4HEIA

2a x-ray structure of hpf from vibrio cholerae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
b'MQINIQGHHIDLTDSMQDYVHSKFDKLERFFDHINHVQVILRVEKLRQIAEATLHVNQAEIHAHADDENMYAAIDSLVDKLVRQLNKHKEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOME HIBERNATION PROTEIN YHBH
publication title Structure of Vibrio cholerae ribosome hibernation promoting factor.
pubmed doi rcsb
molecule tags Translation
total genus 28
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 4heiA00
1IMUA 2RQLA 4HEIA 2YWQA 3TQMA 1L4SA 1N3GA
chains in the Genus database with same CATH superfamily
1BB8A 1I94E 1UBDC 2N3GA 1A1GA 5F3WA 1X6FA 4K0KE 3HTXA 5KL2A 5LMNE 2EOSA 2V89A 2YTGA 4JI6E 2EPOA 2M1SA 2JOBA 4B3TE 1YPNA 2M7QA 1A1LA 1UILA 4R03A 4BBYA 1N3GA 4LF6E 3LMLA 3OMLA 3F6HA 3EPHA 2RS7A 4X66E 1X6EA 1YZ9A 3DJWA 4GKKE 5FLXC 2D9HA 4TUGA 4O5GA 4R2RA 4NHRA 5KL4A 2DSYA 2YTOA 2KHXA 1BBGA 2YTJA 1KJKA 2DLKA 2VQEE 2JXPA 1TF3A 1SFEA 2GPIA 1WHNA 4DR7E 1J26A 1X5WA 4F6NA 2EPRA 2RQLA 2EZ6A 5AC5A 3HXLA 3F6GA 2EP3A 3MHSC 3MHHC 1QU6A 2EM2A 4ZYGA 4J8ZA 4DV6E 2EOJA 3VYYA 1HNWE 2WBUA 4P78A 4DR6E 2RPCA 1MEYC 1IQSA 1N36E 2EL6A 1AAYA 2I13A 2EMFA 4ZYDA 4N4RB 4Q35B 5LLQA 2EL4A 2YZTA 2JR1A 2EPZA 4R2PA 4LF4E 2EOFA 4X64E 2EM5A 2YPNA 2EMKA 2LBSB 4OX9E 2ADRA 4X65E 2HJJA 5AC4A 1XMQE 3MSWA 2JPAA 4F6MA 4DUYE 4LF5E 5KL7A 2JYAA 2CTDA 2LTSA 2V8QB 2EPXA 2L3JA 4LF8E 4DV0E 2M9AA 4I8OA 1YFHA 5A6BD 1GTKA 2BBGA 4WYQB 1IBME 2UXBE 1GQEA 1YYWA 1EH8A 5A6KA 5IT9C 1A1JA 1SR9A 4DV1E 2L2NA 4HEIA 4LFCE 4JI4E 2L3CA 2EPNA 2G7HA 5A6AA 2ODRD 3C4TA 1XNRE 4DV2E 1ZAAC 4ZYEA 2EPLX 4BHCA 1A1HA 1AH5A 4BC7A 4F9CB 4JI7E 5ADZA 4MLVA 1T39A 1DGCA 5BR8E 1X6HA 3IWDA 5A69A 3ADJA 3EPLA 3C6KA 2YWQA 4O24A 4JI8E 2DGCA 4L8NA 4WPYA 2LUPB 4WFTA 1HNXE 4P7DA 5A2QC 4DR3E 3M99B 2N8XA 4F2JC 2NA2A 1ZR9A 2B9DA 1G2DC 2V88A 3IWCA 2UXDE 3HPSA 2M4IA 1YUIA 1P47A 1N32E 4R2EA 4NXNE 2VRDA 4R2SA 2LTRA 1JK1A 4RH8A 2YSPA 2VF1A 2MKDA 3THOB 2FV4B 4DMIA 1RMDA 4BCAA 1RC7A 4LF7E 4BHBA 4DUZE 4M9VC 4GKJE 2V85A 2EMHA 4JI3E 2YRHA 4LF9E 1WHQA 2F8BA 2CT1A 2KOUA 4B3RE 1LLMC 1PJTA 5IWAE 2VQFE 1DI2A 2EM7A 2LVHA 2JWOA 2L2MA 2J7JA 2MDGA 2E5LE 1EKZA 2EMWA 2LMZA 1GZ6A 2EPPA 3KWRA 1N34E 1UHZA 3ADLA 1HR0E 2IHR1 2YTNA 2YTEA 4DV5E 3RMPA 2BB8A 1BBOA 4X8WA 2GHFA 3ZOQB 5A6BA 4HTGA 2RSMA 3KZZA 1JK2A 2UUAE 2B7TA 4LFAE 2YU8A 4GZNC 3UK3C 1FKAE 2EN7A 2LT7A 2EPUA 2EOIA 5CFFE 2UU9E 4F9AB 4M2ZA 1RQ0A 3C6MA 2EOHA 1T4NA 2CSHA 3JAMC 4DV7E 2K4VA 1F2IG 3ADGA 3AV0A 2A25A 2FTXB 4NXME 4FK5C 3ECRA 2YTFA 3HPZA 4WXDA 1MGTA 2LE2A 4JI1E 1WRJA 3J7AG 2R76A 2WZOA 2LUQA 2ELYA 2NUGA 1O0WA 4R8OA 4OOGC 1ZBQA 1IBKE 3VYXA 2YTQA 2EPCA 4R2AA 1YYOA 2WBTA 3KZYA 1X3CA 2UUCE 2EOYA 2NUFA 1YSAC 4B3ME 2NABA 1YUJA 2EM9A 2ODRC 4DR2E 4BMJA 1PJQA 2ELZA 4DR4E 1DQ3A 3L00A 1PJSA 2B3TB 4DV4E 4KWYA 4Q28A 3J80C 2KONA 2EOEA 4WSPA 4ZYHA 1PDAA 3EPJA 3C4BA 4GEQB 3LLHA 4O43A 2FGGA 4BC9A 2EN2A 4JI0E 1XNQE 2JVAA 3VHTB 1IQOA 2JP9A 2YTPA 2L2KB 1UN6B 1X49A 4M30A 1WXRA 3JTZA 1ZU1A 2GLIA 3BBGA 2NUEA 2EL5A 2EMBA 5A6JA 3K6QA 2WBSA 1HNZE 1L4SA 1WJPA 2EE8A 4IS1C 3FIGA 3H09A 3DF6A 1T4LB 2EPKX 2MDRA 2EPAA 5AE3A 4M0VA 4F9BB 2DB2A 2EQ1A 2ENAA 4WSGA 2EMCA 2LO3A 2V87A 5AASA 1A1KA 2EORA 3J7Yp 3EPKA 1XMOE 1STUA 3P1XA 4LTYA 4X9JA 2EJ4A 1T4OA 3IWBA 5IXMB 2L92A 2MC6A 2DMYA 1EH7A 2EM8A 2EOQA 5TSEA 2YTDA 2DRPA 5KL3A 2EM6A 4DR5E 1NCSA 2LRSA 1KYQA 2DIXA 1EH6A 2EOZA 5LL6R 1A1FA 2EQ3A 1G2FC 1NEIA 1X48A 4L5NC 2HGHA 2EWLA 5AE1A 5KL6A 4JV5E 3HQ1A 2L33A 1IMUA 2V86A 2LV2A 5AE2A 4O4KA 2F4VE 1N33E 3JU0A 4R2CA 2E72A 2EPMX 2EOOA 2JOXA 2JY9A 4DV3E 2EM0A 4KZSA 1IBLE 2EMIA 2EN8A 2HHHE 2UUBE 2L8TA 2EM4A 3VK6A 4R2QA 1FJGE 2R1FA 4JI2E 1ZBTA 4AQYE 5T6JA 2DMIA 2EMZA 2EN4A 2RS6A 1A1IA 2YTIA 2RTXA 2YRKA 1B69A 3EQ1A 2EOXA 1J5EE 4B3SE 3AUZA 2HC5A 3OTOE 2LJHA 4RHBB 5IV8B 2EQ0A 4DKKA 2PRTA 2EN1A 2EN3A 2VE7C 2YRMA 1T38A 4KHPE 2EN6A 5LMUE 1TF6A 4BS9A 2EM3A 3T1YE 3THNA 4NZVA 2DLQA 4F54A 3BF2A 2H36X 2ZM6E 2RSIA 1TN9A 2B7VA 4LU9A 4YHHE 4R2DA 4WXCA 1YYKA 2I9IA 4TUIA 1PKPA 2CPNA 5DNYA 2LJUA 2YU5A 2MKNA 4IJDA 2E1MA 2EMLA 5KL5A 4X62E 2ENCA 2EMYA 4JYAE 4WX9A 2YT4A 2YSOA 2EMXA 3QG5C 4DR1E 2L6MA 2V83A 2EMAA 3TQMA 3ADIA 2Q8UA 1Z1BA 4JI5E 2ENHA 2LCEA 1QNTA 3J81C 2K7IA 3BIDA 4MLQA 2EOMA 4LFBE 4YY3E 2EMGA 2WCC3 3T1HE 2MC5A 2N3HA 3BGHA 1X47A 2UXCE
chains in the Genus database with same CATH topology
1IMUA 2RQLA 4HEIA 2YWQA 3TQMA 1L4SA 1N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMU A;  2RQL A;  4HEI A;  2YWQ A;  3TQM A;  1L4S A;  1N3G A; 
#chains in the Genus database with same CATH topology
 1BB8 A;  1I94 E;  1UBD C;  2N3G A;  1A1G A;  5F3W A;  1X6F A;  4K0K E;  3HTX A;  5KL2 A;  5LMN E;  2EOS A;  2V89 A;  2YTG A;  4JI6 E;  2EPO A;  2M1S A;  2JOB A;  4B3T E;  1YPN A;  2M7Q A;  1A1L A;  1UIL A;  4R03 A;  4BBY A;  1N3G A;  4LF6 E;  3LML A;  3OML A;  3F6H A;  3EPH A;  2RS7 A;  4X66 E;  1X6E A;  1YZ9 A;  3DJW A;  4GKK E;  5FLX C;  2D9H A;  4TUG A;  4O5G A;  4R2R A;  4NHR A;  5KL4 A;  2DSY A;  2YTO A;  2KHX A;  1BBG A;  2YTJ A;  1KJK A;  2DLK A;  2VQE E;  2JXP A;  1TF3 A;  1SFE A;  2GPI A;  1WHN A;  4DR7 E;  1J26 A;  1X5W A;  4F6N A;  2EPR A;  2RQL A;  2EZ6 A;  5AC5 A;  3HXL A;  3F6G A;  2EP3 A;  3MHS C;  3MHH C;  1QU6 A;  2EM2 A;  4ZYG A;  4J8Z A;  4DV6 E;  2EOJ A;  3VYY A;  1HNW E;  2WBU A;  4P78 A;  4DR6 E;  2RPC A;  1MEY C;  1IQS A;  1N36 E;  2EL6 A;  1AAY A;  2I13 A;  2EMF A;  4ZYD A;  4N4R B;  4Q35 B;  5LLQ A;  2EL4 A;  2YZT A;  2JR1 A;  2EPZ A;  4R2P A;  4LF4 E;  2EOF A;  4X64 E;  2EM5 A;  2YPN A;  2EMK A;  2LBS B;  4OX9 E;  2ADR A;  4X65 E;  2HJJ A;  5AC4 A;  1XMQ E;  3MSW A;  2JPA A;  4F6M A;  4DUY E;  4LF5 E;  5KL7 A;  2JYA A;  2CTD A;  2LTS A;  2V8Q B;  2EPX A;  2L3J A;  4LF8 E;  4DV0 E;  2M9A A;  4I8O A;  1YFH A;  5A6B D;  1GTK A;  2BBG A;  4WYQ B;  1IBM E;  2UXB E;  1GQE A;  1YYW A;  1EH8 A;  5A6K A;  5IT9 C;  1A1J A;  1SR9 A;  4DV1 E;  2L2N A;  4HEI A;  4LFC E;  4JI4 E;  2L3C A;  2EPN A;  2G7H A;  5A6A A;  2ODR D;  3C4T A;  1XNR E;  4DV2 E;  1ZAA C;  4ZYE A;  2EPL X;  4BHC A;  1A1H A;  1AH5 A;  4BC7 A;  4F9C B;  4JI7 E;  5ADZ A;  4MLV A;  1T39 A;  1DGC A;  5BR8 E;  1X6H A;  3IWD A;  5A69 A;  3ADJ A;  3EPL A;  3C6K A;  2YWQ A;  4O24 A;  4JI8 E;  2DGC A;  4L8N A;  4WPY A;  2LUP B;  4WFT A;  1HNX E;  4P7D A;  5A2Q C;  4DR3 E;  3M99 B;  2N8X A;  4F2J C;  2NA2 A;  1ZR9 A;  2B9D A;  1G2D C;  2V88 A;  3IWC A;  2UXD E;  3HPS A;  2M4I A;  1YUI A;  1P47 A;  1N32 E;  4R2E A;  4NXN E;  2VRD A;  4R2S A;  2LTR A;  1JK1 A;  4RH8 A;  2YSP A;  2VF1 A;  2MKD A;  3THO B;  2FV4 B;  4DMI A;  1RMD A;  4BCA A;  1RC7 A;  4LF7 E;  4BHB A;  4DUZ E;  4M9V C;  4GKJ E;  2V85 A;  2EMH A;  4JI3 E;  2YRH A;  4LF9 E;  1WHQ A;  2F8B A;  2CT1 A;  2KOU A;  4B3R E;  1LLM C;  1PJT A;  5IWA E;  2VQF E;  1DI2 A;  2EM7 A;  2LVH A;  2JWO A;  2L2M A;  2J7J A;  2MDG A;  2E5L E;  1EKZ A;  2EMW A;  2LMZ A;  1GZ6 A;  2EPP A;  3KWR A;  1N34 E;  1UHZ A;  3ADL A;  1HR0 E;  2IHR 1;  2YTN A;  2YTE A;  4DV5 E;  3RMP A;  2BB8 A;  1BBO A;  4X8W A;  2GHF A;  3ZOQ B;  5A6B A;  4HTG A;  2RSM A;  3KZZ A;  1JK2 A;  2UUA E;  2B7T A;  4LFA E;  2YU8 A;  4GZN C;  3UK3 C;  1FKA E;  2EN7 A;  2LT7 A;  2EPU A;  2EOI A;  5CFF E;  2UU9 E;  4F9A B;  4M2Z A;  1RQ0 A;  3C6M A;  2EOH A;  1T4N A;  2CSH A;  3JAM C;  4DV7 E;  2K4V A;  1F2I G;  3ADG A;  3AV0 A;  2A25 A;  2FTX B;  4NXM E;  4FK5 C;  3ECR A;  2YTF A;  3HPZ A;  4WXD A;  1MGT A;  2LE2 A;  4JI1 E;  1WRJ A;  3J7A G;  2R76 A;  2WZO A;  2LUQ A;  2ELY A;  2NUG A;  1O0W A;  4R8O A;  4OOG C;  1ZBQ A;  1IBK E;  3VYX A;  2YTQ A;  2EPC A;  4R2A A;  1YYO A;  2WBT A;  3KZY A;  1X3C A;  2UUC E;  2EOY A;  2NUF A;  1YSA C;  4B3M E;  2NAB A;  1YUJ A;  2EM9 A;  2ODR C;  4DR2 E;  4BMJ A;  1PJQ A;  2ELZ A;  4DR4 E;  1DQ3 A;  3L00 A;  1PJS A;  2B3T B;  4DV4 E;  4KWY A;  4Q28 A;  3J80 C;  2KON A;  2EOE A;  4WSP A;  4ZYH A;  1PDA A;  3EPJ A;  3C4B A;  4GEQ B;  3LLH A;  4O43 A;  2FGG A;  4BC9 A;  2EN2 A;  4JI0 E;  1XNQ E;  2JVA A;  3VHT B;  1IQO A;  2JP9 A;  2YTP A;  2L2K B;  1UN6 B;  1X49 A;  4M30 A;  1WXR A;  3JTZ A;  1ZU1 A;  2GLI A;  3BBG A;  2NUE A;  2EL5 A;  2EMB A;  5A6J A;  3K6Q A;  2WBS A;  1HNZ E;  1L4S A;  1WJP A;  2EE8 A;  4IS1 C;  3FIG A;  3H09 A;  3DF6 A;  1T4L B;  2EPK X;  2MDR A;  2EPA A;  5AE3 A;  4M0V A;  4F9B B;  2DB2 A;  2EQ1 A;  2ENA A;  4WSG A;  2EMC A;  2LO3 A;  2V87 A;  5AAS A;  1A1K A;  2EOR A;  3J7Y p;  3EPK A;  1XMO E;  1STU A;  3P1X A;  4LTY A;  4X9J A;  2EJ4 A;  1T4O A;  3IWB A;  5IXM B;  2L92 A;  2MC6 A;  2DMY A;  1EH7 A;  2EM8 A;  2EOQ A;  5TSE A;  2YTD A;  2DRP A;  5KL3 A;  2EM6 A;  4DR5 E;  1NCS A;  2LRS A;  1KYQ A;  2DIX A;  1EH6 A;  2EOZ A;  5LL6 R;  1A1F A;  2EQ3 A;  1G2F C;  1NEI A;  1X48 A;  4L5N C;  2HGH A;  2EWL A;  5AE1 A;  5KL6 A;  4JV5 E;  3HQ1 A;  2L33 A;  1IMU A;  2V86 A;  2LV2 A;  5AE2 A;  4O4K A;  2F4V E;  1N33 E;  3JU0 A;  4R2C A;  2E72 A;  2EPM X;  2EOO A;  2JOX A;  2JY9 A;  4DV3 E;  2EM0 A;  4KZS A;  1IBL E;  2EMI A;  2EN8 A;  2HHH E;  2UUB E;  2L8T A;  2EM4 A;  3VK6 A;  4R2Q A;  1FJG E;  2R1F A;  4JI2 E;  1ZBT A;  4AQY E;  5T6J A;  2DMI A;  2EMZ A;  2EN4 A;  2RS6 A;  1A1I A;  2YTI A;  2RTX A;  2YRK A;  1B69 A;  3EQ1 A;  2EOX A;  1J5E E;  4B3S E;  3AUZ A;  2HC5 A;  3OTO E;  2LJH A;  4RHB B;  5IV8 B;  2EQ0 A;  4DKK A;  2PRT A;  2EN1 A;  2EN3 A;  2VE7 C;  2YRM A;  1T38 A;  4KHP E;  2EN6 A;  5LMU E;  1TF6 A;  4BS9 A;  2EM3 A;  3T1Y E;  3THN A;  4NZV A;  2DLQ A;  4F54 A;  3BF2 A;  2H36 X;  2ZM6 E;  2RSI A;  1TN9 A;  2B7V A;  4LU9 A;  4YHH E;  4R2D A;  4WXC A;  1YYK A;  2I9I A;  4TUI A;  1PKP A;  2CPN A;  5DNY A;  2LJU A;  2YU5 A;  2MKN A;  4IJD A;  2E1M A;  2EML A;  5KL5 A;  4X62 E;  2ENC A;  2EMY A;  4JYA E;  4WX9 A;  2YT4 A;  2YSO A;  2EMX A;  3QG5 C;  4DR1 E;  2L6M A;  2V83 A;  2EMA A;  3TQM A;  3ADI A;  2Q8U A;  1Z1B A;  4JI5 E;  2ENH A;  2LCE A;  1QNT A;  3J81 C;  2K7I A;  3BID A;  4MLQ A;  2EOM A;  4LFB E;  4YY3 E;  2EMG A;  2WCC 3;  3T1H E;  2MC5 A;  2N3H A;  3BGH A;  1X47 A;  2UXC E; 
#chains in the Genus database with same CATH homology
 1IMU A;  2RQL A;  4HEI A;  2YWQ A;  3TQM A;  1L4S A;  1N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...