4HEIA

2a x-ray structure of hpf from vibrio cholerae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
MQINIQGHHIDLTDSMQDYVHSKFDKLERFFDHINHVQVILRVEKLRQIAEATLHVNQAEIHAHADDENMYAAIDSLVDKLVRQLNKHKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME HIBERNATION PROTEIN YHBH
publication title Structure of Vibrio cholerae ribosome hibernation promoting factor.
pubmed doi rcsb
molecule tags Translation
total genus 28
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 4heiA00
1N3GA 3TQMA 1IMUA 1L4SA 2RQLA 4HEIA 2YWQA
chains in the Genus database with same CATH superfamily
2EPMX 2MC6A 1O0WA 4K0KE 2JVAA 2EQ1A 5A6BA 4NXME 2L6MA 2YTGA 2EZ6A 4AQYE 2FGGA 5IWAE 2YSOA 3F6HA 2KONA 4DR6E 2E5LE 4DMIA 2EMKA 4Q28A 1N34E 3T1YE 1HNXE 1KJKA 2CT1A 2L3JA 1P47A 2EPKX 2DLKA 1A1LA 4B3RE 1YYOA 1ZAAC 2NUGA 4ZYDA 4DR1E 4X66E 2GPIA 2LJUA 2JOBA 2UXDE 3VYXA 3EPLA 2MDRA 1SFEA 2JR1A 5IXMB 5AC5A 2EOEA 2L2KB 1N32E 4R8OA 4BMJA 2DLQA 2L92A 2L3CA 1IBKE 2JY9A 1BBOA 4MLVA 2EMBA 2DMYA 1HR0E 3KZYA 2JP9A 1XMOE 1WHNA 2M9AA 3ZOQB 2RS7A 3AV0A 2MKNA 1WXRA 2V87A 5A6AA 2EMHA 4X8WA 4R2EA 2VRDA 3OTOE 2F8BA 1ZBTA 1UILA 1T39A 1WJPA 2K4VA 4KZSA 2CTDA 3C6KA 2BBGA 2EM0A 1YSAC 2GHFA 1YYKA 4JI6E 2M7QA 3RMPA 5A69A 2EL5A 1RC7A 2EM3A 4JI2E 1ZBQA 2V86A 1FKAE 2LTRA 2EM9A 2ODRD 2F4VE 1QU6A 1DQ3A 1N3GA 2YTIA 4R2AA 2EL6A 2L2NA 2RSMA 4B3ME 3J7Yp 5ADZA 2EN4A 1J26A 2EJ4A 4DR5E 2FV4B 2EMWA 4JV5E 4JI0E 1SR9A 2WBTA 5IT9C 4LU9A 1GQEA 5BR8E 1EH7A 1X3CA 1J5EE 1FJGE 1IQOA 4LTYA 4LF7E 2WBSA 4JI1E 5LMNE 4JI8E 2N3GA 3J81C 3FIGA 2ENHA 4R2SA 1UN6B 4B3TE 2EQ3A 3BGHA 2YWQA 2EM6A 3MSWA 5A2QC 2YT4A 2V85A 1IQSA 4LF9E 3ADIA 1TF6A 2L33A 5AE3A 1N33E 2NUFA 2EPZA 2Q8UA 1PDAA 2JOXA 4O43A 4X64E 3K6QA 2EM8A 1T38A 1X6EA 3DF6A 4DV5E 5KL6A 2LMZA 2UXCE 1BBGA 1T4LB 2ADRA 1WHQA 2DRPA 4DV3E 2B7VA 1X6FA 2BB8A 4R2PA 4JI4E 4M30A 4DR2E 2GLIA 4NHRA 4RHBB 2B9DA 1RQ0A 4R2CA 2YRHA 2EM7A 5AC4A 1GZ6A 2EPNA 4NZVA 5AASA 2EN3A 5F3WA 1X47A 1AAYA 4WX9A 1KYQA 3H09A 4I8OA 2EOYA 3DJWA 2DB2A 2EPRA 1MGTA 1X6HA 4BHBA 2EN6A 1YFHA 4O5GA 2MKDA 2YTJA 2JYAA 4J8ZA 5AE2A 4LFCE 2EN1A 1BB8A 2WBUA 2DIXA 4HTGA 4F9AB 2V89A 4Q35B 1T4NA 1YYWA 2EMFA 2EM2A 4IJDA 1DI2A 2M1SA 4WYQB 4M0VA 2LBSB 1A1KA 2RTXA 1IBME 2UUCE 1A1HA 2EMLA 2EOHA 1YUJA 4BHCA 2H36X 3KZZA 1A1GA 1XNRE 1TN9A 5KL5A 4TUGA 1I94E 4N4RB 4BBYA 2UU9E 2HHHE 4ZYEA 1ZR9A 4JI5E 3P1XA 4BS9A 2R1FA 3TQMA 4F9BB 2CSHA 2G7HA 2YU8A 1A1JA 2WZOA 1B69A 2VE7C 5KL4A 4DR3E 3HTXA 4F6NA 4OOGC 2EOXA 2LE2A 2UUBE 2LUQA 4DR4E 2FTXB 2KOUA 2EPUA 5A6KA 2EE8A 4DUYE 3AUZA 3C4BA 3EPHA 4FK5C 4BC9A 2EMXA 2YTEA 3J80C 2LCEA 2MDGA 4NXNE 4P7DA 3L00A 2EQ0A 3BBGA 2J7JA 1UBDC 3OMLA 3ADJA 5FLXC 4DV7E 1LLMC 1EH6A 3T1HE 2NUEA 2L8TA 2ODRC 4DV2E 2EWLA 1IMUA 4R2DA 2EMIA 4JYAE 2EOJA 2E1MA 3HQ1A 2EN2A 4YY3E 1XNQE 4L8NA 2R76A 2N3HA 2EMAA 4O4KA 4WXCA 5DNYA 2E72A 3C6MA 4RH8A 4O24A 2LT7A 3MHHC 1PJTA 1WRJA 3LLHA 4WSPA 4DV1E 4F2JC 3ADGA 1NEIA 2L2MA 5AE1A 4DV0E 5IV8B 2EMYA 4M9VC 2YTOA 2RPCA 2YPNA 3THNA 3BF2A 4GKKE 4LF4E 4R2RA 1Z1BA 1GTKA 2EM4A 1A1FA 3VK6A 4KHPE 2VQEE 2A25A 1G2DC 2YTPA 2NA2A 3F6GA 2EMZA 4JI3E 1JK1A 2ENAA 2LUPB 4TUIA 2RQLA 1TF3A 2JPAA 1F2IG 4GKJE 4DV6E 4MLQA 5LL6R 4X65E 2EOQA 3IWBA 4X9JA 1PKPA 2MC5A 1T4OA 2D9HA 2V88A 4GZNC 3VHTB 2VF1A 1G2FC 2LJHA 2JXPA 4WSGA 4R2QA 2YTFA 3LMLA 4ZYHA 4BC7A 4LF8E 5KL7A 2YZTA 5A6JA 3VYYA 2YTNA 2UUAE 2EMCA 2EN7A 1L4SA 4YHHE 1ZU1A 2LO3A 2VQFE 4LF6E 4DR7E 3KWRA 2I13A 1IBLE 2CPNA 1RMDA 3JU0A 3EPJA 2DMIA 2V83A 2LV2A 4WPYA 1X49A 2EOMA 2EPXA 1NCSA 2EPAA 2KHXA 2LRSA 3ECRA 2EPOA 2EOOA 4KWYA 4X62E 4LFBE 5A6BD 2B3TB 4L5NC 4P78A 2EL4A 1UHZA 2DGCA 2WCC3 4HEIA 1XMQE 2EOIA 4JI7E 2RSIA 2YSPA 5KL2A 4LF5E 3HPZA 2V8QB 3ADLA 1X5WA 2HGHA 2JWOA 2EPLX 2EMGA 2I9IA 3EPKA 1QNTA 5KL3A 4F54A 2YTDA 2EM5A 1YUIA 1MEYC 2EN8A 2EOZA 5LLQA 1N36E 2HC5A 3M99B 4WXDA 2LVHA 3JTZA 4F9CB 2RS6A 2YTQA 5T6JA 2IHR1 2EOSA 3HPSA 4GEQB 2NABA 2EOFA 1PJSA 3J7AG 1DGCA 4DV4E 3BIDA 2LTSA 2PRTA 4M2ZA 2M4IA 3MHSC 1PJQA 2YRMA 3QG5C 2EPCA 2K7IA 4WFTA 3THOB 4ZYGA 1EH8A 3EQ1A 5LMUE 2HJJA 4IS1C 4DKKA 2EORA 3UK3C 2N8XA 3IWDA 2B7TA 1X48A 3IWCA 1EKZA 1HNWE 3JAMC 2ELYA 2ENCA 4LFAE 5TSEA 1JK2A 1AH5A 1HNZE 2EPPA 1A1IA 2EP3A 1STUA 3C4TA 4DUZE 2ELZA 2UXBE 1YZ9A 4R03A 5CFFE 1YPNA 4B3SE 4F6MA 4OX9E 2DSYA 2YU5A 4BCAA 3HXLA 2ZM6E 2YRKA
chains in the Genus database with same CATH topology
1N3GA 3TQMA 1IMUA 1L4SA 2RQLA 4HEIA 2YWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3G A;  3TQM A;  1IMU A;  1L4S A;  2RQL A;  4HEI A;  2YWQ A; 
#chains in the Genus database with same CATH topology
 2EPM X;  2MC6 A;  1O0W A;  4K0K E;  2JVA A;  2EQ1 A;  5A6B A;  4NXM E;  2L6M A;  2YTG A;  2EZ6 A;  4AQY E;  2FGG A;  5IWA E;  2YSO A;  3F6H A;  2KON A;  4DR6 E;  2E5L E;  4DMI A;  2EMK A;  4Q28 A;  1N34 E;  3T1Y E;  1HNX E;  1KJK A;  2CT1 A;  2L3J A;  1P47 A;  2EPK X;  2DLK A;  1A1L A;  4B3R E;  1YYO A;  1ZAA C;  2NUG A;  4ZYD A;  4DR1 E;  4X66 E;  2GPI A;  2LJU A;  2JOB A;  2UXD E;  3VYX A;  3EPL A;  2MDR A;  1SFE A;  2JR1 A;  5IXM B;  5AC5 A;  2EOE A;  2L2K B;  1N32 E;  4R8O A;  4BMJ A;  2DLQ A;  2L92 A;  2L3C A;  1IBK E;  2JY9 A;  1BBO A;  4MLV A;  2EMB A;  2DMY A;  1HR0 E;  3KZY A;  2JP9 A;  1XMO E;  1WHN A;  2M9A A;  3ZOQ B;  2RS7 A;  3AV0 A;  2MKN A;  1WXR A;  2V87 A;  5A6A A;  2EMH A;  4X8W A;  4R2E A;  2VRD A;  3OTO E;  2F8B A;  1ZBT A;  1UIL A;  1T39 A;  1WJP A;  2K4V A;  4KZS A;  2CTD A;  3C6K A;  2BBG A;  2EM0 A;  1YSA C;  2GHF A;  1YYK A;  4JI6 E;  2M7Q A;  3RMP A;  5A69 A;  2EL5 A;  1RC7 A;  2EM3 A;  4JI2 E;  1ZBQ A;  2V86 A;  1FKA E;  2LTR A;  2EM9 A;  2ODR D;  2F4V E;  1QU6 A;  1DQ3 A;  1N3G A;  2YTI A;  4R2A A;  2EL6 A;  2L2N A;  2RSM A;  4B3M E;  3J7Y p;  5ADZ A;  2EN4 A;  1J26 A;  2EJ4 A;  4DR5 E;  2FV4 B;  2EMW A;  4JV5 E;  4JI0 E;  1SR9 A;  2WBT A;  5IT9 C;  4LU9 A;  1GQE A;  5BR8 E;  1EH7 A;  1X3C A;  1J5E E;  1FJG E;  1IQO A;  4LTY A;  4LF7 E;  2WBS A;  4JI1 E;  5LMN E;  4JI8 E;  2N3G A;  3J81 C;  3FIG A;  2ENH A;  4R2S A;  1UN6 B;  4B3T E;  2EQ3 A;  3BGH A;  2YWQ A;  2EM6 A;  3MSW A;  5A2Q C;  2YT4 A;  2V85 A;  1IQS A;  4LF9 E;  3ADI A;  1TF6 A;  2L33 A;  5AE3 A;  1N33 E;  2NUF A;  2EPZ A;  2Q8U A;  1PDA A;  2JOX A;  4O43 A;  4X64 E;  3K6Q A;  2EM8 A;  1T38 A;  1X6E A;  3DF6 A;  4DV5 E;  5KL6 A;  2LMZ A;  2UXC E;  1BBG A;  1T4L B;  2ADR A;  1WHQ A;  2DRP A;  4DV3 E;  2B7V A;  1X6F A;  2BB8 A;  4R2P A;  4JI4 E;  4M30 A;  4DR2 E;  2GLI A;  4NHR A;  4RHB B;  2B9D A;  1RQ0 A;  4R2C A;  2YRH A;  2EM7 A;  5AC4 A;  1GZ6 A;  2EPN A;  4NZV A;  5AAS A;  2EN3 A;  5F3W A;  1X47 A;  1AAY A;  4WX9 A;  1KYQ A;  3H09 A;  4I8O A;  2EOY A;  3DJW A;  2DB2 A;  2EPR A;  1MGT A;  1X6H A;  4BHB A;  2EN6 A;  1YFH A;  4O5G A;  2MKD A;  2YTJ A;  2JYA A;  4J8Z A;  5AE2 A;  4LFC E;  2EN1 A;  1BB8 A;  2WBU A;  2DIX A;  4HTG A;  4F9A B;  2V89 A;  4Q35 B;  1T4N A;  1YYW A;  2EMF A;  2EM2 A;  4IJD A;  1DI2 A;  2M1S A;  4WYQ B;  4M0V A;  2LBS B;  1A1K A;  2RTX A;  1IBM E;  2UUC E;  1A1H A;  2EML A;  2EOH A;  1YUJ A;  4BHC A;  2H36 X;  3KZZ A;  1A1G A;  1XNR E;  1TN9 A;  5KL5 A;  4TUG A;  1I94 E;  4N4R B;  4BBY A;  2UU9 E;  2HHH E;  4ZYE A;  1ZR9 A;  4JI5 E;  3P1X A;  4BS9 A;  2R1F A;  3TQM A;  4F9B B;  2CSH A;  2G7H A;  2YU8 A;  1A1J A;  2WZO A;  1B69 A;  2VE7 C;  5KL4 A;  4DR3 E;  3HTX A;  4F6N A;  4OOG C;  2EOX A;  2LE2 A;  2UUB E;  2LUQ A;  4DR4 E;  2FTX B;  2KOU A;  2EPU A;  5A6K A;  2EE8 A;  4DUY E;  3AUZ A;  3C4B A;  3EPH A;  4FK5 C;  4BC9 A;  2EMX A;  2YTE A;  3J80 C;  2LCE A;  2MDG A;  4NXN E;  4P7D A;  3L00 A;  2EQ0 A;  3BBG A;  2J7J A;  1UBD C;  3OML A;  3ADJ A;  5FLX C;  4DV7 E;  1LLM C;  1EH6 A;  3T1H E;  2NUE A;  2L8T A;  2ODR C;  4DV2 E;  2EWL A;  1IMU A;  4R2D A;  2EMI A;  4JYA E;  2EOJ A;  2E1M A;  3HQ1 A;  2EN2 A;  4YY3 E;  1XNQ E;  4L8N A;  2R76 A;  2N3H A;  2EMA A;  4O4K A;  4WXC A;  5DNY A;  2E72 A;  3C6M A;  4RH8 A;  4O24 A;  2LT7 A;  3MHH C;  1PJT A;  1WRJ A;  3LLH A;  4WSP A;  4DV1 E;  4F2J C;  3ADG A;  1NEI A;  2L2M A;  5AE1 A;  4DV0 E;  5IV8 B;  2EMY A;  4M9V C;  2YTO A;  2RPC A;  2YPN A;  3THN A;  3BF2 A;  4GKK E;  4LF4 E;  4R2R A;  1Z1B A;  1GTK A;  2EM4 A;  1A1F A;  3VK6 A;  4KHP E;  2VQE E;  2A25 A;  1G2D C;  2YTP A;  2NA2 A;  3F6G A;  2EMZ A;  4JI3 E;  1JK1 A;  2ENA A;  2LUP B;  4TUI A;  2RQL A;  1TF3 A;  2JPA A;  1F2I G;  4GKJ E;  4DV6 E;  4MLQ A;  5LL6 R;  4X65 E;  2EOQ A;  3IWB A;  4X9J A;  1PKP A;  2MC5 A;  1T4O A;  2D9H A;  2V88 A;  4GZN C;  3VHT B;  2VF1 A;  1G2F C;  2LJH A;  2JXP A;  4WSG A;  4R2Q A;  2YTF A;  3LML A;  4ZYH A;  4BC7 A;  4LF8 E;  5KL7 A;  2YZT A;  5A6J A;  3VYY A;  2YTN A;  2UUA E;  2EMC A;  2EN7 A;  1L4S A;  4YHH E;  1ZU1 A;  2LO3 A;  2VQF E;  4LF6 E;  4DR7 E;  3KWR A;  2I13 A;  1IBL E;  2CPN A;  1RMD A;  3JU0 A;  3EPJ A;  2DMI A;  2V83 A;  2LV2 A;  4WPY A;  1X49 A;  2EOM A;  2EPX A;  1NCS A;  2EPA A;  2KHX A;  2LRS A;  3ECR A;  2EPO A;  2EOO A;  4KWY A;  4X62 E;  4LFB E;  5A6B D;  2B3T B;  4L5N C;  4P78 A;  2EL4 A;  1UHZ A;  2DGC A;  2WCC 3;  4HEI A;  1XMQ E;  2EOI A;  4JI7 E;  2RSI A;  2YSP A;  5KL2 A;  4LF5 E;  3HPZ A;  2V8Q B;  3ADL A;  1X5W A;  2HGH A;  2JWO A;  2EPL X;  2EMG A;  2I9I A;  3EPK A;  1QNT A;  5KL3 A;  4F54 A;  2YTD A;  2EM5 A;  1YUI A;  1MEY C;  2EN8 A;  2EOZ A;  5LLQ A;  1N36 E;  2HC5 A;  3M99 B;  4WXD A;  2LVH A;  3JTZ A;  4F9C B;  2RS6 A;  2YTQ A;  5T6J A;  2IHR 1;  2EOS A;  3HPS A;  4GEQ B;  2NAB A;  2EOF A;  1PJS A;  3J7A G;  1DGC A;  4DV4 E;  3BID A;  2LTS A;  2PRT A;  4M2Z A;  2M4I A;  3MHS C;  1PJQ A;  2YRM A;  3QG5 C;  2EPC A;  2K7I A;  4WFT A;  3THO B;  4ZYG A;  1EH8 A;  3EQ1 A;  5LMU E;  2HJJ A;  4IS1 C;  4DKK A;  2EOR A;  3UK3 C;  2N8X A;  3IWD A;  2B7T A;  1X48 A;  3IWC A;  1EKZ A;  1HNW E;  3JAM C;  2ELY A;  2ENC A;  4LFA E;  5TSE A;  1JK2 A;  1AH5 A;  1HNZ E;  2EPP A;  1A1I A;  2EP3 A;  1STU A;  3C4T A;  4DUZ E;  2ELZ A;  2UXB E;  1YZ9 A;  4R03 A;  5CFF E;  1YPN A;  4B3S E;  4F6M A;  4OX9 E;  2DSY A;  2YU5 A;  4BCA A;  3HXL A;  2ZM6 E;  2YRK A; 
#chains in the Genus database with same CATH homology
 1N3G A;  3TQM A;  1IMU A;  1L4S A;  2RQL A;  4HEI A;  2YWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...