4HEIA

2a x-ray structure of hpf from vibrio cholerae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
92
structure length
92
Chain Sequence
MQINIQGHHIDLTDSMQDYVHSKFDKLERFFDHINHVQVILRVEKLRQIAEATLHVNQAEIHAHADDENMYAAIDSLVDKLVRQLNKHKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords RIBOSOME HIBERNATION PROTEIN YHBH
publication title Structure of Vibrio cholerae ribosome hibernation promoting factor.
pubmed doi rcsb
total genus 28
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02482 Ribosomal_S30AE Sigma 54 modulation protein / S30EA ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.100 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Ribosome hibernation promotion factor-like 4heiA00
1N3GA 2YWQA 1L4SA 2RQLA 4HEIA 1IMUA 3TQMA
chains in the Genus database with same CATH superfamily
4ZYGA 2EQ3A 3MHSC 5BR8E 1GTKA 4BMJA 2EMHA 2VE7C 4KWYA 1WHQA 3C6KA 2DIXA 1A1HA 1A1IA 2N3GA 1X48A 2EPKX 1YFHA 4LFCE 5KL3A 2YWQA 2EPRA 2EMKA 1IQOA 2NABA 5IT9C 1TF3A 2RS6A 1YYKA 2EN2A 2ODRD 1QNTA 3HXLA 1YSAC 2LMZA 2EE8A 5IXMB 3KZZA 5KL2A 2L3CA 1A1GA 4DV6E 4DV7E 1XMQE 2RS7A 4LF8E 3ZOQB 4MLVA 1IBKE 1A1LA 4M9VC 4BCAA 4IJDA 4WPYA 3EPHA 1N33E 4DR3E 2L33A 2L6MA 2UUAE 1BBGA 2EOEA 2EOXA 2YTPA 3LMLA 3J81C 2EOQA 2L8TA 2GHFA 4O24A 1I94E 4F9CB 2YTIA 3F6HA 2LRSA 1P47A 1O0WA 2DB2A 4GZNC 1L4SA 4LTYA 4MLQA 4R03A 3ADLA 4J8ZA 1J5EE 1N3GA 3M99B 1HNZE 2EM8A 1KJKA 4WXCA 3ADIA 2NUEA 4N4RB 2YTDA 4O43A 4JI0E 3UK3C 3MHHC 1SFEA 4DV0E 1XNRE 4DV5E 5F3WA 5KL7A 3T1YE 2DMYA 4NHRA 3C6MA 2EOJA 2V88A 1WHNA 1BB8A 3VK6A 2WBUA 2EPZA 1X49A 4RHBB 1NEIA 5T6JA 3BGHA 4P7DA 1X5WA 3JAMC 1ZAAC 2EOHA 2E1MA 2YTOA 2EP3A 4OX9E 4WSGA 2EL5A 4R2DA 1PJTA 3TQMA 1SR9A 2MKNA 2HC5A 2RTXA 2V85A 4ZYEA 1UN6B 1QU6A 2DGCA 2EN7A 2MC5A 4F6NA 2FGGA 4F9AB 4FK5C 1BBOA 2EN3A 3ADGA 5A6JA 2EMYA 2LE2A 4GEQB 2L2KB 2EN4A 3JU0A 5AE2A 2K7IA 2EPCA 3C4TA 1AAYA 1JK1A 4WSPA 1ZBTA 3KWRA 2LUQA 3OTOE 4LF5E 1HR0E 2G7HA 2YTGA 1PDAA 1PJQA 1IBLE 2LTSA 5A6AA 1YUJA 4JI3E 2EM9A 4O5GA 2EMBA 4AQYE 2HJJA 4JI7E 1F2IG 3THNA 2JR1A 3QG5C 3EPJA 2JOXA 1X6FA 5A69A 1YYWA 4DR6E 1EH7A 4R2CA 4R2QA 3RMPA 1UBDC 4R2SA 2H36X 4L5NC 2EPNA 1XNQE 1N32E 5TSEA 2GLIA 4M30A 1MGTA 4WXDA 4X66E 2YPNA 4DR7E 4R2RA 2B7TA 2YTJA 1YPNA 4KZSA 2HHHE 4NZVA 4R2AA 2A25A 2MDGA 2PRTA 2EMZA 2EOOA 3J80C 2ADRA 4DV4E 3BIDA 4F9BB 2LBSB 2EOFA 2EMLA 1EKZA 1G2DC 2D9HA 2EJ4A 1FJGE 2B3TB 2V83A 4JI4E 2YTFA 2DRPA 1GQEA 2DSYA 1WJPA 2EN1A 2VF1A 4TUIA 2EMIA 2LO3A 4HTGA 5A6KA 5KL6A 2WCC3 4GKJE 1T4OA 4HEIA 1UHZA 2EOYA 2I13A 2EPOA 4KHPE 1YYOA 4WX9A 2JVAA 1N34E 3IWDA 2EOSA 2E5LE 4M0VA 1TN9A 1WXRA 2EN6A 2JOBA 4K0KE 4F6MA 4B3RE 1DQ3A 1KYQA 2M9AA 4X64E 2KOUA 2LT7A 4LF9E 2UXDE 2YT4A 3C4BA 5CFFE 4R8OA 1IQSA 2EMWA 4DR5E 1PKPA 4F54A 4L8NA 2JY9A 2VRDA 5IV8B 3K6QA 2YTNA 1WRJA 2B9DA 4O4KA 4DV1E 2YTEA 3HQ1A 2YU5A 2NUGA 4LFAE 5A6BA 4X62E 4DUZE 2EM0A 1J26A 2WBSA 2BB8A 2LJUA 1NCSA 2DLQA 3FIGA 5KL4A 2V8QB 3MSWA 1T4NA 4IS1C 2CT1A 5AASA 1LLMC 3HPSA 2MDRA 2UUCE 4DR4E 4JI8E 2EM6A 3L00A 3J7AG 2FV4B 2NUFA 2EM3A 4JI5E 1HNWE 1AH5A 3HTXA 1STUA 2EM7A 2M1SA 5LL6R 4X65E 2EZ6A 2RPCA 2MC6A 4LF4E 2ELZA 3JTZA 2MKDA 4ZYDA 3IWBA 2VQEE 2VQFE 1RC7A 3OMLA 2YRKA 4R2EA 2EPXA 2EL4A 1A1FA 4JV5E 5LMNE 2CSHA 1DGCA 5A2QC 4M2ZA 4B3TE 4DUYE 4DV2E 3THOB 3IWCA 2GPIA 2JP9A 2UUBE 4F2JC 1RMDA 2EM5A 1N36E 2B7VA 1X47A 2ENCA 4I8OA 4DR2E 2L3JA 2LV2A 1X6HA 1ZU1A 3VHTB 2EMXA 1B69A 3HPZA 1IBME 1ZBQA 3DJWA 2EPAA 3EQ1A 4YY3E 3BF2A 2RSMA 3P1XA 2EQ0A 2N8XA 1Z1BA 1T38A 5AE3A 1A1KA 3VYXA 2EL6A 2ENHA 3VYYA 2EWLA 4ZYHA 2JPAA 2LUPB 4JI1E 1DI2A 4LF6E 1PJSA 1EH8A 1TF6A 4BC9A 2L2MA 2F4VE 2N3HA 5IWAE 1G2FC 2ENAA 1RQ0A 4Q35B 2EOIA 2YSPA 2EPPA 1A1JA 2HGHA 3EPKA 2UXBE 2EM4A 2L2NA 2YU8A 2V87A 2M4IA 2KONA 3ECRA 3AV0A 2UXCE 1ZR9A 2V89A 4DR1E 2YTQA 2R76A 5AC5A 4DV3E 2ELYA 5FLXC 2LCEA 4LF7E 2JXPA 4JI6E 5AE1A 2EPLX 5KL5A 4OOGC 2M7QA 2EQ1A 4X9JA 4NXNE 3H09A 2ZM6E 2EPMX 1HNXE 2EMGA 2K4VA 2LTRA 4NXME 1XMOE 4BHBA 3DF6A 2F8BA 4P78A 4DKKA 2E72A 3KZYA 2ODRC 4BS9A 2IHR1 5AC4A 5LMUE 2EMAA 2YSOA 5A6BD 1IMUA 2DMIA 3AUZA 2UU9E 2BBGA 2DLKA 4TUGA 2R1FA 1YZ9A 2EN8A 2Q8UA 2V86A 4BHCA 2EM2A 2YZTA 1X6EA 2JYAA 4YHHE 3F6GA 3EPLA 2EMCA 2EOMA 2YRHA 1T39A 2EPUA 3LLHA 4RH8A 4LU9A 4WFTA 3ADJA 4WYQB 1JK2A 1FKAE 4BC7A 1EH6A 2I9IA 1UILA 2L92A 4B3ME 4GKKE 4JYAE 2EOZA 3J7Yp 1YUIA 4DMIA 5LLQA 1MEYC 2LVHA 4JI2E 2J7JA 2WBTA 3T1HE 1GZ6A 4B3SE 2KHXA 4Q28A 4BBYA 2FTXB 3BBGA 2EORA 1T4LB 2NA2A 1X3CA 5DNYA 4LFBE 2CPNA 2YRMA 4X8WA 2JWOA 2RSIA 2LJHA 2EMFA 5ADZA 2CTDA 2RQLA 2WZOA 4R2PA
chains in the Genus database with same CATH topology
1N3GA 2YWQA 1L4SA 2RQLA 4HEIA 1IMUA 3TQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3G A;  2YWQ A;  1L4S A;  2RQL A;  4HEI A;  1IMU A;  3TQM A; 
#chains in the Genus database with same CATH topology
 4ZYG A;  2EQ3 A;  3MHS C;  5BR8 E;  1GTK A;  4BMJ A;  2EMH A;  2VE7 C;  4KWY A;  1WHQ A;  3C6K A;  2DIX A;  1A1H A;  1A1I A;  2N3G A;  1X48 A;  2EPK X;  1YFH A;  4LFC E;  5KL3 A;  2YWQ A;  2EPR A;  2EMK A;  1IQO A;  2NAB A;  5IT9 C;  1TF3 A;  2RS6 A;  1YYK A;  2EN2 A;  2ODR D;  1QNT A;  3HXL A;  1YSA C;  2LMZ A;  2EE8 A;  5IXM B;  3KZZ A;  5KL2 A;  2L3C A;  1A1G A;  4DV6 E;  4DV7 E;  1XMQ E;  2RS7 A;  4LF8 E;  3ZOQ B;  4MLV A;  1IBK E;  1A1L A;  4M9V C;  4BCA A;  4IJD A;  4WPY A;  3EPH A;  1N33 E;  4DR3 E;  2L33 A;  2L6M A;  2UUA E;  1BBG A;  2EOE A;  2EOX A;  2YTP A;  3LML A;  3J81 C;  2EOQ A;  2L8T A;  2GHF A;  4O24 A;  1I94 E;  4F9C B;  2YTI A;  3F6H A;  2LRS A;  1P47 A;  1O0W A;  2DB2 A;  4GZN C;  1L4S A;  4LTY A;  4MLQ A;  4R03 A;  3ADL A;  4J8Z A;  1J5E E;  1N3G A;  3M99 B;  1HNZ E;  2EM8 A;  1KJK A;  4WXC A;  3ADI A;  2NUE A;  4N4R B;  2YTD A;  4O43 A;  4JI0 E;  3UK3 C;  3MHH C;  1SFE A;  4DV0 E;  1XNR E;  4DV5 E;  5F3W A;  5KL7 A;  3T1Y E;  2DMY A;  4NHR A;  3C6M A;  2EOJ A;  2V88 A;  1WHN A;  1BB8 A;  3VK6 A;  2WBU A;  2EPZ A;  1X49 A;  4RHB B;  1NEI A;  5T6J A;  3BGH A;  4P7D A;  1X5W A;  3JAM C;  1ZAA C;  2EOH A;  2E1M A;  2YTO A;  2EP3 A;  4OX9 E;  4WSG A;  2EL5 A;  4R2D A;  1PJT A;  3TQM A;  1SR9 A;  2MKN A;  2HC5 A;  2RTX A;  2V85 A;  4ZYE A;  1UN6 B;  1QU6 A;  2DGC A;  2EN7 A;  2MC5 A;  4F6N A;  2FGG A;  4F9A B;  4FK5 C;  1BBO A;  2EN3 A;  3ADG A;  5A6J A;  2EMY A;  2LE2 A;  4GEQ B;  2L2K B;  2EN4 A;  3JU0 A;  5AE2 A;  2K7I A;  2EPC A;  3C4T A;  1AAY A;  1JK1 A;  4WSP A;  1ZBT A;  3KWR A;  2LUQ A;  3OTO E;  4LF5 E;  1HR0 E;  2G7H A;  2YTG A;  1PDA A;  1PJQ A;  1IBL E;  2LTS A;  5A6A A;  1YUJ A;  4JI3 E;  2EM9 A;  4O5G A;  2EMB A;  4AQY E;  2HJJ A;  4JI7 E;  1F2I G;  3THN A;  2JR1 A;  3QG5 C;  3EPJ A;  2JOX A;  1X6F A;  5A69 A;  1YYW A;  4DR6 E;  1EH7 A;  4R2C A;  4R2Q A;  3RMP A;  1UBD C;  4R2S A;  2H36 X;  4L5N C;  2EPN A;  1XNQ E;  1N32 E;  5TSE A;  2GLI A;  4M30 A;  1MGT A;  4WXD A;  4X66 E;  2YPN A;  4DR7 E;  4R2R A;  2B7T A;  2YTJ A;  1YPN A;  4KZS A;  2HHH E;  4NZV A;  4R2A A;  2A25 A;  2MDG A;  2PRT A;  2EMZ A;  2EOO A;  3J80 C;  2ADR A;  4DV4 E;  3BID A;  4F9B B;  2LBS B;  2EOF A;  2EML A;  1EKZ A;  1G2D C;  2D9H A;  2EJ4 A;  1FJG E;  2B3T B;  2V83 A;  4JI4 E;  2YTF A;  2DRP A;  1GQE A;  2DSY A;  1WJP A;  2EN1 A;  2VF1 A;  4TUI A;  2EMI A;  2LO3 A;  4HTG A;  5A6K A;  5KL6 A;  2WCC 3;  4GKJ E;  1T4O A;  4HEI A;  1UHZ A;  2EOY A;  2I13 A;  2EPO A;  4KHP E;  1YYO A;  4WX9 A;  2JVA A;  1N34 E;  3IWD A;  2EOS A;  2E5L E;  4M0V A;  1TN9 A;  1WXR A;  2EN6 A;  2JOB A;  4K0K E;  4F6M A;  4B3R E;  1DQ3 A;  1KYQ A;  2M9A A;  4X64 E;  2KOU A;  2LT7 A;  4LF9 E;  2UXD E;  2YT4 A;  3C4B A;  5CFF E;  4R8O A;  1IQS A;  2EMW A;  4DR5 E;  1PKP A;  4F54 A;  4L8N A;  2JY9 A;  2VRD A;  5IV8 B;  3K6Q A;  2YTN A;  1WRJ A;  2B9D A;  4O4K A;  4DV1 E;  2YTE A;  3HQ1 A;  2YU5 A;  2NUG A;  4LFA E;  5A6B A;  4X62 E;  4DUZ E;  2EM0 A;  1J26 A;  2WBS A;  2BB8 A;  2LJU A;  1NCS A;  2DLQ A;  3FIG A;  5KL4 A;  2V8Q B;  3MSW A;  1T4N A;  4IS1 C;  2CT1 A;  5AAS A;  1LLM C;  3HPS A;  2MDR A;  2UUC E;  4DR4 E;  4JI8 E;  2EM6 A;  3L00 A;  3J7A G;  2FV4 B;  2NUF A;  2EM3 A;  4JI5 E;  1HNW E;  1AH5 A;  3HTX A;  1STU A;  2EM7 A;  2M1S A;  5LL6 R;  4X65 E;  2EZ6 A;  2RPC A;  2MC6 A;  4LF4 E;  2ELZ A;  3JTZ A;  2MKD A;  4ZYD A;  3IWB A;  2VQE E;  2VQF E;  1RC7 A;  3OML A;  2YRK A;  4R2E A;  2EPX A;  2EL4 A;  1A1F A;  4JV5 E;  5LMN E;  2CSH A;  1DGC A;  5A2Q C;  4M2Z A;  4B3T E;  4DUY E;  4DV2 E;  3THO B;  3IWC A;  2GPI A;  2JP9 A;  2UUB E;  4F2J C;  1RMD A;  2EM5 A;  1N36 E;  2B7V A;  1X47 A;  2ENC A;  4I8O A;  4DR2 E;  2L3J A;  2LV2 A;  1X6H A;  1ZU1 A;  3VHT B;  2EMX A;  1B69 A;  3HPZ A;  1IBM E;  1ZBQ A;  3DJW A;  2EPA A;  3EQ1 A;  4YY3 E;  3BF2 A;  2RSM A;  3P1X A;  2EQ0 A;  2N8X A;  1Z1B A;  1T38 A;  5AE3 A;  1A1K A;  3VYX A;  2EL6 A;  2ENH A;  3VYY A;  2EWL A;  4ZYH A;  2JPA A;  2LUP B;  4JI1 E;  1DI2 A;  4LF6 E;  1PJS A;  1EH8 A;  1TF6 A;  4BC9 A;  2L2M A;  2F4V E;  2N3H A;  5IWA E;  1G2F C;  2ENA A;  1RQ0 A;  4Q35 B;  2EOI A;  2YSP A;  2EPP A;  1A1J A;  2HGH A;  3EPK A;  2UXB E;  2EM4 A;  2L2N A;  2YU8 A;  2V87 A;  2M4I A;  2KON A;  3ECR A;  3AV0 A;  2UXC E;  1ZR9 A;  2V89 A;  4DR1 E;  2YTQ A;  2R76 A;  5AC5 A;  4DV3 E;  2ELY A;  5FLX C;  2LCE A;  4LF7 E;  2JXP A;  4JI6 E;  5AE1 A;  2EPL X;  5KL5 A;  4OOG C;  2M7Q A;  2EQ1 A;  4X9J A;  4NXN E;  3H09 A;  2ZM6 E;  2EPM X;  1HNX E;  2EMG A;  2K4V A;  2LTR A;  4NXM E;  1XMO E;  4BHB A;  3DF6 A;  2F8B A;  4P78 A;  4DKK A;  2E72 A;  3KZY A;  2ODR C;  4BS9 A;  2IHR 1;  5AC4 A;  5LMU E;  2EMA A;  2YSO A;  5A6B D;  1IMU A;  2DMI A;  3AUZ A;  2UU9 E;  2BBG A;  2DLK A;  4TUG A;  2R1F A;  1YZ9 A;  2EN8 A;  2Q8U A;  2V86 A;  4BHC A;  2EM2 A;  2YZT A;  1X6E A;  2JYA A;  4YHH E;  3F6G A;  3EPL A;  2EMC A;  2EOM A;  2YRH A;  1T39 A;  2EPU A;  3LLH A;  4RH8 A;  4LU9 A;  4WFT A;  3ADJ A;  4WYQ B;  1JK2 A;  1FKA E;  4BC7 A;  1EH6 A;  2I9I A;  1UIL A;  2L92 A;  4B3M E;  4GKK E;  4JYA E;  2EOZ A;  3J7Y p;  1YUI A;  4DMI A;  5LLQ A;  1MEY C;  2LVH A;  4JI2 E;  2J7J A;  2WBT A;  3T1H E;  1GZ6 A;  4B3S E;  2KHX A;  4Q28 A;  4BBY A;  2FTX B;  3BBG A;  2EOR A;  1T4L B;  2NA2 A;  1X3C A;  5DNY A;  4LFB E;  2CPN A;  2YRM A;  4X8W A;  2JWO A;  2RSI A;  2LJH A;  2EMF A;  5ADZ A;  2CTD A;  2RQL A;  2WZO A;  4R2P A; 
#chains in the Genus database with same CATH homology
 1N3G A;  2YWQ A;  1L4S A;  2RQL A;  4HEI A;  1IMU A;  3TQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...