3ADLA

Structure of trbp2 and its molecule implications for mirna processing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
GLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
molecule keywords RISC-loading complex subunit TARBP2
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3adlA01
2B7TA 2NUEA 2LUQA 4B3RE 1N33E 1X47A 1YYOA 1N36E 2L33A 4DV5E 5LMNE 2NUFA 2B7VA 2UUAE 1FJGE 3T1YE 4DV7E 4JI6E 4LFBE 4OOGC 4DV2E 1HR0E 4LF4E 2RSMA 2UXCE 4DR2E 1WHQA 3C4BA 4JI8E 4DV6E 1DI2A 3ADIA 4JI2E 2YT4A 2B3TB 5CFFE 1PKPA 3LLHA 4YY3E 4B3ME 1IBKE 1GQEA 2ZM6E 4LF5E 4DR3E 2LRSA 2EZ6A 2LBSB 2UXDE 2UU9E 1YZ9A 4DKKA 2DB2A 2MDRA 1T4LB 4JI4E 4JYAE 4GKKE 2LTRA 2LJHA 4DUZE 2L2KB 4DV4E 4JV5E 3HTXA 3P1XA 4WYQB 1UILA 2RS6A 1XMOE 4NXME 1YYWA 4JI5E 2UUCE 2VQEE 1QU6A 4LF8E 4OX9E 3ADGA 2UXBE 4X66E 1J26A 4X64E 1J5EE 1FKAE 1IBLE 5BR8E 3VYXA 2NA2A 4DR1E 1T4NA 1RQ0A 2E5LE 2DIXA 4WFTA 4LFCE 1ZBTA 2IHR1 1EKZA 1WHNA 2N3HA 1X49A 2KHXA 1RC7A 2VQFE 2LUPB 4DR7E 5IWAE 1XNRE 3ADLA 1N34E 2DMYA 1O0WA 4DV0E 4JI0E 4DR6E 2CPNA 4DV1E 2F4VE 4DR4E 2L3CA 4LF6E 1HNWE 2HHHE 4K0KE 4X62E 4X8WA 4JI1E 4DV3E 4B3SE 4AQYE 4KHPE 5LMUE 4DUYE 4X65E 4LF9E 2L2MA 1T4OA 1STUA 2N3GA 1IBME 1XMQE 1I94E 1YYKA 4YHHE 4JI7E 2L3JA 3T1HE 4GKJE 2JY9A 4B3TE 2RS7A 2NUGA 4LF7E 3C4TA 3J7Yp 1N32E 2JVAA 1HNXE 4JI3E 4NXNE 2LTSA 2RTXA 2L2NA 4LFAE 1UHZA 4DR5E 1X48A 4M2ZA 3VYYA 2UUBE 3ADJA 1HNZE 4M30A 1XNQE 3OTOE
chains in the Genus database with same CATH superfamily
5AC5A 2YRKA 4O4KA 1YYOA 2A25A 2EPRA 2EPZA 1FJGE 3T1YE 2M7QA 3HQ1A 4M0VA 2YTGA 2DLQA 4BHCA 3J80C 1A1JA 4MLVA 5T6JA 1AAYA 2EPCA 2UXCE 4DR2E 3IWCA 1A1KA 4JI8E 1B69A 2LVHA 2EOJA 3MSWA 2ELZA 2L92A 2EM4A 2HC5A 4MLQA 2YTOA 4WSGA 1GTKA 4FK5C 3J7AG 4R2DA 2EOSA 1IBKE 2LO3A 4DR3E 2LRSA 2EZ6A 2ADRA 2UU9E 5AE3A 5IV8B 2ODRC 2PRTA 5TSEA 3C6KA 3UK3C 2MDRA 5AC4A 4F9AB 4DUZE 4WYQB 1YFHA 4JI5E 5F3WA 2UUCE 2KOUA 3F6HA 2K7IA 3THOB 4LF8E 2EOIA 4OX9E 3ADGA 4R8OA 1RMDA 4X66E 1FKAE 3DJWA 1J5EE 4KWYA 4R2SA 2EPXA 2EMBA 3KWRA 5A6BD 2IHR1 2EM8A 2LMZA 5A69A 1X49A 2LUPB 2FV4B 4L8NA 1XNRE 2DMYA 5AASA 5AE2A 1O0WA 1UN6B 2VF1A 4BC7A 2YTFA 1NEIA 4DR4E 1HNWE 1P47A 4R2RA 3H09A 2EN3A 4AQYE 4X65E 1X3CA 1BBOA 1STUA 1XMQE 1I94E 1IQOA 2EN2A 2JY9A 2HGHA 3C4TA 1N32E 2MKNA 2EMHA 2YSPA 4KZSA 4LFAE 3AV0A 2JOXA 1ZAAC 1N3GA 4RHBB 2YRHA 2DRPA 1X6EA 4I8OA 3VYYA 2EOFA 3ADJA 5A6AA 4P78A 4TUGA 1SFEA 2EM0A 1XNQE 2EPAA 2E1MA 2EMIA 2EL5A 1A1FA 2L33A 2EMFA 5KL6A 2DLKA 4IJDA 5LMNE 2B7VA 5IT9C 4Q28A 2EORA 4DV7E 4O5GA 4LTYA 4OOGC 2DSYA 2EOYA 5KL5A 1X6FA 4LF4E 3ECRA 1Z1BA 2D9HA 2JOBA 3C4BA 4HTGA 4DV6E 2EE8A 1G2FC 2BB8A 2B3TB 2WBTA 4F2JC 1LLMC 4F6MA 2EN7A 2NABA 2EM7A 1ZU1A 2V89A 2RPCA 3LLHA 2EOHA 3IWDA 4YY3E 5ADZA 4R2CA 1QNTA 2R1FA 4B3ME 2YPNA 2VE7C 1GQEA 2ZM6E 4LF5E 1A1LA 2LJUA 2UXDE 1YZ9A 2YSOA 4DKKA 2EM3A 1SR9A 2MKDA 3JU0A 3HPSA 1T4LB 4X9JA 2V83A 2ENCA 1UBDC 4JV5E 2L2KB 3EPKA 3ZOQB 4WX9A 3P1XA 4NXME 1UILA 2EOQA 4BBYA 2EMLA 4GZNC 1F2IG 2VQEE 1QU6A 2G7HA 2WBSA 3AUZA 5A6JA 2UXBE 2RQLA 1J26A 3DF6A 4BMJA 3QG5C 2EN8A 2YZTA 1T4NA 2CSHA 1RQ0A 3JAMC 2MC6A 1ZBTA 2LV2A 1BB8A 2M4IA 2N8XA 1EH8A 3EQ1A 4DR6E 4LU9A 2L3CA 2ODRD 4X62E 3HXLA 2F8BA 1PJTA 4LF9E 1WXRA 3TQMA 1IBME 1YYKA 2EMZA 3EPJA 2I9IA 4JI7E 2L3JA 1YSAC 1IMUA 2EM9A 3F6GA 3M99B 2EMCA 2JVAA 4JI3E 2V87A 1L4SA 2RTXA 2ENHA 1UHZA 3EPLA 4F54A 1JK1A 2EPMX 4NHRA 2YTJA 1PDAA 4ZYEA 1HNZE 2EQ0A 2V88A 3OTOE 2I13A 2B7TA 4B3RE 2EOXA 1PJQA 1N36E 2EN1A 4DV5E 3VK6A 1YUJA 1TF3A 2UUAE 3BIDA 2GPIA 5LLQA 4IS1C 4LFBE 4N4RB 4BHBA 4DV2E 1HR0E 2RSMA 2E72A 1MGTA 1WHQA 2BBGA 1DI2A 3ADIA 2CT1A 2ENAA 5CFFE 2LT7A 5KL4A 1PKPA 3BGHA 5A6BA 3IWBA 5FLXC 2WZOA 2EJ4A 2LBSB 4F9BB 2V85A 2EM6A 2EPNA 4JYAE 3BF2A 4GKKE 3K6QA 3HTXA 2VRDA 3OMLA 2RS6A 1YYWA 4P7DA 4R2QA 2RSIA 2JR1A 2EPPA 1A1IA 2GHFA 3VYXA 1IBLE 1EH7A 4DMIA 2EPOA 2NA2A 4DR1E 2LCEA 2E5LE 2K4VA 1EKZA 4DR7E 3KZYA 5IWAE 1IQSA 2JPAA 3ADLA 4R2EA 2Q8UA 2WCC3 1A1GA 4JI0E 4RH8A 4K0KE 1TN9A 4X8WA 2R76A 4DV3E 2JXPA 5LMUE 5IXMB 4DUYE 2J7JA 2EM2A 2EM5A 1T4OA 2L2MA 4O43A 5A2QC 4YHHE 2EOOA 1GZ6A 4GKJE 4ZYGA 2JYAA 2RS7A 2NUGA 2EPLX 2GLIA 1HNXE 2YTPA 4WXCA 2LTSA 1T39A 2L2NA 4DR5E 1X5WA 2DMIA 3THNA 5KL3A 2EMGA 2L8TA 2H36X 2EWLA 4R2AA 2EQ1A 2EQ3A 2WBUA 2NUEA 1T38A 2LUQA 4O24A 2B9DA 1YUIA 1N33E 3J81C 5AE1A 1X47A 4J8ZA 2LE2A 2NUFA 1KYQA 2DGCA 2EN6A 4GEQB 4F9CB 2M1SA 4WSPA 4JI6E 1ZR9A 4Q35B 3BBGA 2FTXB 2EPUA 1WJPA 2EL6A 2MC5A 2YRMA 2EPKX 5LL6R 4JI2E 2EN4A 2EMXA 2YT4A 2EMWA 4F6NA 3FIGA 2M9AA 2YTQA 4BS9A 5KL2A 3EPHA 2V86A 2YTNA 2EMAA 2EOMA 3VHTB 3C6MA 1X6HA 1PJSA 5DNYA 2DB2A 2YTEA 3L00A 5A6KA 5KL7A 2V8QB 2EMYA 4JI4E 2LTRA 2LJHA 1YPNA 4WPYA 4DV4E 2MDGA 1XMOE 2EL4A 1DGCA 2JP9A 4M9VC 1AH5A 3MHSC 2YU5A 3KZZA 2YU8A 2YTIA 3LMLA 2YTDA 4X64E 1KJKA 5BR8E 2KONA 4NZVA 2DIXA 4WFTA 4LFCE 4L5NC 2FGGA 2HJJA 1WHNA 2N3HA 4BC9A 2KHXA 1RC7A 2VQFE 1MEYC 1A1HA 1DQ3A 3MHHC 4WXDA 2JWOA 1N34E 4DV0E 2CPNA 4DV1E 2F4VE 4TUIA 4LF6E 2ELYA 2HHHE 4JI1E 4B3SE 2L6MA 4KHPE 3HPZA 1TF6A 2YWQA 2N3GA 1ZBQA 2EOEA 3T1HE 4B3TE 4R03A 4R2PA 4LF7E 3J7Yp 1G2DC 2EP3A 2CTDA 3JTZA 4HEIA 2EMKA 3RMPA 4NXNE 1JK2A 1BBGA 2EOZA 1X48A 1WRJA 1EH6A 4M2ZA 4BCAA 2UUBE 4ZYDA 4ZYHA 4M30A 1NCSA
chains in the Genus database with same CATH topology
2B7TA 2NUEA 2LUQA 4B3RE 2B9DA 1N33E 2E1MA 3J81C 5AE1A 1X47A 1YYOA 1N36E 4J8ZA 2L33A 2LE2A 4DV5E 3VK6A 5LMNE 2NUFA 2B7VA 2UUAE 5IT9C 4Q28A 4GEQB 1FJGE 4F9CB 3T1YE 2M1SA 4WSPA 4DV7E 4JI6E 4LTYA 2M7QA 4LFBE 3HQ1A 4OOGC 4M0VA 2FTXB 2DSYA 4DV2E 1HR0E 2MC5A 3J80C 4LF4E 2RSMA 5T6JA 2UXCE 4KHPE 2JOBA 3IWCA 4DR2E 1WHQA 3C4BA 4JI8E 4DV6E 5LL6R 1DI2A 3MSWA 4JI2E 2L92A 2YT4A 3ADIA 2B3TB 3J7AG 5CFFE 3FIGA 4BS9A 1PKPA 2V86A 2V89A 3LLHA 4DR6E 3IWDA 4YY3E 5ADZA 3IWBA 4B3ME 2VE7C 1GQEA 1IBKE 5FLXC 2WZOA 2ZM6E 4LF5E 4DR3E 2LRSA 2EZ6A 2LBSB 2UXDE 5DNYA 2UU9E 1YZ9A 5AE3A 4DKKA 1SR9A 2ODRC 2DB2A 3JU0A 4F9BB 2V8QB 2V85A 3HPSA 2MDRA 1T4LB 4JI4E 4JYAE 4GKKE 3K6QA 2LTRA 4F9AB 2LJHA 2V83A 4WPYA 4DUZE 2L2KB 4DV4E 3ZOQB 3HTXA 4JV5E 3P1XA 4WYQB 1UILA 2RS6A 3OMLA 1XMOE 4BBYA 4NXME 1YYWA 4P7DA 4JI5E 5F3WA 2UUCE 2VQEE 2JR1A 1QU6A 2KOUA 3F6HA 2G7HA 4LF8E 3AUZA 4OX9E 3ADGA 3LMLA 2UXBE 4R8OA 4X66E 1J26A 3DF6A 4X64E 3DJWA 4BMJA 1J5EE 5BR8E 4DMIA 1IBLE 1FKAE 2NA2A 4DR1E 3VYXA 2YZTA 2KONA 1T4NA 1RQ0A 3KWRA 3JAMC 2E5LE 2K4VA 2DIXA 4WFTA 2MC6A 4LFCE 1ZBTA 2FGGA 4L5NC 2IHR1 1EKZA 1WHNA 2LMZA 2N3HA 1X49A 2KHXA 4BC9A 1RC7A 2VQFE 2LUPB 2FV4B 1DQ3A 2M4IA 4DR7E 5IWAE 4L8NA 1XNRE 2JWOA 3ADLA 1N34E 2DMYA 5AASA 5AE2A 1O0WA 4DV0E 2VF1A 4BC7A 2CPNA 4DV1E 4JI0E 4LU9A 4TUIA 2L3CA 4LF6E 2ODRD 2HHHE 2F4VE 4X62E 4DR4E 4K0KE 4X8WA 1HNWE 3HXLA 3H09A 2L6MA 2F8BA 4DV3E 5LMUE 4DUYE 1WXRA 4X65E 4AQYE 4B3SE 4LF9E 2L2MA 1T4OA 3HPZA 1STUA 2N3GA 1IBME 4JI1E 1ZBQA 1XMQE 5A2QC 1I94E 1YYKA 4YHHE 1GZ6A 4JI7E 2L3JA 3T1HE 2JY9A 4GKJE 3F6GA 4B3TE 4R03A 2RS7A 2NUGA 4LF7E 3C4TA 3J7Yp 1N32E 3RMPA 2JVAA 3JTZA 1HNXE 2V87A 4JI3E 4NXNE 4KZSA 2LTSA 2RTXA 2L2NA 4LFAE 1UHZA 3AV0A 4DR5E 1X48A 2JOXA 4F54A 4M2ZA 2L8TA 4I8OA 3VYYA 2H36X 2EWLA 4BCAA 2UUBE 3ADJA 4P78A 4TUGA 1HNZE 4M30A 2V88A 1XNQE 3OTOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7T A;  2NUE A;  2LUQ A;  4B3R E;  1N33 E;  1X47 A;  1YYO A;  1N36 E;  2L33 A;  4DV5 E;  5LMN E;  2NUF A;  2B7V A;  2UUA E;  1FJG E;  3T1Y E;  4DV7 E;  4JI6 E;  4LFB E;  4OOG C;  4DV2 E;  1HR0 E;  4LF4 E;  2RSM A;  2UXC E;  4DR2 E;  1WHQ A;  3C4B A;  4JI8 E;  4DV6 E;  1DI2 A;  3ADI A;  4JI2 E;  2YT4 A;  2B3T B;  5CFF E;  1PKP A;  3LLH A;  4YY3 E;  4B3M E;  1IBK E;  1GQE A;  2ZM6 E;  4LF5 E;  4DR3 E;  2LRS A;  2EZ6 A;  2LBS B;  2UXD E;  2UU9 E;  1YZ9 A;  4DKK A;  2DB2 A;  2MDR A;  1T4L B;  4JI4 E;  4JYA E;  4GKK E;  2LTR A;  2LJH A;  4DUZ E;  2L2K B;  4DV4 E;  4JV5 E;  3HTX A;  3P1X A;  4WYQ B;  1UIL A;  2RS6 A;  1XMO E;  4NXM E;  1YYW A;  4JI5 E;  2UUC E;  2VQE E;  1QU6 A;  4LF8 E;  4OX9 E;  3ADG A;  2UXB E;  4X66 E;  1J26 A;  4X64 E;  1J5E E;  1FKA E;  1IBL E;  5BR8 E;  3VYX A;  2NA2 A;  4DR1 E;  1T4N A;  1RQ0 A;  2E5L E;  2DIX A;  4WFT A;  4LFC E;  1ZBT A;  2IHR 1;  1EKZ A;  1WHN A;  2N3H A;  1X49 A;  2KHX A;  1RC7 A;  2VQF E;  2LUP B;  4DR7 E;  5IWA E;  1XNR E;  3ADL A;  1N34 E;  2DMY A;  1O0W A;  4DV0 E;  4JI0 E;  4DR6 E;  2CPN A;  4DV1 E;  2F4V E;  4DR4 E;  2L3C A;  4LF6 E;  1HNW E;  2HHH E;  4K0K E;  4X62 E;  4X8W A;  4JI1 E;  4DV3 E;  4B3S E;  4AQY E;  4KHP E;  5LMU E;  4DUY E;  4X65 E;  4LF9 E;  2L2M A;  1T4O A;  1STU A;  2N3G A;  1IBM E;  1XMQ E;  1I94 E;  1YYK A;  4YHH E;  4JI7 E;  2L3J A;  3T1H E;  4GKJ E;  2JY9 A;  4B3T E;  2RS7 A;  2NUG A;  4LF7 E;  3C4T A;  3J7Y p;  1N32 E;  2JVA A;  1HNX E;  4JI3 E;  4NXN E;  2LTS A;  2RTX A;  2L2N A;  4LFA E;  1UHZ A;  4DR5 E;  1X48 A;  4M2Z A;  3VYY A;  2UUB E;  3ADJ A;  1HNZ E;  4M30 A;  1XNQ E;  3OTO E; 
#chains in the Genus database with same CATH topology
 5AC5 A;  2YRK A;  4O4K A;  1YYO A;  2A25 A;  2EPR A;  2EPZ A;  1FJG E;  3T1Y E;  2M7Q A;  3HQ1 A;  4M0V A;  2YTG A;  2DLQ A;  4BHC A;  3J80 C;  1A1J A;  4MLV A;  5T6J A;  1AAY A;  2EPC A;  2UXC E;  4DR2 E;  3IWC A;  1A1K A;  4JI8 E;  1B69 A;  2LVH A;  2EOJ A;  3MSW A;  2ELZ A;  2L92 A;  2EM4 A;  2HC5 A;  4MLQ A;  2YTO A;  4WSG A;  1GTK A;  4FK5 C;  3J7A G;  4R2D A;  2EOS A;  1IBK E;  2LO3 A;  4DR3 E;  2LRS A;  2EZ6 A;  2ADR A;  2UU9 E;  5AE3 A;  5IV8 B;  2ODR C;  2PRT A;  5TSE A;  3C6K A;  3UK3 C;  2MDR A;  5AC4 A;  4F9A B;  4DUZ E;  4WYQ B;  1YFH A;  4JI5 E;  5F3W A;  2UUC E;  2KOU A;  3F6H A;  2K7I A;  3THO B;  4LF8 E;  2EOI A;  4OX9 E;  3ADG A;  4R8O A;  1RMD A;  4X66 E;  1FKA E;  3DJW A;  1J5E E;  4KWY A;  4R2S A;  2EPX A;  2EMB A;  3KWR A;  5A6B D;  2IHR 1;  2EM8 A;  2LMZ A;  5A69 A;  1X49 A;  2LUP B;  2FV4 B;  4L8N A;  1XNR E;  2DMY A;  5AAS A;  5AE2 A;  1O0W A;  1UN6 B;  2VF1 A;  4BC7 A;  2YTF A;  1NEI A;  4DR4 E;  1HNW E;  1P47 A;  4R2R A;  3H09 A;  2EN3 A;  4AQY E;  4X65 E;  1X3C A;  1BBO A;  1STU A;  1XMQ E;  1I94 E;  1IQO A;  2EN2 A;  2JY9 A;  2HGH A;  3C4T A;  1N32 E;  2MKN A;  2EMH A;  2YSP A;  4KZS A;  4LFA E;  3AV0 A;  2JOX A;  1ZAA C;  1N3G A;  4RHB B;  2YRH A;  2DRP A;  1X6E A;  4I8O A;  3VYY A;  2EOF A;  3ADJ A;  5A6A A;  4P78 A;  4TUG A;  1SFE A;  2EM0 A;  1XNQ E;  2EPA A;  2E1M A;  2EMI A;  2EL5 A;  1A1F A;  2L33 A;  2EMF A;  5KL6 A;  2DLK A;  4IJD A;  5LMN E;  2B7V A;  5IT9 C;  4Q28 A;  2EOR A;  4DV7 E;  4O5G A;  4LTY A;  4OOG C;  2DSY A;  2EOY A;  5KL5 A;  1X6F A;  4LF4 E;  3ECR A;  1Z1B A;  2D9H A;  2JOB A;  3C4B A;  4HTG A;  4DV6 E;  2EE8 A;  1G2F C;  2BB8 A;  2B3T B;  2WBT A;  4F2J C;  1LLM C;  4F6M A;  2EN7 A;  2NAB A;  2EM7 A;  1ZU1 A;  2V89 A;  2RPC A;  3LLH A;  2EOH A;  3IWD A;  4YY3 E;  5ADZ A;  4R2C A;  1QNT A;  2R1F A;  4B3M E;  2YPN A;  2VE7 C;  1GQE A;  2ZM6 E;  4LF5 E;  1A1L A;  2LJU A;  2UXD E;  1YZ9 A;  2YSO A;  4DKK A;  2EM3 A;  1SR9 A;  2MKD A;  3JU0 A;  3HPS A;  1T4L B;  4X9J A;  2V83 A;  2ENC A;  1UBD C;  4JV5 E;  2L2K B;  3EPK A;  3ZOQ B;  4WX9 A;  3P1X A;  4NXM E;  1UIL A;  2EOQ A;  4BBY A;  2EML A;  4GZN C;  1F2I G;  2VQE E;  1QU6 A;  2G7H A;  2WBS A;  3AUZ A;  5A6J A;  2UXB E;  2RQL A;  1J26 A;  3DF6 A;  4BMJ A;  3QG5 C;  2EN8 A;  2YZT A;  1T4N A;  2CSH A;  1RQ0 A;  3JAM C;  2MC6 A;  1ZBT A;  2LV2 A;  1BB8 A;  2M4I A;  2N8X A;  1EH8 A;  3EQ1 A;  4DR6 E;  4LU9 A;  2L3C A;  2ODR D;  4X62 E;  3HXL A;  2F8B A;  1PJT A;  4LF9 E;  1WXR A;  3TQM A;  1IBM E;  1YYK A;  2EMZ A;  3EPJ A;  2I9I A;  4JI7 E;  2L3J A;  1YSA C;  1IMU A;  2EM9 A;  3F6G A;  3M99 B;  2EMC A;  2JVA A;  4JI3 E;  2V87 A;  1L4S A;  2RTX A;  2ENH A;  1UHZ A;  3EPL A;  4F54 A;  1JK1 A;  2EPM X;  4NHR A;  2YTJ A;  1PDA A;  4ZYE A;  1HNZ E;  2EQ0 A;  2V88 A;  3OTO E;  2I13 A;  2B7T A;  4B3R E;  2EOX A;  1PJQ A;  1N36 E;  2EN1 A;  4DV5 E;  3VK6 A;  1YUJ A;  1TF3 A;  2UUA E;  3BID A;  2GPI A;  5LLQ A;  4IS1 C;  4LFB E;  4N4R B;  4BHB A;  4DV2 E;  1HR0 E;  2RSM A;  2E72 A;  1MGT A;  1WHQ A;  2BBG A;  1DI2 A;  3ADI A;  2CT1 A;  2ENA A;  5CFF E;  2LT7 A;  5KL4 A;  1PKP A;  3BGH A;  5A6B A;  3IWB A;  5FLX C;  2WZO A;  2EJ4 A;  2LBS B;  4F9B B;  2V85 A;  2EM6 A;  2EPN A;  4JYA E;  3BF2 A;  4GKK E;  3K6Q A;  3HTX A;  2VRD A;  3OML A;  2RS6 A;  1YYW A;  4P7D A;  4R2Q A;  2RSI A;  2JR1 A;  2EPP A;  1A1I A;  2GHF A;  3VYX A;  1IBL E;  1EH7 A;  4DMI A;  2EPO A;  2NA2 A;  4DR1 E;  2LCE A;  2E5L E;  2K4V A;  1EKZ A;  4DR7 E;  3KZY A;  5IWA E;  1IQS A;  2JPA A;  3ADL A;  4R2E A;  2Q8U A;  2WCC 3;  1A1G A;  4JI0 E;  4RH8 A;  4K0K E;  1TN9 A;  4X8W A;  2R76 A;  4DV3 E;  2JXP A;  5LMU E;  5IXM B;  4DUY E;  2J7J A;  2EM2 A;  2EM5 A;  1T4O A;  2L2M A;  4O43 A;  5A2Q C;  4YHH E;  2EOO A;  1GZ6 A;  4GKJ E;  4ZYG A;  2JYA A;  2RS7 A;  2NUG A;  2EPL X;  2GLI A;  1HNX E;  2YTP A;  4WXC A;  2LTS A;  1T39 A;  2L2N A;  4DR5 E;  1X5W A;  2DMI A;  3THN A;  5KL3 A;  2EMG A;  2L8T A;  2H36 X;  2EWL A;  4R2A A;  2EQ1 A;  2EQ3 A;  2WBU A;  2NUE A;  1T38 A;  2LUQ A;  4O24 A;  2B9D A;  1YUI A;  1N33 E;  3J81 C;  5AE1 A;  1X47 A;  4J8Z A;  2LE2 A;  2NUF A;  1KYQ A;  2DGC A;  2EN6 A;  4GEQ B;  4F9C B;  2M1S A;  4WSP A;  4JI6 E;  1ZR9 A;  4Q35 B;  3BBG A;  2FTX B;  2EPU A;  1WJP A;  2EL6 A;  2MC5 A;  2YRM A;  2EPK X;  5LL6 R;  4JI2 E;  2EN4 A;  2EMX A;  2YT4 A;  2EMW A;  4F6N A;  3FIG A;  2M9A A;  2YTQ A;  4BS9 A;  5KL2 A;  3EPH A;  2V86 A;  2YTN A;  2EMA A;  2EOM A;  3VHT B;  3C6M A;  1X6H A;  1PJS A;  5DNY A;  2DB2 A;  2YTE A;  3L00 A;  5A6K A;  5KL7 A;  2V8Q B;  2EMY A;  4JI4 E;  2LTR A;  2LJH A;  1YPN A;  4WPY A;  4DV4 E;  2MDG A;  1XMO E;  2EL4 A;  1DGC A;  2JP9 A;  4M9V C;  1AH5 A;  3MHS C;  2YU5 A;  3KZZ A;  2YU8 A;  2YTI A;  3LML A;  2YTD A;  4X64 E;  1KJK A;  5BR8 E;  2KON A;  4NZV A;  2DIX A;  4WFT A;  4LFC E;  4L5N C;  2FGG A;  2HJJ A;  1WHN A;  2N3H A;  4BC9 A;  2KHX A;  1RC7 A;  2VQF E;  1MEY C;  1A1H A;  1DQ3 A;  3MHH C;  4WXD A;  2JWO A;  1N34 E;  4DV0 E;  2CPN A;  4DV1 E;  2F4V E;  4TUI A;  4LF6 E;  2ELY A;  2HHH E;  4JI1 E;  4B3S E;  2L6M A;  4KHP E;  3HPZ A;  1TF6 A;  2YWQ A;  2N3G A;  1ZBQ A;  2EOE A;  3T1H E;  4B3T E;  4R03 A;  4R2P A;  4LF7 E;  3J7Y p;  1G2D C;  2EP3 A;  2CTD A;  3JTZ A;  4HEI A;  2EMK A;  3RMP A;  4NXN E;  1JK2 A;  1BBG A;  2EOZ A;  1X48 A;  1WRJ A;  1EH6 A;  4M2Z A;  4BCA A;  2UUB E;  4ZYD A;  4ZYH A;  4M30 A;  1NCS A; 
#chains in the Genus database with same CATH homology
 2B7T A;  2NUE A;  2LUQ A;  4B3R E;  2B9D A;  1N33 E;  2E1M A;  3J81 C;  5AE1 A;  1X47 A;  1YYO A;  1N36 E;  4J8Z A;  2L33 A;  2LE2 A;  4DV5 E;  3VK6 A;  5LMN E;  2NUF A;  2B7V A;  2UUA E;  5IT9 C;  4Q28 A;  4GEQ B;  1FJG E;  4F9C B;  3T1Y E;  2M1S A;  4WSP A;  4DV7 E;  4JI6 E;  4LTY A;  2M7Q A;  4LFB E;  3HQ1 A;  4OOG C;  4M0V A;  2FTX B;  2DSY A;  4DV2 E;  1HR0 E;  2MC5 A;  3J80 C;  4LF4 E;  2RSM A;  5T6J A;  2UXC E;  4KHP E;  2JOB A;  3IWC A;  4DR2 E;  1WHQ A;  3C4B A;  4JI8 E;  4DV6 E;  5LL6 R;  1DI2 A;  3MSW A;  4JI2 E;  2L92 A;  2YT4 A;  3ADI A;  2B3T B;  3J7A G;  5CFF E;  3FIG A;  4BS9 A;  1PKP A;  2V86 A;  2V89 A;  3LLH A;  4DR6 E;  3IWD A;  4YY3 E;  5ADZ A;  3IWB A;  4B3M E;  2VE7 C;  1GQE A;  1IBK E;  5FLX C;  2WZO A;  2ZM6 E;  4LF5 E;  4DR3 E;  2LRS A;  2EZ6 A;  2LBS B;  2UXD E;  5DNY A;  2UU9 E;  1YZ9 A;  5AE3 A;  4DKK A;  1SR9 A;  2ODR C;  2DB2 A;  3JU0 A;  4F9B B;  2V8Q B;  2V85 A;  3HPS A;  2MDR A;  1T4L B;  4JI4 E;  4JYA E;  4GKK E;  3K6Q A;  2LTR A;  4F9A B;  2LJH A;  2V83 A;  4WPY A;  4DUZ E;  2L2K B;  4DV4 E;  3ZOQ B;  3HTX A;  4JV5 E;  3P1X A;  4WYQ B;  1UIL A;  2RS6 A;  3OML A;  1XMO E;  4BBY A;  4NXM E;  1YYW A;  4P7D A;  4JI5 E;  5F3W A;  2UUC E;  2VQE E;  2JR1 A;  1QU6 A;  2KOU A;  3F6H A;  2G7H A;  4LF8 E;  3AUZ A;  4OX9 E;  3ADG A;  3LML A;  2UXB E;  4R8O A;  4X66 E;  1J26 A;  3DF6 A;  4X64 E;  3DJW A;  4BMJ A;  1J5E E;  5BR8 E;  4DMI A;  1IBL E;  1FKA E;  2NA2 A;  4DR1 E;  3VYX A;  2YZT A;  2KON A;  1T4N A;  1RQ0 A;  3KWR A;  3JAM C;  2E5L E;  2K4V A;  2DIX A;  4WFT A;  2MC6 A;  4LFC E;  1ZBT A;  2FGG A;  4L5N C;  2IHR 1;  1EKZ A;  1WHN A;  2LMZ A;  2N3H A;  1X49 A;  2KHX A;  4BC9 A;  1RC7 A;  2VQF E;  2LUP B;  2FV4 B;  1DQ3 A;  2M4I A;  4DR7 E;  5IWA E;  4L8N A;  1XNR E;  2JWO A;  3ADL A;  1N34 E;  2DMY A;  5AAS A;  5AE2 A;  1O0W A;  4DV0 E;  2VF1 A;  4BC7 A;  2CPN A;  4DV1 E;  4JI0 E;  4LU9 A;  4TUI A;  2L3C A;  4LF6 E;  2ODR D;  2HHH E;  2F4V E;  4X62 E;  4DR4 E;  4K0K E;  4X8W A;  1HNW E;  3HXL A;  3H09 A;  2L6M A;  2F8B A;  4DV3 E;  5LMU E;  4DUY E;  1WXR A;  4X65 E;  4AQY E;  4B3S E;  4LF9 E;  2L2M A;  1T4O A;  3HPZ A;  1STU A;  2N3G A;  1IBM E;  4JI1 E;  1ZBQ A;  1XMQ E;  5A2Q C;  1I94 E;  1YYK A;  4YHH E;  1GZ6 A;  4JI7 E;  2L3J A;  3T1H E;  2JY9 A;  4GKJ E;  3F6G A;  4B3T E;  4R03 A;  2RS7 A;  2NUG A;  4LF7 E;  3C4T A;  3J7Y p;  1N32 E;  3RMP A;  2JVA A;  3JTZ A;  1HNX E;  2V87 A;  4JI3 E;  4NXN E;  4KZS A;  2LTS A;  2RTX A;  2L2N A;  4LFA E;  1UHZ A;  3AV0 A;  4DR5 E;  1X48 A;  2JOX A;  4F54 A;  4M2Z A;  2L8T A;  4I8O A;  3VYY A;  2H36 X;  2EWL A;  4BCA A;  2UUB E;  3ADJ A;  4P78 A;  4TUG A;  1HNZ E;  4M30 A;  2V88 A;  1XNQ E;  3OTO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...