE 4NXNE 4JI7E 2UXDE 3LLHA 4JI3E 2JR1A 2JOXA 1ZBTA 1IBME 2LBSB 4DV6E 4GKKE 4Q28A 2L2NA 3HXLA 5LL6R 3F6GA 4JI4E 1IBLE 1T4LB 2M7QA 4LFCE 1J5EE 3HPSA 2FGGA 4LF8E 2V8QB 4P78A 4R8OA 1I94E 2V88A 1YYWA 4YY3E 2E1MA 3RMPA 2KHXA 4X64E 4LU9A 3OMLA 4DR1E 2L2KB 4F54A 4X66E 3J80C 1FJGE 1IBKE 2LUQA 4F9BB 1STUA 2MDRA 4JI5E 1ZBQA 3JU0A 4KZSA 5AE2A 4LFAE 4LF6E 4M30A 3OTOE 4DR3E 1WHNA 3ADJA 4LFBE 4LF5E 4YHHE 1QU6A 2LRSA 5LMNE 3VK6A 4X8WA 2ODRD 4DV3E 2EWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHQ A;  1PKP A;  2LTS A;  3ADI A;  1N32 E;  3ADL A;  1XMQ E;  4DV2 E;  4JI0 E;  2F4V E;  2DIX A;  1FKA E;  3VYX A;  1J26 A;  1GQE A;  1N36 E;  4DV7 E;  2NUE A;  2L3J A;  1XNQ E;  2VQF E;  2B3T B;  4DR2 E;  1HNW E;  1X49 A;  2DB2 A;  3T1Y E;  3J7Y p;  2JVA A;  2EZ6 A;  2JY9 A;  4X65 E;  5CFF E;  4DUZ E;  4K0K E;  4DR4 E;  2L2M A;  4JYA E;  3C4T A;  3P1X A;  4JI2 E;  2RSM A;  4DKK A;  4JI6 E;  1DI2 A;  2HHH E;  4OX9 E;  2LUP B;  1HNX E;  1UHZ A;  4LF4 E;  1XNR E;  4OOG C;  3T1H E;  2DMY A;  5LMU E;  1N34 E;  2YT4 A;  1N33 E;  4LF7 E;  2LTR A;  2RS6 A;  1EKZ A;  2N3G A;  4B3S E;  2B7V A;  3ADG A;  1RQ0 A;  5IWA E;  1YYK A;  4JI8 E;  2ZM6 E;  4LF9 E;  4B3R E;  1O0W A;  1X47 A;  2RTX A;  4DV1 E;  2L3C A;  4DV4 E;  1UIL A;  2B7T A;  2UUB E;  2UXB E;  2UUC E;  4DR6 E;  2IHR 1;  4DUY E;  4WFT A;  2CPN A;  4JV5 E;  4M2Z A;  4NXM E;  4DR5 E;  1HR0 E;  1X48 A;  2E5L E;  1T4O A;  2LJH A;  3VYY A;  2UU9 E;  4DR7 E;  3C4B A;  1YZ9 A;  2NA2 A;  4B3M E;  5BR8 E;  4B3T E;  3HTX A;  4WYQ B;  2UUA E;  4X62 E;  1RC7 A;  2N3H A;  2L33 A;  1T4N A;  1FJG E;  4DV5 E;  1YYO A;  1HNZ E;  2UXC E;  4DV0 E;  2VQE E;  2NUG A;  2RS7 A;  1XMO E;  2NUF A;  4KHP E;  4NXN E;  4JI7 E;  2UXD E;  3LLH A;  4JI3 E;  1ZBT A;  1IBM E;  2LBS B;  4DV6 E;  4GKK E;  2L2N A;  4JI4 E;  1IBL E;  1T4L B;  4LFC E;  1J5E E;  4LF8 E;  1I94 E;  1YYW A;  4YY3 E;  2KHX A;  4X64 E;  4DR1 E;  2L2K B;  4X66 E;  1IBK E;  2LUQ A;  1STU A;  2MDR A;  4JI5 E;  4LFA E;  4LF6 E;  4M30 A;  3OTO E;  4DR3 E;  1WHN A;  3ADJ A;  4LFB E;  4LF5 E;  4YHH E;  1QU6 A;  2LRS A;  5LMN E;  4JI1 E;  4X8W A;  4GKJ E;  4DV3 E;  4AQY E; 
#chains in the Genus database with same CATH topology
 4HTG A;  4WSP A;  3BF2 A;  2EMZ A;  4BBY A;  1XMQ E;  2CTD A;  2EPU A;  5AC5 A;  1X6E A;  2DSY A;  3VYX A;  3KWR A;  1N36 E;  2L3J A;  4DR2 E;  2B3T B;  2EM2 A;  1JK2 A;  1X49 A;  2DB2 A;  2EOJ A;  2N8X A;  3T1Y E;  4NHR A;  2B9D A;  2YSO A;  3THO B;  2EPC A;  1SFE A;  2K4V A;  4DKK A;  1DI2 A;  2HHH E;  2EM3 A;  2EN1 A;  2R1F A;  4GZN C;  1UHZ A;  5T6J A;  5A6B D;  2EMB A;  1UBD C;  2PRT A;  1ZU1 A;  2YT4 A;  2H36 X;  4WX9 A;  1N33 E;  3IWD A;  3THN A;  1EKZ A;  2EOY A;  2EPX A;  2WCC 3;  1LLM C;  1GTK A;  5AAS A;  3FIG A;  5IWA E;  2M4I A;  2V89 A;  2MKN A;  4JI8 E;  3JTZ A;  4B3R E;  4R2E A;  1Z1B A;  1TF3 A;  2L3C A;  4DV4 E;  2B7T A;  2UUB E;  2UXB E;  1B69 A;  2IHR 1;  4J8Z A;  2YU8 A;  1PDA A;  1NEI A;  4R2C A;  2EOI A;  3C6K A;  2E5L E;  3IWB A;  1WRJ A;  2UU9 E;  4DR7 E;  2EMW A;  1AH5 A;  3HPZ A;  4WYQ B;  5TSE A;  1SR9 A;  2EM8 A;  2N3H A;  1A1H A;  1T4N A;  4DV0 E;  5IXM B;  1A1G A;  4O43 A;  1T39 A;  2J7J A;  3VHT B;  1JK1 A;  1RMD A;  4R2S A;  4R2R A;  1ZAA C;  4R8O A;  1YYW A;  4YY3 E;  2E1M A;  2L2K B;  4F54 A;  4X66 E;  4F9B B;  1STU A;  4HEI A;  4KZS A;  4LFA E;  4LF6 E;  4IS1 C;  1EH7 A;  3ADJ A;  1A1I A;  2EL5 A;  5LMN E;  4JI1 E;  4X8W A;  4GKJ E;  4ZYE A;  2EML A;  1WHQ A;  1PKP A;  2LTS A;  3ADL A;  2EMK A;  4N4R B;  4DV2 E;  4JI0 E;  5DNY A;  3K6Q A;  2M1S A;  2DIX A;  2YTQ A;  5F3W A;  2L92 A;  1J26 A;  1BB8 A;  4DV7 E;  2GLI A;  1G2F C;  5IT9 C;  1XNQ E;  4NZV A;  5IV8 B;  4TUG A;  2EZ6 A;  1PJT A;  2JY9 A;  4X65 E;  5CFF E;  2YSP A;  2EL6 A;  3BGH A;  2RPC A;  4R2D A;  2L2M A;  1YSA C;  3C4T A;  3P1X A;  2RSM A;  3MHS C;  2EPO A;  2MC6 A;  2EM5 A;  4DMI A;  4BC9 A;  4F9A B;  2YRH A;  5AE3 A;  2BB8 A;  2EOF A;  2DMY A;  5LMU E;  2EMC A;  1X6F A;  3BID A;  2VRD A;  1N34 E;  2EPK X;  4LF7 E;  2YRK A;  3KZY A;  2K7I A;  2EMY A;  2EQ0 A;  3AV0 A;  4O4K A;  5AC4 A;  2EMA A;  4LF9 E;  1TN9 A;  2RTX A;  3DF6 A;  2V87 A;  2YWQ A;  3L00 A;  5KL3 A;  4DV1 E;  2G7H A;  4L8N A;  2EOE A;  3J81 C;  1YPN A;  4DUY E;  2JOB A;  2ODR C;  4F9C B;  2EPA A;  4DR5 E;  2DLQ A;  1PJS A;  3VYY A;  3C4B A;  1YZ9 A;  4I8O A;  4B3M E;  2YTF A;  2ADR A;  4LTY A;  3HTX A;  1MGT A;  2EOS A;  2YTJ A;  2EMI A;  2RQL A;  5FLX C;  2LO3 A;  5A2Q C;  2EN6 A;  4F6N A;  1BBG A;  2JWO A;  2V86 A;  5ADZ A;  2MKD A;  1HNZ E;  2YTO A;  2F8B A;  2RS7 A;  2GHF A;  2GPI A;  2LJU A;  4BMJ A;  2EM0 A;  1YFH A;  1KJK A;  4RH8 A;  1ZBT A;  2YTN A;  1A1L A;  1A1F A;  2I13 A;  2LBS B;  2L2N A;  3HXL A;  5LL6 R;  2M7Q A;  2EJ4 A;  2EQ3 A;  2EMX A;  2V8Q B;  4P78 A;  5A6K A;  4ZYH A;  2EOX A;  1QNT A;  1EH8 A;  1A1K A;  1KYQ A;  1ZBQ A;  1X3C A;  3UK3 C;  1WHN A;  2DLK A;  2JP9 A;  4LFB E;  1QU6 A;  1IQO A;  2R76 A;  3TQM A;  1AAY A;  2EE8 A;  2EP3 A;  2FV4 B;  3F6H A;  1N32 E;  4WXD A;  3BBG A;  5KL4 A;  4MLV A;  1FKA E;  4BC7 A;  1GQE A;  2WBT A;  3KZZ A;  2YTI A;  2YU5 A;  2YTE A;  3ZOQ B;  3IWC A;  3J7Y p;  2JVA A;  2LE2 A;  3MSW A;  2DRP A;  1L4S A;  2ENH A;  2YTP A;  4DR4 E;  2LCE A;  2DMI A;  4F6M A;  2YZT A;  4MLQ A;  5KL2 A;  4JI6 E;  5LLQ A;  1BBO A;  4OX9 E;  1HNX E;  1X6H A;  4OOG C;  1X5W A;  2EN2 A;  2EOM A;  2L8T A;  2EPM X;  4GEQ B;  4L5N C;  2EPL X;  2FTX B;  2RSI A;  2DGC A;  3EPL A;  1RQ0 A;  1YYK A;  1WJP A;  2ZM6 E;  2YTG A;  5A6J A;  2NAB A;  1O0W A;  1X47 A;  2LV2 A;  2V85 A;  4R2A A;  1MEY C;  2WZO A;  3C6M A;  3AUZ A;  2EN7 A;  4DR6 E;  4WFT A;  3EPK A;  4M0V A;  4M2Z A;  1DGC A;  1HR0 E;  1X48 A;  3MHH C;  4P7D A;  2LMZ A;  2NA2 A;  4ZYG A;  4RHB B;  4B3T E;  2UUA E;  2EOR A;  2CSH A;  4X62 E;  1RC7 A;  4F2J C;  5KL5 A;  2JYA A;  2L33 A;  1FJG E;  2KON A;  2UXC E;  2MDG A;  2VQE E;  3J7A G;  2JPA A;  4O5G A;  4KHP E;  2UXD E;  2EPR A;  1P47 A;  3EQ1 A;  3LLH A;  1TF6 A;  2JR1 A;  2JOX A;  1N3G A;  2E72 A;  4DV6 E;  3F6G A;  1IBL E;  5A6B A;  1T4L B;  1IMU A;  1J5E E;  3HPS A;  4LF8 E;  2EPN A;  1I94 E;  3RMP A;  4X64 E;  2EOH A;  2YRM A;  2EMF A;  2EM6 A;  3EPH A;  1A1J A;  3J80 C;  2LUQ A;  2MDR A;  5AE2 A;  5KL7 A;  3OTO E;  4DR3 E;  4BHB A;  2EPP A;  2EOO A;  2WBS A;  3VK6 A;  1DQ3 A;  4DV3 E;  2EWL A;  2CT1 A;  2HGH A;  1UN6 B;  2EM4 A;  3ECR A;  3ADI A;  2BBG A;  2YPN A;  2F4V E;  2VE7 C;  2ELY A;  2A25 A;  4TUI A;  2NUE A;  2EM9 A;  2KOU A;  3M99 B;  2VQF E;  1HNW E;  4KWY A;  4DUZ E;  4Q35 B;  4K0K E;  4FK5 C;  2EOZ A;  1F2I G;  4WPY A;  4JYA E;  4JI2 E;  2L6M A;  2EQ1 A;  2HC5 A;  2LUP B;  4BS9 A;  2LT7 A;  1T38 A;  4LF4 E;  4BCA A;  4O24 A;  1XNR E;  3H09 A;  2EN3 A;  2WBU A;  3T1H E;  4R2P A;  3QG5 C;  4WXC A;  4M9V C;  2LTR A;  2RS6 A;  3JAM C;  2ENC A;  2N3G A;  4B3S E;  2B7V A;  3ADG A;  2LVH A;  2VF1 A;  1UIL A;  2UUC E;  2D9H A;  4R03 A;  2CPN A;  4JV5 E;  2HJJ A;  2EMH A;  4NXM E;  3DJW A;  3LML A;  4WSG A;  1T4O A;  2LJH A;  1YUI A;  4R2Q A;  1GZ6 A;  1WXR A;  5BR8 E;  1IQS A;  1NCS A;  5AE1 A;  4X9J A;  2M9A A;  2MC5 A;  2EPZ A;  3HQ1 A;  2V83 A;  4DV5 E;  1YYO A;  1ZR9 A;  2EL4 A;  2NUG A;  2EM7 A;  1YUJ A;  1XMO E;  2NUF A;  2EMG A;  4NXN E;  4JI7 E;  2JXP A;  2I9I A;  4JI3 E;  5A69 A;  1IBM E;  4GKK E;  4Q28 A;  4IJD A;  3EPJ A;  4JI4 E;  4LFC E;  2Q8U A;  1PJQ A;  2FGG A;  4BHC A;  4ZYD A;  2V88 A;  5KL6 A;  2KHX A;  2YTD A;  4LU9 A;  3OML A;  2EOQ A;  4DR1 E;  5A6A A;  2ENA A;  2EN4 A;  1IBK E;  1EH6 A;  4JI5 E;  1G2D C;  2ELZ A;  2EN8 A;  3JU0 A;  4M30 A;  4LF5 E;  4YHH E;  2LRS A;  2ODR D;  4AQY E; 
#chains in the Genus database with same CATH homology
 1WHQ A;  1PKP A;  2FV4 B;  2LTS A;  3F6H A;  4WSP A;  3ADI A;  1N32 E;  3ADL A;  4BBY A;  1XMQ E;  4DV2 E;  4JI0 E;  5DNY A;  4JI1 E;  2F4V E;  3K6Q A;  2VE7 C;  2M1S A;  2DIX A;  5F3W A;  1FKA E;  2DSY A;  4BC7 A;  4TUI A;  2L92 A;  3VYX A;  1J26 A;  1GQE A;  3KWR A;  4DV7 E;  1N36 E;  2KOU A;  2L3J A;  2NUE A;  5IT9 C;  3ZOQ B;  2VQF E;  2B3T B;  4DR2 E;  3IWC A;  1XNQ E;  1HNW E;  1X49 A;  2DB2 A;  4TUG A;  3J7Y p;  2JVA A;  1DQ3 A;  3T1Y E;  2EZ6 A;  2JY9 A;  4X65 E;  5CFF E;  2LE2 A;  3MSW A;  4DUZ E;  4K0K E;  2B9D A;  4DR4 E;  2L2M A;  4GKJ E;  4WPY A;  4JYA E;  3C4T A;  3P1X A;  4JI2 E;  2YZT A;  2RSM A;  2L6M A;  2K4V A;  4DKK A;  4JI6 E;  1DI2 A;  2HHH E;  2MC6 A;  4DMI A;  4OX9 E;  4BC9 A;  2LUP B;  1UHZ A;  5T6J A;  4F9A B;  4BS9 A;  1HNX E;  4LF4 E;  5AE3 A;  4BCA A;  4OOG C;  1XNR E;  3H09 A;  3T1H E;  4AQY E;  2DMY A;  5LMU E;  2L8T A;  1N34 E;  2YT4 A;  2H36 X;  4GEQ B;  4LF7 E;  2LTR A;  1N33 E;  3IWD A;  2RS6 A;  3JAM C;  4L5N C;  1EKZ A;  2N3G A;  4B3S E;  2FTX B;  2B7V A;  5AAS A;  3ADG A;  3AV0 A;  1RQ0 A;  3FIG A;  2M4I A;  2V89 A;  5IWA E;  4JI8 E;  2ZM6 E;  3JTZ A;  1YYK A;  4DR7 E;  4LF9 E;  4B3R E;  1O0W A;  1X47 A;  2RTX A;  2V85 A;  3DF6 A;  2V87 A;  2L3C A;  2VF1 A;  1UIL A;  4DV1 E;  2B7T A;  4DV4 E;  2UUB E;  2G7H A;  2WZO A;  4L8N A;  2UXB E;  2UUC E;  3AUZ A;  3J81 C;  4R03 A;  4DR6 E;  2IHR 1;  4J8Z A;  4DUY E;  4WFT A;  4M0V A;  2CPN A;  4JV5 E;  2JOB A;  2ODR C;  4F9C B;  4M2Z A;  4NXM E;  3DJW A;  4DR5 E;  1HR0 E;  1X48 A;  3IWB A;  1T4O A;  2LJH A;  3LML A;  3VYY A;  2E5L E;  1GZ6 A;  2UU9 E;  4P7D A;  3C4B A;  2LMZ A;  2NA2 A;  4I8O A;  3HPZ A;  5BR8 E;  1WXR A;  4B3M E;  1YZ9 A;  4B3T E;  4LTY A;  3HTX A;  4WYQ B;  2UUA E;  5AE1 A;  4X62 E;  5FLX C;  2MC5 A;  1SR9 A;  5A2Q C;  1RC7 A;  3HQ1 A;  2N3H A;  2L33 A;  1T4N A;  2V83 A;  2JWO A;  2V86 A;  5ADZ A;  2KON A;  4DV5 E;  1YYO A;  1HNZ E;  4DV0 E;  2UXC E;  2VQE E;  2NUG A;  2F8B A;  2RS7 A;  3J7A G;  4BMJ A;  1XMO E;  2NUF A;  4KHP E;  4NXN E;  4JI7 E;  2UXD E;  3LLH A;  4JI3 E;  2JR1 A;  2JOX A;  1ZBT A;  1IBM E;  2LBS B;  4DV6 E;  4GKK E;  4Q28 A;  2L2N A;  3HXL A;  5LL6 R;  3F6G A;  4JI4 E;  1IBL E;  1T4L B;  2M7Q A;  4LFC E;  1J5E E;  3HPS A;  2FGG A;  4LF8 E;  2V8Q B;  4P78 A;  4R8O A;  1I94 E;  2V88 A;  1YYW A;  4YY3 E;  2E1M A;  3RMP A;  2KHX A;  4X64 E;  4LU9 A;  3OML A;  4DR1 E;  2L2K B;  4F54 A;  4X66 E;  3J80 C;  1FJG E;  1IBK E;  2LUQ A;  4F9B B;  1STU A;  2MDR A;  4JI5 E;  1ZBQ A;  3JU0 A;  4KZS A;  5AE2 A;  4LFA E;  4LF6 E;  4M30 A;  3OTO E;  4DR3 E;  1WHN A;  3ADJ A;  4LFB E;  4LF5 E;  4YHH E;  1QU6 A;  2LRS A;  5LMN E;  3VK6 A;  4X8W A;  2ODR D;  4DV3 E;  2EWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...