4HEIA

2a x-ray structure of hpf from vibrio cholerae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
MQINIQGHHIDLTDSMQDYVHSKFDKLERFFDHINHVQVILRVEKLRQIAEATLHVNQAEIHAHADDENMYAAIDSLVDKLVRQLNKHKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Vibrio cholerae ribosome hibernation promoting factor.
pubmed doi rcsb
molecule tags Translation
molecule keywords RIBOSOME HIBERNATION PROTEIN YHBH
total genus 28
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 4heiA00
1N3GA 4HEIA 2YWQA 1L4SA 2RQLA 1IMUA 3TQMA
chains in the Genus database with same CATH superfamily
4WXDA 2EN4A 2V8QB 1X48A 1X6EA 2YZTA 1PJQA 2JPAA 1IBKE 2UUCE 5A6KA 2I9IA 3LLHA 2LTSA 3KZYA 2EMHA 1YPNA 3EQ1A 1UILA 2NA2A 5AE3A 1YYWA 1IMUA 4JV5E 4R8OA 4DV2E 1T4NA 2E5LE 4M0VA 1IQSA 1N34E 2GPIA 4X9JA 2JXPA 2YPNA 4LF5E 2EN8A 2EPMX 2NUEA 1ZAAC 1YUIA 2EWLA 1LLMC 3ADJA 2UXDE 4DR3E 1FJGE 1Z1BA 3IWBA 2EJ4A 2EQ1A 2LT7A 2M7QA 2DIXA 3IWDA 4F9CB 3HPZA 4LF7E 1N36E 2VQEE 4BS9A 4BHCA 1A1JA 1X5WA 2EE8A 2VQFE 2YTQA 1PDAA 2DSYA 2FTXB 2M9AA 4DKKA 2E72A 4ZYDA 3EPJA 1HNXE 1P47A 4R03A 1A1FA 2EMGA 3THOB 2NUGA 4P78A 2M1SA 2YSPA 2CT1A 3HXLA 1BBGA 2EL5A 2EMLA 2EM5A 1IBME 3J80C 4YY3E 2ENAA 5CFFE 3C4TA 2ZM6E 4TUGA 4AQYE 3VYXA 2UXCE 1BB8A 2EM2A 3HPSA 2RTXA 4R2QA 3VYYA 1ZBTA 2EM3A 3QG5C 2YTPA 2V85A 2YTFA 4TUIA 4OOGC 1A1LA 2L6MA 5T6JA 4F54A 2DLQA 4DV3E 2EPKX 4DR1E 1XMOE 2WBUA 4DR2E 3J7Yp 4M9VC 2EOQA 2EOFA 3M99B 4HEIA 5IWAE 4DV0E 1T39A 2EOHA 2DMIA 3OTOE 3T1HE 3AV0A 1YZ9A 2YTIA 2F8BA 4JI3E 2EORA 3EPKA 4WXCA 2EZ6A 4LF9E 2JOBA 2YWQA 2JYAA 2R76A 4BMJA 2V88A 4R2CA 2EPPA 2KOUA 3ADIA 2GHFA 3MHHC 3KWRA 2EPUA 4M2ZA 2YU5A 4L8NA 4O4KA 1N32E 4DV7E 1PJTA 5KL4A 5KL6A 4DV5E 4JI5E 2LRSA 4JI1E 5BR8E 1YUJA 3ECRA 5AC5A 2ELZA 4BHBA 2MDGA 1NCSA 4DUYE 2L3CA 2L92A 1A1HA 3J81C 2EOYA 1SFEA 3KZZA 1A1IA 4MLVA 2LTRA 4R2SA 1X49A 1YYKA 2JVAA 4Q28A 1ZU1A 4LF6E 1EH8A 4ZYGA 2ODRD 1L4SA 3RMPA 1SR9A 2Q8UA 4O24A 2MDRA 3JTZA 5AE1A 5A2QC 5AASA 4DR4E 2YTJA 3C4BA 1WXRA 4OX9E 1O0WA 2L2NA 1EH6A 4P7DA 3ADGA 1HNZE 2GLIA 1XNQE 2LV2A 2ELYA 2YT4A 2VF1A 1RC7A 4LU9A 1JK1A 2R1FA 2UUAE 2HC5A 5AC4A 1AH5A 4WX9A 4WYQB 2EN7A 4JYAE 2MC6A 2EMWA 4I8OA 4X62E 1WHQA 2KONA 2EPLX 2UUBE 2DLKA 1YFHA 3P1XA 4JI4E 2EQ3A 2EM4A 2FGGA 2ODRC 3BIDA 2MKNA 2PRTA 2BB8A 2UU9E 3DF6A 4YHHE 5F3WA 1YYOA 1RQ0A 4NHRA 2NABA 3JAMC 2CPNA 2EM8A 2WCC3 3MHSC 2B9DA 2EN2A 1X3CA 2JR1A 5A6JA 2EMKA 3J7AG 1TN9A 1X47A 4DV1E 2DB2A 4DR7E 3H09A 2YTNA 2WBTA 2BBGA 2N3HA 2EM7A 4DUZE 3LMLA 1GTKA 2LJHA 1ZBQA 1I94E 2EN3A 2RSMA 4JI8E 4R2DA 4DV4E 3BGHA 5A6BA 1FKAE 1GQEA 3VK6A 2LBSB 4N4RB 2NUFA 4ZYEA 4NXNE 2JP9A 4BCAA 2YSOA 1BBOA 2KHXA 4LF8E 4B3RE 1NEIA 2ENCA 4LF4E 1GZ6A 2L3JA 3C6MA 5TSEA 2RSIA 1DQ3A 3F6GA 2J7JA 3BF2A 2EOJA 4BC7A 1XMQE 5FLXC 1MEYC 4KHPE 2EM6A 2EPXA 2LO3A 1PJSA 2EPAA 1T4LB 4L5NC 2YTGA 2L8TA 1JK2A 5IXMB 2WBSA 2G7HA 1F2IG 4IS1C 2K7IA 1X6HA 4NXME 1HR0E 2MC5A 4O43A 2RS6A 2LUPB 4F2JC 2YRKA 4LTYA 3K6QA 2EOSA 4KWYA 4X8WA 3C6KA 1EKZA 5A69A 4ZYHA 2EPOA 2DRPA 2B3TB 2WZOA 2B7TA 2A25A 2EL6A 2L2MA 2UXBE 4RHBB 2JWOA 5LLQA 2EN6A 5IT9C 2V89A 1RMDA 2LCEA 2EQ0A 1MGTA 2VRDA 1AAYA 3FIGA 2EP3A 4X65E 4F6NA 4JI6E 1ZR9A 5KL5A 2D9HA 2EMYA 4GEQB 1UN6B 4BC9A 3THNA 2EOIA 2E1MA 2N8XA 1QU6A 5LL6R 2LVHA 2ADRA 3AUZA 2V87A 4WSGA 3L00A 5ADZA 2N3GA 4WPYA 3OMLA 4R2RA 4X66E 1N3GA 2EM0A 4LFCE 4JI7E 4BBYA 2ENHA 5KL2A 4FK5C 4WSPA 2V86A 1TF6A 2EMIA 4MLQA 2B7VA 1J26A 2EPZA 2YTOA 1DI2A 3ZOQB 4HTGA 1G2FC 5KL7A 5A6AA 2HJJA 1A1GA 3HQ1A 2CSHA 2EOXA 2YTDA 1QNTA 2M4IA 4F9AB 1X6FA 1YSAC 4GKJE 1KYQA 5A6BD 2EPNA 4B3TE 4B3SE 4K0KE 1WRJA 2EMCA 2MKDA 2HHHE 3T1YE 1XNRE 1EH7A 1UHZA 3EPLA 2K4VA 4Q35B 1KJKA 2EL4A 5AE2A 2RPCA 3DJWA 2CTDA 2L2KB 1A1KA 5LMNE 1HNWE 2F4VE 1N33E 2EPCA 4DV6E 1IQOA 1PKPA 2L33A 2EN1A 5DNYA 4NZVA 4M30A 2LMZA 4JI2E 1IBLE 4R2PA 4GZNC 3MSWA 1WJPA 3UK3C 1WHNA 2EOMA 1B69A 1T38A 2HGHA 2LE2A 4F6MA 2IHR1 2JY9A 2V83A 2RS7A 2EMFA 1UBDC 4RH8A 3JU0A 2EOOA 3VHTB 4R2EA 2YU8A 2LUQA 4KZSA 2H36X 2EMZA 4IJDA 4B3ME 2DMYA 4X64E 1G2DC 4DMIA 4LFAE 2EOZA 2LJUA 4O5GA 5LMUE 1J5EE 4DR5E 1T4OA 2I13A 3TQMA 2YRMA 2VE7C 1TF3A 3BBGA 4DR6E 2EMBA 2YTEA 2JOXA 2RQLA 3F6HA 2EMAA 5KL3A 1STUA 4JI0E 2EPRA 3HTXA 2EMXA 3IWCA 4R2AA 4LFBE 3EPHA 4WFTA 4GKKE 1DGCA 4F9BB 2DGCA 4J8ZA 2EOEA 3ADLA 2FV4B 5IV8B 2EM9A 2YRHA
chains in the Genus database with same CATH topology
1N3GA 4HEIA 2YWQA 1L4SA 2RQLA 1IMUA 3TQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3G A;  4HEI A;  2YWQ A;  1L4S A;  2RQL A;  1IMU A;  3TQM A; 
#chains in the Genus database with same CATH topology
 4WXD A;  2EN4 A;  2V8Q B;  1X48 A;  1X6E A;  2YZT A;  1PJQ A;  2JPA A;  1IBK E;  2UUC E;  5A6K A;  2I9I A;  3LLH A;  2LTS A;  3KZY A;  2EMH A;  1YPN A;  3EQ1 A;  1UIL A;  2NA2 A;  5AE3 A;  1YYW A;  1IMU A;  4JV5 E;  4R8O A;  4DV2 E;  1T4N A;  2E5L E;  4M0V A;  1IQS A;  1N34 E;  2GPI A;  4X9J A;  2JXP A;  2YPN A;  4LF5 E;  2EN8 A;  2EPM X;  2NUE A;  1ZAA C;  1YUI A;  2EWL A;  1LLM C;  3ADJ A;  2UXD E;  4DR3 E;  1FJG E;  1Z1B A;  3IWB A;  2EJ4 A;  2EQ1 A;  2LT7 A;  2M7Q A;  2DIX A;  3IWD A;  4F9C B;  3HPZ A;  4LF7 E;  1N36 E;  2VQE E;  4BS9 A;  4BHC A;  1A1J A;  1X5W A;  2EE8 A;  2VQF E;  2YTQ A;  1PDA A;  2DSY A;  2FTX B;  2M9A A;  4DKK A;  2E72 A;  4ZYD A;  3EPJ A;  1HNX E;  1P47 A;  4R03 A;  1A1F A;  2EMG A;  3THO B;  2NUG A;  4P78 A;  2M1S A;  2YSP A;  2CT1 A;  3HXL A;  1BBG A;  2EL5 A;  2EML A;  2EM5 A;  1IBM E;  3J80 C;  4YY3 E;  2ENA A;  5CFF E;  3C4T A;  2ZM6 E;  4TUG A;  4AQY E;  3VYX A;  2UXC E;  1BB8 A;  2EM2 A;  3HPS A;  2RTX A;  4R2Q A;  3VYY A;  1ZBT A;  2EM3 A;  3QG5 C;  2YTP A;  2V85 A;  2YTF A;  4TUI A;  4OOG C;  1A1L A;  2L6M A;  5T6J A;  4F54 A;  2DLQ A;  4DV3 E;  2EPK X;  4DR1 E;  1XMO E;  2WBU A;  4DR2 E;  3J7Y p;  4M9V C;  2EOQ A;  2EOF A;  3M99 B;  4HEI A;  5IWA E;  4DV0 E;  1T39 A;  2EOH A;  2DMI A;  3OTO E;  3T1H E;  3AV0 A;  1YZ9 A;  2YTI A;  2F8B A;  4JI3 E;  2EOR A;  3EPK A;  4WXC A;  2EZ6 A;  4LF9 E;  2JOB A;  2YWQ A;  2JYA A;  2R76 A;  4BMJ A;  2V88 A;  4R2C A;  2EPP A;  2KOU A;  3ADI A;  2GHF A;  3MHH C;  3KWR A;  2EPU A;  4M2Z A;  2YU5 A;  4L8N A;  4O4K A;  1N32 E;  4DV7 E;  1PJT A;  5KL4 A;  5KL6 A;  4DV5 E;  4JI5 E;  2LRS A;  4JI1 E;  5BR8 E;  1YUJ A;  3ECR A;  5AC5 A;  2ELZ A;  4BHB A;  2MDG A;  1NCS A;  4DUY E;  2L3C A;  2L92 A;  1A1H A;  3J81 C;  2EOY A;  1SFE A;  3KZZ A;  1A1I A;  4MLV A;  2LTR A;  4R2S A;  1X49 A;  1YYK A;  2JVA A;  4Q28 A;  1ZU1 A;  4LF6 E;  1EH8 A;  4ZYG A;  2ODR D;  1L4S A;  3RMP A;  1SR9 A;  2Q8U A;  4O24 A;  2MDR A;  3JTZ A;  5AE1 A;  5A2Q C;  5AAS A;  4DR4 E;  2YTJ A;  3C4B A;  1WXR A;  4OX9 E;  1O0W A;  2L2N A;  1EH6 A;  4P7D A;  3ADG A;  1HNZ E;  2GLI A;  1XNQ E;  2LV2 A;  2ELY A;  2YT4 A;  2VF1 A;  1RC7 A;  4LU9 A;  1JK1 A;  2R1F A;  2UUA E;  2HC5 A;  5AC4 A;  1AH5 A;  4WX9 A;  4WYQ B;  2EN7 A;  4JYA E;  2MC6 A;  2EMW A;  4I8O A;  4X62 E;  1WHQ A;  2KON A;  2EPL X;  2UUB E;  2DLK A;  1YFH A;  3P1X A;  4JI4 E;  2EQ3 A;  2EM4 A;  2FGG A;  2ODR C;  3BID A;  2MKN A;  2PRT A;  2BB8 A;  2UU9 E;  3DF6 A;  4YHH E;  5F3W A;  1YYO A;  1RQ0 A;  4NHR A;  2NAB A;  3JAM C;  2CPN A;  2EM8 A;  2WCC 3;  3MHS C;  2B9D A;  2EN2 A;  1X3C A;  2JR1 A;  5A6J A;  2EMK A;  3J7A G;  1TN9 A;  1X47 A;  4DV1 E;  2DB2 A;  4DR7 E;  3H09 A;  2YTN A;  2WBT A;  2BBG A;  2N3H A;  2EM7 A;  4DUZ E;  3LML A;  1GTK A;  2LJH A;  1ZBQ A;  1I94 E;  2EN3 A;  2RSM A;  4JI8 E;  4R2D A;  4DV4 E;  3BGH A;  5A6B A;  1FKA E;  1GQE A;  3VK6 A;  2LBS B;  4N4R B;  2NUF A;  4ZYE A;  4NXN E;  2JP9 A;  4BCA A;  2YSO A;  1BBO A;  2KHX A;  4LF8 E;  4B3R E;  1NEI A;  2ENC A;  4LF4 E;  1GZ6 A;  2L3J A;  3C6M A;  5TSE A;  2RSI A;  1DQ3 A;  3F6G A;  2J7J A;  3BF2 A;  2EOJ A;  4BC7 A;  1XMQ E;  5FLX C;  1MEY C;  4KHP E;  2EM6 A;  2EPX A;  2LO3 A;  1PJS A;  2EPA A;  1T4L B;  4L5N C;  2YTG A;  2L8T A;  1JK2 A;  5IXM B;  2WBS A;  2G7H A;  1F2I G;  4IS1 C;  2K7I A;  1X6H A;  4NXM E;  1HR0 E;  2MC5 A;  4O43 A;  2RS6 A;  2LUP B;  4F2J C;  2YRK A;  4LTY A;  3K6Q A;  2EOS A;  4KWY A;  4X8W A;  3C6K A;  1EKZ A;  5A69 A;  4ZYH A;  2EPO A;  2DRP A;  2B3T B;  2WZO A;  2B7T A;  2A25 A;  2EL6 A;  2L2M A;  2UXB E;  4RHB B;  2JWO A;  5LLQ A;  2EN6 A;  5IT9 C;  2V89 A;  1RMD A;  2LCE A;  2EQ0 A;  1MGT A;  2VRD A;  1AAY A;  3FIG A;  2EP3 A;  4X65 E;  4F6N A;  4JI6 E;  1ZR9 A;  5KL5 A;  2D9H A;  2EMY A;  4GEQ B;  1UN6 B;  4BC9 A;  3THN A;  2EOI A;  2E1M A;  2N8X A;  1QU6 A;  5LL6 R;  2LVH A;  2ADR A;  3AUZ A;  2V87 A;  4WSG A;  3L00 A;  5ADZ A;  2N3G A;  4WPY A;  3OML A;  4R2R A;  4X66 E;  1N3G A;  2EM0 A;  4LFC E;  4JI7 E;  4BBY A;  2ENH A;  5KL2 A;  4FK5 C;  4WSP A;  2V86 A;  1TF6 A;  2EMI A;  4MLQ A;  2B7V A;  1J26 A;  2EPZ A;  2YTO A;  1DI2 A;  3ZOQ B;  4HTG A;  1G2F C;  5KL7 A;  5A6A A;  2HJJ A;  1A1G A;  3HQ1 A;  2CSH A;  2EOX A;  2YTD A;  1QNT A;  2M4I A;  4F9A B;  1X6F A;  1YSA C;  4GKJ E;  1KYQ A;  5A6B D;  2EPN A;  4B3T E;  4B3S E;  4K0K E;  1WRJ A;  2EMC A;  2MKD A;  2HHH E;  3T1Y E;  1XNR E;  1EH7 A;  1UHZ A;  3EPL A;  2K4V A;  4Q35 B;  1KJK A;  2EL4 A;  5AE2 A;  2RPC A;  3DJW A;  2CTD A;  2L2K B;  1A1K A;  5LMN E;  1HNW E;  2F4V E;  1N33 E;  2EPC A;  4DV6 E;  1IQO A;  1PKP A;  2L33 A;  2EN1 A;  5DNY A;  4NZV A;  4M30 A;  2LMZ A;  4JI2 E;  1IBL E;  4R2P A;  4GZN C;  3MSW A;  1WJP A;  3UK3 C;  1WHN A;  2EOM A;  1B69 A;  1T38 A;  2HGH A;  2LE2 A;  4F6M A;  2IHR 1;  2JY9 A;  2V83 A;  2RS7 A;  2EMF A;  1UBD C;  4RH8 A;  3JU0 A;  2EOO A;  3VHT B;  4R2E A;  2YU8 A;  2LUQ A;  4KZS A;  2H36 X;  2EMZ A;  4IJD A;  4B3M E;  2DMY A;  4X64 E;  1G2D C;  4DMI A;  4LFA E;  2EOZ A;  2LJU A;  4O5G A;  5LMU E;  1J5E E;  4DR5 E;  1T4O A;  2I13 A;  3TQM A;  2YRM A;  2VE7 C;  1TF3 A;  3BBG A;  4DR6 E;  2EMB A;  2YTE A;  2JOX A;  2RQL A;  3F6H A;  2EMA A;  5KL3 A;  1STU A;  4JI0 E;  2EPR A;  3HTX A;  2EMX A;  3IWC A;  4R2A A;  4LFB E;  3EPH A;  4WFT A;  4GKK E;  1DGC A;  4F9B B;  2DGC A;  4J8Z A;  2EOE A;  3ADL A;  2FV4 B;  5IV8 B;  2EM9 A;  2YRH A; 
#chains in the Genus database with same CATH homology
 1N3G A;  4HEI A;  2YWQ A;  1L4S A;  2RQL A;  1IMU A;  3TQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...