4HEIA

2a x-ray structure of hpf from vibrio cholerae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
MQINIQGHHIDLTDSMQDYVHSKFDKLERFFDHINHVQVILRVEKLRQIAEATLHVNQAEIHAHADDENMYAAIDSLVDKLVRQLNKHKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Vibrio cholerae ribosome hibernation promoting factor.
pubmed doi rcsb
molecule tags Translation
molecule keywords RIBOSOME HIBERNATION PROTEIN YHBH
total genus 28
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 4heiA00
3TQMA 4HEIA 2YWQA 2RQLA 1N3GA 1IMUA 1L4SA
chains in the Genus database with same CATH superfamily
4B3TE 5CFFE 1NCSA 2LE2A 4BBYA 4O43A 1IQOA 1HNWE 4N4RB 3DJWA 5A6BD 3THNA 1YYOA 4JI2E 2JP9A 2WBSA 1DI2A 3HTXA 1ZBQA 3J7Yp 2EPCA 2NA2A 1PJSA 2I9IA 2PRTA 1FJGE 3LMLA 2EL5A 2EPLX 4DR5E 5KL5A 1ZBTA 2MC5A 2YTOA 5A69A 4ZYHA 2RSIA 3UK3C 4LU9A 2EQ1A 2JR1A 4R03A 2L3CA 5IT9C 2YU5A 3HPSA 5A6KA 4I8OA 1G2DC 1BBGA 1O0WA 1X3CA 4WYQB 2EN6A 2NUFA 1Z1BA 2VF1A 3OMLA 2ELYA 1YPNA 5KL4A 2WZOA 3J7AG 2RQLA 1N3GA 3EPHA 2MC6A 2JXPA 4OOGC 4L5NC 2DSYA 4R2PA 1EKZA 4LTYA 3JAMC 3J80C 4DR7E 1GZ6A 4DV0E 3DF6A 4BS9A 2V87A 3QG5C 2B7TA 2EQ0A 1LLMC 2YRMA 2EMCA 3H09A 2LJHA 3HXLA 2LBSB 4DMIA 1L4SA 1MEYC 2L3JA 1TF3A 3BIDA 1PDAA 4IS1C 2EPAA 2V88A 2M7QA 4DV6E 2FTXB 1F2IG 4JI3E 4DR1E 4MLVA 5LLQA 2YTPA 5AC4A 1X48A 2ODRD 2YTEA 2FGGA 3VYYA 4LF4E 3HQ1A 1TN9A 4DV1E 4GZNC 4JI6E 4KWYA 1YUJA 1SFEA 2K7IA 3BGHA 1T4NA 1NEIA 2DGCA 4X65E 3IWBA 5A6BA 1GTKA 2MKDA 2YTDA 5IWAE 4F6MA 4GKKE 3IWDA 5TSEA 1KJKA 1UHZA 4LF6E 3T1HE 3EQ1A 2YSPA 2EMBA 5LMUE 1YFHA 2EM8A 2EM2A 4JI8E 3F6HA 2EOMA 2EPMX 3L00A 5AE2A 2EM0A 2E1MA 2V89A 4R2RA 4GKJE 1TF6A 3AV0A 1UILA 3EPKA 2YTQA 4P78A 4M2ZA 1A1LA 5DNYA 5A6JA 2H36X 4NHRA 2UXCE 2YSOA 2N8XA 4NXME 4M30A 2DRPA 2D9HA 2EMKA 2F4VE 1X47A 4F9AB 1JK1A 1A1FA 4Q35B 5F3WA 4GEQB 2V8QB 4JV5E 4BHCA 4ZYDA 2EOIA 2L2KB 1I94E 4AQYE 3BBGA 4R2EA 2YTFA 1QNTA 5KL3A 2EN8A 2LTRA 2JYAA 5IV8B 3T1YE 4LFAE 3C6KA 1B69A 2V86A 1WRJA 3MHHC 4F9CB 2EOSA 2GHFA 2EMZA 1J26A 4TUIA 4NXNE 2HHHE 4DR6E 2HGHA 2N3HA 2E72A 5ADZA 1IBLE 4LF8E 4DKKA 4DR4E 2YT4A 4YHHE 3EPLA 4F2JC 4WXDA 3JU0A 1RMDA 5AASA 2E5LE 2ADRA 2VQEE 5KL7A 1STUA 1XMQE 2ODRC 3ECRA 4P7DA 4M0VA 1J5EE 2EPXA 3HPZA 2YTGA 3LLHA 4F6NA 2EMHA 2M1SA 4ZYGA 4DV3E 1HNXE 4X62E 2L2MA 2EP3A 2UXBE 1RQ0A 2CTDA 2N3GA 2UU9E 2EOXA 3C4TA 2YZTA 2G7HA 4LFBE 5BR8E 1XNRE 2YPNA 1BBOA 4MLQA 2EZ6A 2EMAA 3JTZA 1PJTA 2M9AA 4LF9E 2EPKX 5LMNE 2EMYA 2YWQA 1EH8A 4J8ZA 4HEIA 4JI0E 2ENCA 5AE1A 4X64E 1X6HA 4DR3E 2EOHA 2YRKA 1EH6A 2B9DA 4R8OA 1X5WA 2EM5A 2RS7A 2B7VA 2UUBE 4NZVA 2LUQA 2EM3A 2KHXA 2ZM6E 2DMIA 4LF5E 4DV5E 4BHBA 5AE3A 4M9VC 2YRHA 3AUZA 1ZAAC 4DV4E 1WHNA 3C4BA 4BMJA 1IBME 2EWLA 2LCEA 2EPRA 4B3RE 2EJ4A 2RSMA 2EOJA 2J7JA 4WSPA 3BF2A 2ELZA 2RPCA 1UBDC 3ZOQB 2EQ3A 3M99B 1ZU1A 1T4LB 2LV2A 2EE8A 2V83A 2R1FA 4JI1E 1N32E 2EM6A 2HJJA 2MDRA 2YU8A 4BCAA 2UXDE 2UUAE 2DIXA 1T39A 1N36E 4ZYEA 2EN1A 2EPOA 2V85A 4WFTA 2LUPB 2RTXA 1T38A 4JI4E 2EOOA 3KWRA 1A1JA 1WHQA 2YTNA 2EPUA 4X66E 2EPZA 2HC5A 3TQMA 2EOFA 4IJDA 1IQSA 2FV4B 4DV7E 1X6EA 2I13A 2RS6A 1PKPA 3F6GA 1X49A 1DGCA 1KYQA 1WXRA 5IXMB 2LT7A 4YY3E 2EN3A 4JYAE 2LTSA 1RC7A 5KL2A 1A1GA 2CSHA 5KL6A 2UUCE 4DUYE 2B3TB 1BB8A 2EL6A 2DB2A 2Q8UA 5AC5A 1A1KA 4F9BB 2GPIA 2JOBA 1N33E 4Q28A 2A25A 2L2NA 4O24A 2EMFA 1IBKE 5T6JA 4R2QA 1XMOE 2MKNA 2NABA 3FIGA 3ADJA 2DLQA 4FK5C 2YTIA 2NUEA 2VRDA 3MSWA 5FLXC 4JI7E 3KZYA 2WBUA 1MGTA 4B3ME 2EOQA 5LL6R 2R76A 2EMWA 2VE7C 2LMZA 1AAYA 2LVHA 1YYWA 4KHPE 2F8BA 3MHSC 1GQEA 2CPNA 2K4VA 3KZZA 1HNZE 3EPJA 4B3SE 2EM4A 4KZSA 3VHTB 3RMPA 4R2SA 1YUIA 4BC7A 2IHR1 4O5GA 1IMUA 1WJPA 2EM9A 2EM7A 2LRSA 2YTJA 3C6MA 3ADIA 3ADLA 3P1XA 1DQ3A 3J81C 2JVAA 2VQFE 2EN4A 2EOYA 1G2FC 2EPNA 2EN2A 5A6AA 4R2DA 2L6MA 4TUGA 2EORA 1AH5A 1HR0E 1T4OA 2ENAA 2EPPA 1ZR9A 2EL4A 4JI5E 2EOZA 3ADGA 2L33A 3IWCA 1SR9A 4X8WA 4RH8A 4R2AA 2KOUA 2L92A 1P47A 4LF7E 2EN7A 2EMLA 1FKAE 4HTGA 4F54A 2CT1A 2GLIA 1A1HA 1PJQA 2EMGA 4DR2E 4R2CA 2WCC3 2JWOA 2LO3A 4LFCE 4WX9A 2NUGA 1X6FA 5A2QC 2ENHA 4K0KE 2KONA 3VYXA 4RHBB 3VK6A 2L8TA 2WBTA 2DLKA 1EH7A 1JK2A 4O4KA 3K6QA 2M4IA 4DV2E 2BBGA 1YSAC 2MDGA 2JPAA 4BC9A 2EOEA 1N34E 1QU6A 2DMYA 4WXCA 2BB8A 2JY9A 1XNQE 2JOXA 4L8NA 4WPYA 2EMIA 1YYKA 3THOB 4WSGA 4X9JA 4DUZE 1UN6B 1A1IA 2LJUA 2EMXA 1YZ9A 3OTOE 4OX9E
chains in the Genus database with same CATH topology
3TQMA 4HEIA 2YWQA 2RQLA 1N3GA 1IMUA 1L4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQM A;  4HEI A;  2YWQ A;  2RQL A;  1N3G A;  1IMU A;  1L4S A; 
#chains in the Genus database with same CATH topology
 4B3T E;  5CFF E;  1NCS A;  2LE2 A;  4BBY A;  4O43 A;  1IQO A;  1HNW E;  4N4R B;  3DJW A;  5A6B D;  3THN A;  1YYO A;  4JI2 E;  2JP9 A;  2WBS A;  1DI2 A;  3HTX A;  1ZBQ A;  3J7Y p;  2EPC A;  2NA2 A;  1PJS A;  2I9I A;  2PRT A;  1FJG E;  3LML A;  2EL5 A;  2EPL X;  4DR5 E;  5KL5 A;  1ZBT A;  2MC5 A;  2YTO A;  5A69 A;  4ZYH A;  2RSI A;  3UK3 C;  4LU9 A;  2EQ1 A;  2JR1 A;  4R03 A;  2L3C A;  5IT9 C;  2YU5 A;  3HPS A;  5A6K A;  4I8O A;  1G2D C;  1BBG A;  1O0W A;  1X3C A;  4WYQ B;  2EN6 A;  2NUF A;  1Z1B A;  2VF1 A;  3OML A;  2ELY A;  1YPN A;  5KL4 A;  2WZO A;  3J7A G;  2RQL A;  1N3G A;  3EPH A;  2MC6 A;  2JXP A;  4OOG C;  4L5N C;  2DSY A;  4R2P A;  1EKZ A;  4LTY A;  3JAM C;  3J80 C;  4DR7 E;  1GZ6 A;  4DV0 E;  3DF6 A;  4BS9 A;  2V87 A;  3QG5 C;  2B7T A;  2EQ0 A;  1LLM C;  2YRM A;  2EMC A;  3H09 A;  2LJH A;  3HXL A;  2LBS B;  4DMI A;  1L4S A;  1MEY C;  2L3J A;  1TF3 A;  3BID A;  1PDA A;  4IS1 C;  2EPA A;  2V88 A;  2M7Q A;  4DV6 E;  2FTX B;  1F2I G;  4JI3 E;  4DR1 E;  4MLV A;  5LLQ A;  2YTP A;  5AC4 A;  1X48 A;  2ODR D;  2YTE A;  2FGG A;  3VYY A;  4LF4 E;  3HQ1 A;  1TN9 A;  4DV1 E;  4GZN C;  4JI6 E;  4KWY A;  1YUJ A;  1SFE A;  2K7I A;  3BGH A;  1T4N A;  1NEI A;  2DGC A;  4X65 E;  3IWB A;  5A6B A;  1GTK A;  2MKD A;  2YTD A;  5IWA E;  4F6M A;  4GKK E;  3IWD A;  5TSE A;  1KJK A;  1UHZ A;  4LF6 E;  3T1H E;  3EQ1 A;  2YSP A;  2EMB A;  5LMU E;  1YFH A;  2EM8 A;  2EM2 A;  4JI8 E;  3F6H A;  2EOM A;  2EPM X;  3L00 A;  5AE2 A;  2EM0 A;  2E1M A;  2V89 A;  4R2R A;  4GKJ E;  1TF6 A;  3AV0 A;  1UIL A;  3EPK A;  2YTQ A;  4P78 A;  4M2Z A;  1A1L A;  5DNY A;  5A6J A;  2H36 X;  4NHR A;  2UXC E;  2YSO A;  2N8X A;  4NXM E;  4M30 A;  2DRP A;  2D9H A;  2EMK A;  2F4V E;  1X47 A;  4F9A B;  1JK1 A;  1A1F A;  4Q35 B;  5F3W A;  4GEQ B;  2V8Q B;  4JV5 E;  4BHC A;  4ZYD A;  2EOI A;  2L2K B;  1I94 E;  4AQY E;  3BBG A;  4R2E A;  2YTF A;  1QNT A;  5KL3 A;  2EN8 A;  2LTR A;  2JYA A;  5IV8 B;  3T1Y E;  4LFA E;  3C6K A;  1B69 A;  2V86 A;  1WRJ A;  3MHH C;  4F9C B;  2EOS A;  2GHF A;  2EMZ A;  1J26 A;  4TUI A;  4NXN E;  2HHH E;  4DR6 E;  2HGH A;  2N3H A;  2E72 A;  5ADZ A;  1IBL E;  4LF8 E;  4DKK A;  4DR4 E;  2YT4 A;  4YHH E;  3EPL A;  4F2J C;  4WXD A;  3JU0 A;  1RMD A;  5AAS A;  2E5L E;  2ADR A;  2VQE E;  5KL7 A;  1STU A;  1XMQ E;  2ODR C;  3ECR A;  4P7D A;  4M0V A;  1J5E E;  2EPX A;  3HPZ A;  2YTG A;  3LLH A;  4F6N A;  2EMH A;  2M1S A;  4ZYG A;  4DV3 E;  1HNX E;  4X62 E;  2L2M A;  2EP3 A;  2UXB E;  1RQ0 A;  2CTD A;  2N3G A;  2UU9 E;  2EOX A;  3C4T A;  2YZT A;  2G7H A;  4LFB E;  5BR8 E;  1XNR E;  2YPN A;  1BBO A;  4MLQ A;  2EZ6 A;  2EMA A;  3JTZ A;  1PJT A;  2M9A A;  4LF9 E;  2EPK X;  5LMN E;  2EMY A;  2YWQ A;  1EH8 A;  4J8Z A;  4HEI A;  4JI0 E;  2ENC A;  5AE1 A;  4X64 E;  1X6H A;  4DR3 E;  2EOH A;  2YRK A;  1EH6 A;  2B9D A;  4R8O A;  1X5W A;  2EM5 A;  2RS7 A;  2B7V A;  2UUB E;  4NZV A;  2LUQ A;  2EM3 A;  2KHX A;  2ZM6 E;  2DMI A;  4LF5 E;  4DV5 E;  4BHB A;  5AE3 A;  4M9V C;  2YRH A;  3AUZ A;  1ZAA C;  4DV4 E;  1WHN A;  3C4B A;  4BMJ A;  1IBM E;  2EWL A;  2LCE A;  2EPR A;  4B3R E;  2EJ4 A;  2RSM A;  2EOJ A;  2J7J A;  4WSP A;  3BF2 A;  2ELZ A;  2RPC A;  1UBD C;  3ZOQ B;  2EQ3 A;  3M99 B;  1ZU1 A;  1T4L B;  2LV2 A;  2EE8 A;  2V83 A;  2R1F A;  4JI1 E;  1N32 E;  2EM6 A;  2HJJ A;  2MDR A;  2YU8 A;  4BCA A;  2UXD E;  2UUA E;  2DIX A;  1T39 A;  1N36 E;  4ZYE A;  2EN1 A;  2EPO A;  2V85 A;  4WFT A;  2LUP B;  2RTX A;  1T38 A;  4JI4 E;  2EOO A;  3KWR A;  1A1J A;  1WHQ A;  2YTN A;  2EPU A;  4X66 E;  2EPZ A;  2HC5 A;  3TQM A;  2EOF A;  4IJD A;  1IQS A;  2FV4 B;  4DV7 E;  1X6E A;  2I13 A;  2RS6 A;  1PKP A;  3F6G A;  1X49 A;  1DGC A;  1KYQ A;  1WXR A;  5IXM B;  2LT7 A;  4YY3 E;  2EN3 A;  4JYA E;  2LTS A;  1RC7 A;  5KL2 A;  1A1G A;  2CSH A;  5KL6 A;  2UUC E;  4DUY E;  2B3T B;  1BB8 A;  2EL6 A;  2DB2 A;  2Q8U A;  5AC5 A;  1A1K A;  4F9B B;  2GPI A;  2JOB A;  1N33 E;  4Q28 A;  2A25 A;  2L2N A;  4O24 A;  2EMF A;  1IBK E;  5T6J A;  4R2Q A;  1XMO E;  2MKN A;  2NAB A;  3FIG A;  3ADJ A;  2DLQ A;  4FK5 C;  2YTI A;  2NUE A;  2VRD A;  3MSW A;  5FLX C;  4JI7 E;  3KZY A;  2WBU A;  1MGT A;  4B3M E;  2EOQ A;  5LL6 R;  2R76 A;  2EMW A;  2VE7 C;  2LMZ A;  1AAY A;  2LVH A;  1YYW A;  4KHP E;  2F8B A;  3MHS C;  1GQE A;  2CPN A;  2K4V A;  3KZZ A;  1HNZ E;  3EPJ A;  4B3S E;  2EM4 A;  4KZS A;  3VHT B;  3RMP A;  4R2S A;  1YUI A;  4BC7 A;  2IHR 1;  4O5G A;  1IMU A;  1WJP A;  2EM9 A;  2EM7 A;  2LRS A;  2YTJ A;  3C6M A;  3ADI A;  3ADL A;  3P1X A;  1DQ3 A;  3J81 C;  2JVA A;  2VQF E;  2EN4 A;  2EOY A;  1G2F C;  2EPN A;  2EN2 A;  5A6A A;  4R2D A;  2L6M A;  4TUG A;  2EOR A;  1AH5 A;  1HR0 E;  1T4O A;  2ENA A;  2EPP A;  1ZR9 A;  2EL4 A;  4JI5 E;  2EOZ A;  3ADG A;  2L33 A;  3IWC A;  1SR9 A;  4X8W A;  4RH8 A;  4R2A A;  2KOU A;  2L92 A;  1P47 A;  4LF7 E;  2EN7 A;  2EML A;  1FKA E;  4HTG A;  4F54 A;  2CT1 A;  2GLI A;  1A1H A;  1PJQ A;  2EMG A;  4DR2 E;  4R2C A;  2WCC 3;  2JWO A;  2LO3 A;  4LFC E;  4WX9 A;  2NUG A;  1X6F A;  5A2Q C;  2ENH A;  4K0K E;  2KON A;  3VYX A;  4RHB B;  3VK6 A;  2L8T A;  2WBT A;  2DLK A;  1EH7 A;  1JK2 A;  4O4K A;  3K6Q A;  2M4I A;  4DV2 E;  2BBG A;  1YSA C;  2MDG A;  2JPA A;  4BC9 A;  2EOE A;  1N34 E;  1QU6 A;  2DMY A;  4WXC A;  2BB8 A;  2JY9 A;  1XNQ E;  2JOX A;  4L8N A;  4WPY A;  2EMI A;  1YYK A;  3THO B;  4WSG A;  4X9J A;  4DUZ E;  1UN6 B;  1A1I A;  2LJU A;  2EMX A;  1YZ9 A;  3OTO E;  4OX9 E; 
#chains in the Genus database with same CATH homology
 3TQM A;  4HEI A;  2YWQ A;  2RQL A;  1N3G A;  1IMU A;  1L4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...