2LJHA

Nmr structure of double-stranded rna-specific editase adar
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'SDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFIQFKDGAVLSPLKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase Adar
publication title Solution structure of the N-terminal dsRBD of Drosophila ADAR and interaction studies with RNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.5.-.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ljhA01
1EKZA 4LF7E 4DV4E 2UUAE 4JI4E 3ADJA 2VQFE 1N33E 3J7Yp 2N3GA 4B3ME 4X8WA 4M2ZA 1XNRE 2NUFA 2RS7A 2RS6A 2L3CA 2VQEE 5LMUE 1HR0E 1J26A 4DR6E 3VYXA 4X65E 4LF5E 4JI1E 4JI5E 4NXME 1UILA 1IBME 4K0KE 4DKKA 4JYAE 4DV7E 2UXBE 4LFAE 4DR7E 3C4TA 4X64E 1GQEA 1HNWE 4DUYE 2L2KB 2UXDE 4WFTA 4DR1E 1HNZE 4JV5E 4LF8E 3P1XA 1N32E 4LF4E 1T4NA 1X47A 1O0WA 1DI2A 4LFBE 4DUZE 2NUGA 2LTRA 4GKJE 4NXNE 2LTSA 2ZM6E 1N36E 3ADIA 2B7TA 2UUCE 2DIXA 1J5EE 1XNQE 4DV2E 4YHHE 2L3JA 2NUEA 5BR8E 1IBLE 4B3SE 1QU6A 4DR2E 4JI2E 1YYKA 2B3TB 4DR5E 2YT4A 3ADLA 4GKKE 1XMOE 2LBSB 2UUBE 2CPNA 2LJHA 2DB2A 3LLHA 1X49A 2DMYA 2JY9A 4WYQB 2KHXA 5CFFE 2LRSA 3C4BA 2LUQA 1T4LB 4JI8E 1RC7A 3OTOE 1T4OA 1PKPA 3HTXA 1FKAE 1YZ9A 5IWAE 1HNXE 4OOGC 3T1YE 2HHHE 1ZBTA 1UHZA 1RQ0A 4LF9E 2N3HA 4JI7E 4OX9E 2RSMA 2JVAA 1IBKE 1I94E 4M30A 4LF6E 4JI6E 1STUA 2NA2A 4DV5E 4DV0E 3ADGA 4DV6E 2L2MA 4B3RE 2EZ6A 4X66E 1YYWA 4DV3E 1WHNA 4AQYE 2B7VA 2MDRA 4JI0E 3VYYA 4YY3E 1WHQA 5LMNE 2L33A 2LUPB 2IHR1 2UU9E 4DV1E 1XMQE 4LFCE 1YYOA 2L2NA 4B3TE 4DR3E 4KHPE 4X62E 1N34E 2RTXA 2F4VE 4JI3E 1X48A 3T1HE 4DR4E 2E5LE 1FJGE 2UXCE
chains in the Genus database with same CATH superfamily
1P47A 2JR1A 2EM9A 2KONA 4Q35B 1A1KA 4LF7E 4JI4E 2D9HA 5LLQA 3ADJA 2EN2A 1N33E 4X8WA 4L8NA 2RS7A 2RS6A 2L3CA 3KZZA 5T6JA 5A6BD 4JI5E 4ZYGA 2M1SA 4BHCA 4DKKA 4JYAE 2V87A 4DV7E 4LFAE 4DR7E 1KJKA 2DGCA 4X64E 1HNWE 4DUYE 1SR9A 2EN3A 1SFEA 2EN7A 1ZBQA 2EMLA 3VK6A 1N32E 3RMPA 4F6MA 2EOFA 4M0VA 4BC7A 2EMXA 2NUGA 2I13A 3KWRA 2ZM6E 2N8XA 4HEIA 4F2JC 3TQMA 4YHHE 2L8TA 5BR8E 1QU6A 4DR2E 4DMIA 5F3WA 2MKDA 4JI2E 3HPZA 2EQ0A 2EPNA 2B3TB 2EMHA 3EPKA 1XMOE 4RHBB 2EQ1A 5TSEA 2YPNA 2CPNA 2ENCA 2V85A 3F6HA 1X49A 2DMYA 4WYQB 4NZVA 5CFFE 2EOEA 2LUQA 3MHHC 4MLVA 5IT9C 1T4LB 1T4OA 2ODRC 2V8QB 2YTPA 2EMIA 4OOGC 4MLQA 1WJPA 5A6JA 4WX9A 4P7DA 2EMCA 2JVAA 3C6MA 2EOOA 2EOHA 1UN6B 1I94E 4WXDA 2EOZA 2EMKA 2YRHA 3ADGA 4DV6E 5A6BA 2YTQA 2JXPA 4BHBA 1DGCA 2EZ6A 2JOXA 4X66E 1YYWA 4DV3E 2YRKA 2WBTA 3MHSC 4AQYE 1MEYC 2MDRA 4R2QA 1X6EA 2LV2A 4ZYDA 4ZYHA 2LUPB 1ZU1A 2I9IA 5DNYA 2EMGA 1A1LA 4LFCE 5KL7A 1YYOA 1LLMC 3VHTB 3F6GA 2YTGA 4DR3E 2EPUA 4P78A 1PJTA 1G2DC 2F4VE 1KYQA 4JI3E 4F9BB 2RQLA 3T1HE 1AH5A 2EOQA 5KL2A 1EKZA 2FV4B 2EL6A 4DV4E 2UUAE 4F54A 2MC5A 2EPAA 4WSPA 4BCAA 3IWBA 4M2ZA 2NUFA 2VQEE 1HR0E 4DR6E 5AE2A 4LF5E 4BBYA 4IJDA 2J7JA 1IQSA 2DSYA 1X6HA 1UILA 5AC4A 2YSOA 2EM8A 3C4TA 2YZTA 3OMLA 2L2KB 4BMJA 4R2RA 3P1XA 1EH8A 1T4NA 3HPSA 5AE3A 4LFBE 1YPNA 2DLQA 2EN6A 2LTSA 2ELZA 1N36E 3ADIA 2B7TA 2K4VA 2DIXA 1JK1A 4DV2E 3FIGA 2RSIA 1IBLE 2M4IA 4KZSA 2VF1A 3UK3C 4R03A 4FK5C 2E1MA 3LMLA 4DR5E 3QG5C 1X3CA 1BBGA 2EM6A 2LBSB 2EN4A 2DB2A 2EM3A 2R1FA 2V86A 2EM5A 2MKNA 3C4BA 4JI8E 3AUZA 2EOYA 4J8ZA 1RC7A 1QNTA 1PKPA 2EPOA 5AASA 1RMDA 1YZ9A 3T1YE 1ZBTA 1UHZA 4Q28A 1RQ0A 1BB8A 4OX9E 3J7AG 1ZR9A 2EM0A 2EMWA 3BBGA 4M30A 5IXMB 2WBUA 2EM4A 3EPJA 2NA2A 1A1IA 4DV5E 2EJ4A 4F6NA 4L5NC 1G2FC 2V83A 1WHNA 2LVHA 2YSPA 2PRTA 4JI0E 4R2CA 4R2EA 4YY3E 2IHR1 1NCSA 4DV1E 2EOJA 1TF6A 4O24A 2EQ3A 2RPCA 5IV8B 2EE8A 1EH6A 4KHPE 4X62E 2EL5A 2YRMA 3THNA 2VE7C 4HTGA 3JAMC 1X48A 1YSAC 4N4RB 2DMIA 2F8BA 2H36X 2YU5A 2YTDA 1YUIA 5A6KA 3ZOQB 3J7Yp 2N3GA 2JPAA 4LTYA 5AE1A 2V89A 2B9DA 5KL5A 4KWYA 2NABA 2EOIA 2LJUA 1J26A 2EOXA 3VYXA 4RH8A 1YUJA 4NXME 2EOSA 5A69A 1IBME 2EPZA 5A2QC 2UXDE 4NHRA 1A1FA 4WFTA 2JWOA 4DR1E 1HNZE 3JTZA 1YFHA 4LF8E 4ZYEA 4LF4E 2EM7A 5ADZA 1X47A 1FJGE 2ADRA 2EPMX 4GKJE 2LTRA 1IQOA 2E72A 3IWDA 2YTOA 2UUCE 2HJJA 5AC5A 1XNQE 2L3JA 1A1JA 2NUEA 4R8OA 2JOBA 3K6QA 3BF2A 5KL4A 3C6KA 3ADLA 2EPPA 2UUBE 1EH7A 3LLHA 2JY9A 2EN8A 2HC5A 2LRSA 2EPRA 4TUIA 2HGHA 2FGGA 5A6AA 2EL4A 1AAYA 2HHHE 2DLKA 2LT7A 4LF9E 1JK2A 2N3HA 3EPHA 4JI7E 5KL3A 2L6MA 2RSMA 3KZYA 2VRDA 2WZOA 2GPIA 1BBOA 2ELYA 2MC6A 2L92A 1DQ3A 3VYYA 2EPLX 1PJSA 3J80C 5KL6A 2UU9E 3EPLA 2K7IA 3ECRA 3H09A 2M7QA 2MDGA 4B3TE 1N34E 2Q8UA 4I8OA 4TUGA 2ODRD 2E5LE 1Z1BA 2A25A 2VQFE 4B3ME 2LO3A 2CT1A 1PDAA 1XNRE 4R2SA 5LMUE 2EMZA 2M9AA 3BIDA 4R2PA 4X65E 4JI1E 1ZAAC 4K0KE 3EQ1A 2UXBE 2LMZA 5FLXC 2YTNA 1GQEA 1L4SA 2LE2A 4WPYA 4JV5E 3JU0A 3HQ1A 2ENAA 4BS9A 2EMBA 4WSGA 1O0WA 1DI2A 1X5WA 2EWLA 4DUZE 2EORA 4NXNE 3M99B 1X6FA 1T39A 2LCEA 2CSHA 1F2IG 2BBGA 1J5EE 4WXCA 2YWQA 1B69A 2DRPA 2WBSA 4O43A 1UBDC 3IWCA 1PJQA 4B3SE 4R2DA 4O4KA 1YYKA 4GZNC 4GEQB 2YT4A 1TN9A 4GKKE 2R76A 4F9CB 2KOUA 2LJHA 2YTJA 2KHXA 4F9AB 1T38A 2EMYA 2CTDA 1N3GA 2EM2A 2BB8A 3OTOE 2YTEA 3DF6A 5LL6R 2FTXB 3HTXA 1FKAE 2EPKX 5IWAE 1HNXE 4O5GA 1WXRA 3THOB 1IMUA 1TF3A 2WCC3 3L00A 2EMFA 4R2AA 1IBKE 4LF6E 4JI6E 1STUA 2YTFA 4DV0E 1WRJA 2EPCA 2JYAA 2EP3A 4IS1C 2L2MA 4B3RE 2YU8A 2GLIA 2EPXA 1GZ6A 2B7VA 2GHFA 1WHQA 2EMAA 4X9JA 3HXLA 5LMNE 2L33A 2EOMA 2EN1A 1MGTA 2V88A 1XMQE 1GTKA 3J81C 4BC9A 2L2NA 3BGHA 3DJWA 1A1GA 3AV0A 2G7HA 2JP9A 2RTXA 3MSWA 4M9VC 2ENHA 4LU9A 2YTIA 1A1HA 4DR4E 2UXCE 1NEIA
chains in the Genus database with same CATH topology
2JR1A 1EKZA 2FV4B 2KONA 4LF7E 4DV4E 2UUAE 4F54A 4JI4E 2MC5A 3ADJA 4WSPA 3ZOQB 3J7Yp 2N3GA 4BCAA 2VQFE 4X8WA 3IWBA 4LTYA 4B3ME 4M2ZA 1XNRE 2NUFA 4L8NA 2RS7A 2RS6A 5AE1A 2V89A 2L3CA 2B9DA 5T6JA 2VQEE 5LMUE 1HR0E 1J26A 4DR6E 3VYXA 2E5LE 4X65E 5AE2A 4JI1E 4LF5E 4JI5E 4BBYA 4NXME 2M1SA 2DSYA 1UILA 1IBME 4K0KE 4DKKA 4JYAE 2V87A 4DV7E 4LFAE 4DR7E 2LMZA 3C4TA 2YZTA 5FLXC 2UXBE 4X64E 1GQEA 1HNWE 4DUYE 1SR9A 2LE2A 3OMLA 4WPYA 5A2QC 2L2KB 2UXDE 4BMJA 4WFTA 2JWOA 4DR1E 1HNZE 3JTZA 3JU0A 1ZBQA 3P1XA 3HQ1A 3VK6A 4LF8E 4BS9A 4LF4E 1N32E 3RMPA 5ADZA 1T4NA 1X47A 1O0WA 3HPSA 5AE3A 4LFBE 2EWLA 1DI2A 4DUZE 4M0VA 4BC7A 2NUGA 2LTRA 4GKJE 4NXNE 1N33E 2LTSA 3IWDA 3KWRA 2ZM6E 1N36E 3ADIA 2B7TA 2K4VA 2UUCE 2DIXA 1J5EE 1XNQE 4DV2E 3FIGA 4YHHE 2L3JA 2L8TA 2NUEA 4R8OA 5BR8E 2JOBA 3IWCA 2M4IA 4KZSA 3K6QA 1QU6A 2VF1A 1IBLE 4DR2E 4B3SE 4R03A 4DMIA 5F3WA 4JI2E 1YYKA 3HPZA 4GEQB 2B3TB 2E1MA 3LMLA 4DR5E 2YT4A 3ADLA 4GKKE 1XMOE 2LBSB 2UUBE 4F9CB 2CPNA 2KOUA 2LJHA 2DB2A 2V86A 2V85A 1X49A 2DMYA 2JY9A 3F6HA 2KHXA 3LLHA 4WYQB 4F9AB 5CFFE 2LRSA 4TUIA 3C4BA 2LUQA 1T4LB 4JI8E 3AUZA 5IT9C 4J8ZA 1RC7A 3OTOE 2FGGA 3DF6A 5LL6R 1T4OA 2FTXB 1PKPA 2ODRC 2V8QB 1FKAE 3HTXA 5AASA 1YZ9A 5IWAE 1HNXE 4OOGC 1WXRA 3T1YE 2HHHE 1ZBTA 1UHZA 4Q28A 1RQ0A 4LF9E 2N3HA 4P7DA 4JI7E 4OX9E 2L6MA 3J7AG 2RSMA 2JVAA 1IBKE 1I94E 4M30A 4LF6E 4JI6E 1STUA 2NA2A 4DV5E 4DV0E 3ADGA 4DV6E 2WZOA 4L5NC 4JV5E 2L2MA 4B3RE 2EZ6A 2V83A 2JOXA 4X66E 1YYWA 4DV3E 2MC6A 1WHNA 2L92A 1DQ3A 1GZ6A 2B7VA 2MDRA 4AQYE 3VYYA 4YY3E 1WHQA 5LMNE 4JI0E 3HXLA 2L33A 3J80C 2LUPB 2IHR1 5DNYA 2UU9E 2V88A 4DV1E 1XMQE 3J81C 4LFCE 4BC9A 1YYOA 2L2NA 3H09A 2M7QA 4B3TE 4DR3E 3F6GA 4KHPE 3DJWA 4X62E 3AV0A 4P78A 1N34E 2G7HA 2RTXA 2F4VE 4I8OA 4TUGA 4JI3E 2VE7C 4F9BB 3JAMC 1X48A 3MSWA 3T1HE 2ODRD 4DR4E 4LU9A 1FJGE 2F8BA 2UXCE 2H36X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKZ A;  4LF7 E;  4DV4 E;  2UUA E;  4JI4 E;  3ADJ A;  2VQF E;  1N33 E;  3J7Y p;  2N3G A;  4B3M E;  4X8W A;  4M2Z A;  1XNR E;  2NUF A;  2RS7 A;  2RS6 A;  2L3C A;  2VQE E;  5LMU E;  1HR0 E;  1J26 A;  4DR6 E;  3VYX A;  4X65 E;  4LF5 E;  4JI1 E;  4JI5 E;  4NXM E;  1UIL A;  1IBM E;  4K0K E;  4DKK A;  4JYA E;  4DV7 E;  2UXB E;  4LFA E;  4DR7 E;  3C4T A;  4X64 E;  1GQE A;  1HNW E;  4DUY E;  2L2K B;  2UXD E;  4WFT A;  4DR1 E;  1HNZ E;  4JV5 E;  4LF8 E;  3P1X A;  1N32 E;  4LF4 E;  1T4N A;  1X47 A;  1O0W A;  1DI2 A;  4LFB E;  4DUZ E;  2NUG A;  2LTR A;  4GKJ E;  4NXN E;  2LTS A;  2ZM6 E;  1N36 E;  3ADI A;  2B7T A;  2UUC E;  2DIX A;  1J5E E;  1XNQ E;  4DV2 E;  4YHH E;  2L3J A;  2NUE A;  5BR8 E;  1IBL E;  4B3S E;  1QU6 A;  4DR2 E;  4JI2 E;  1YYK A;  2B3T B;  4DR5 E;  2YT4 A;  3ADL A;  4GKK E;  1XMO E;  2LBS B;  2UUB E;  2CPN A;  2LJH A;  2DB2 A;  3LLH A;  1X49 A;  2DMY A;  2JY9 A;  4WYQ B;  2KHX A;  5CFF E;  2LRS A;  3C4B A;  2LUQ A;  1T4L B;  4JI8 E;  1RC7 A;  3OTO E;  1T4O A;  1PKP A;  3HTX A;  1FKA E;  1YZ9 A;  5IWA E;  1HNX E;  4OOG C;  3T1Y E;  2HHH E;  1ZBT A;  1UHZ A;  1RQ0 A;  4LF9 E;  2N3H A;  4JI7 E;  4OX9 E;  2RSM A;  2JVA A;  1IBK E;  1I94 E;  4M30 A;  4LF6 E;  4JI6 E;  1STU A;  2NA2 A;  4DV5 E;  4DV0 E;  3ADG A;  4DV6 E;  2L2M A;  4B3R E;  2EZ6 A;  4X66 E;  1YYW A;  4DV3 E;  1WHN A;  4AQY E;  2B7V A;  2MDR A;  4JI0 E;  3VYY A;  4YY3 E;  1WHQ A;  5LMN E;  2L33 A;  2LUP B;  2IHR 1;  2UU9 E;  4DV1 E;  1XMQ E;  4LFC E;  1YYO A;  2L2N A;  4B3T E;  4DR3 E;  4KHP E;  4X62 E;  1N34 E;  2RTX A;  2F4V E;  4JI3 E;  1X48 A;  3T1H E;  4DR4 E;  2E5L E;  1FJG E;  2UXC E; 
#chains in the Genus database with same CATH topology
 1P47 A;  2JR1 A;  2EM9 A;  2KON A;  4Q35 B;  1A1K A;  4LF7 E;  4JI4 E;  2D9H A;  5LLQ A;  3ADJ A;  2EN2 A;  1N33 E;  4X8W A;  4L8N A;  2RS7 A;  2RS6 A;  2L3C A;  3KZZ A;  5T6J A;  5A6B D;  4JI5 E;  4ZYG A;  2M1S A;  4BHC A;  4DKK A;  4JYA E;  2V87 A;  4DV7 E;  4LFA E;  4DR7 E;  1KJK A;  2DGC A;  4X64 E;  1HNW E;  4DUY E;  1SR9 A;  2EN3 A;  1SFE A;  2EN7 A;  1ZBQ A;  2EML A;  3VK6 A;  1N32 E;  3RMP A;  4F6M A;  2EOF A;  4M0V A;  4BC7 A;  2EMX A;  2NUG A;  2I13 A;  3KWR A;  2ZM6 E;  2N8X A;  4HEI A;  4F2J C;  3TQM A;  4YHH E;  2L8T A;  5BR8 E;  1QU6 A;  4DR2 E;  4DMI A;  5F3W A;  2MKD A;  4JI2 E;  3HPZ A;  2EQ0 A;  2EPN A;  2B3T B;  2EMH A;  3EPK A;  1XMO E;  4RHB B;  2EQ1 A;  5TSE A;  2YPN A;  2CPN A;  2ENC A;  2V85 A;  3F6H A;  1X49 A;  2DMY A;  4WYQ B;  4NZV A;  5CFF E;  2EOE A;  2LUQ A;  3MHH C;  4MLV A;  5IT9 C;  1T4L B;  1T4O A;  2ODR C;  2V8Q B;  2YTP A;  2EMI A;  4OOG C;  4MLQ A;  1WJP A;  5A6J A;  4WX9 A;  4P7D A;  2EMC A;  2JVA A;  3C6M A;  2EOO A;  2EOH A;  1UN6 B;  1I94 E;  4WXD A;  2EOZ A;  2EMK A;  2YRH A;  3ADG A;  4DV6 E;  5A6B A;  2YTQ A;  2JXP A;  4BHB A;  1DGC A;  2EZ6 A;  2JOX A;  4X66 E;  1YYW A;  4DV3 E;  2YRK A;  2WBT A;  3MHS C;  4AQY E;  1MEY C;  2MDR A;  4R2Q A;  1X6E A;  2LV2 A;  4ZYD A;  4ZYH A;  2LUP B;  1ZU1 A;  2I9I A;  5DNY A;  2EMG A;  1A1L A;  4LFC E;  5KL7 A;  1YYO A;  1LLM C;  3VHT B;  3F6G A;  2YTG A;  4DR3 E;  2EPU A;  4P78 A;  1PJT A;  1G2D C;  2F4V E;  1KYQ A;  4JI3 E;  4F9B B;  2RQL A;  3T1H E;  1AH5 A;  2EOQ A;  5KL2 A;  1EKZ A;  2FV4 B;  2EL6 A;  4DV4 E;  2UUA E;  4F54 A;  2MC5 A;  2EPA A;  4WSP A;  4BCA A;  3IWB A;  4M2Z A;  2NUF A;  2VQE E;  1HR0 E;  4DR6 E;  5AE2 A;  4LF5 E;  4BBY A;  4IJD A;  2J7J A;  1IQS A;  2DSY A;  1X6H A;  1UIL A;  5AC4 A;  2YSO A;  2EM8 A;  3C4T A;  2YZT A;  3OML A;  2L2K B;  4BMJ A;  4R2R A;  3P1X A;  1EH8 A;  1T4N A;  3HPS A;  5AE3 A;  4LFB E;  1YPN A;  2DLQ A;  2EN6 A;  2LTS A;  2ELZ A;  1N36 E;  3ADI A;  2B7T A;  2K4V A;  2DIX A;  1JK1 A;  4DV2 E;  3FIG A;  2RSI A;  1IBL E;  2M4I A;  4KZS A;  2VF1 A;  3UK3 C;  4R03 A;  4FK5 C;  2E1M A;  3LML A;  4DR5 E;  3QG5 C;  1X3C A;  1BBG A;  2EM6 A;  2LBS B;  2EN4 A;  2DB2 A;  2EM3 A;  2R1F A;  2V86 A;  2EM5 A;  2MKN A;  3C4B A;  4JI8 E;  3AUZ A;  2EOY A;  4J8Z A;  1RC7 A;  1QNT A;  1PKP A;  2EPO A;  5AAS A;  1RMD A;  1YZ9 A;  3T1Y E;  1ZBT A;  1UHZ A;  4Q28 A;  1RQ0 A;  1BB8 A;  4OX9 E;  3J7A G;  1ZR9 A;  2EM0 A;  2EMW A;  3BBG A;  4M30 A;  5IXM B;  2WBU A;  2EM4 A;  3EPJ A;  2NA2 A;  1A1I A;  4DV5 E;  2EJ4 A;  4F6N A;  4L5N C;  1G2F C;  2V83 A;  1WHN A;  2LVH A;  2YSP A;  2PRT A;  4JI0 E;  4R2C A;  4R2E A;  4YY3 E;  2IHR 1;  1NCS A;  4DV1 E;  2EOJ A;  1TF6 A;  4O24 A;  2EQ3 A;  2RPC A;  5IV8 B;  2EE8 A;  1EH6 A;  4KHP E;  4X62 E;  2EL5 A;  2YRM A;  3THN A;  2VE7 C;  4HTG A;  3JAM C;  1X48 A;  1YSA C;  4N4R B;  2DMI A;  2F8B A;  2H36 X;  2YU5 A;  2YTD A;  1YUI A;  5A6K A;  3ZOQ B;  3J7Y p;  2N3G A;  2JPA A;  4LTY A;  5AE1 A;  2V89 A;  2B9D A;  5KL5 A;  4KWY A;  2NAB A;  2EOI A;  2LJU A;  1J26 A;  2EOX A;  3VYX A;  4RH8 A;  1YUJ A;  4NXM E;  2EOS A;  5A69 A;  1IBM E;  2EPZ A;  5A2Q C;  2UXD E;  4NHR A;  1A1F A;  4WFT A;  2JWO A;  4DR1 E;  1HNZ E;  3JTZ A;  1YFH A;  4LF8 E;  4ZYE A;  4LF4 E;  2EM7 A;  5ADZ A;  1X47 A;  1FJG E;  2ADR A;  2EPM X;  4GKJ E;  2LTR A;  1IQO A;  2E72 A;  3IWD A;  2YTO A;  2UUC E;  2HJJ A;  5AC5 A;  1XNQ E;  2L3J A;  1A1J A;  2NUE A;  4R8O A;  2JOB A;  3K6Q A;  3BF2 A;  5KL4 A;  3C6K A;  3ADL A;  2EPP A;  2UUB E;  1EH7 A;  3LLH A;  2JY9 A;  2EN8 A;  2HC5 A;  2LRS A;  2EPR A;  4TUI A;  2HGH A;  2FGG A;  5A6A A;  2EL4 A;  1AAY A;  2HHH E;  2DLK A;  2LT7 A;  4LF9 E;  1JK2 A;  2N3H A;  3EPH A;  4JI7 E;  5KL3 A;  2L6M A;  2RSM A;  3KZY A;  2VRD A;  2WZO A;  2GPI A;  1BBO A;  2ELY A;  2MC6 A;  2L92 A;  1DQ3 A;  3VYY A;  2EPL X;  1PJS A;  3J80 C;  5KL6 A;  2UU9 E;  3EPL A;  2K7I A;  3ECR A;  3H09 A;  2M7Q A;  2MDG A;  4B3T E;  1N34 E;  2Q8U A;  4I8O A;  4TUG A;  2ODR D;  2E5L E;  1Z1B A;  2A25 A;  2VQF E;  4B3M E;  2LO3 A;  2CT1 A;  1PDA A;  1XNR E;  4R2S A;  5LMU E;  2EMZ A;  2M9A A;  3BID A;  4R2P A;  4X65 E;  4JI1 E;  1ZAA C;  4K0K E;  3EQ1 A;  2UXB E;  2LMZ A;  5FLX C;  2YTN A;  1GQE A;  1L4S A;  2LE2 A;  4WPY A;  4JV5 E;  3JU0 A;  3HQ1 A;  2ENA A;  4BS9 A;  2EMB A;  4WSG A;  1O0W A;  1DI2 A;  1X5W A;  2EWL A;  4DUZ E;  2EOR A;  4NXN E;  3M99 B;  1X6F A;  1T39 A;  2LCE A;  2CSH A;  1F2I G;  2BBG A;  1J5E E;  4WXC A;  2YWQ A;  1B69 A;  2DRP A;  2WBS A;  4O43 A;  1UBD C;  3IWC A;  1PJQ A;  4B3S E;  4R2D A;  4O4K A;  1YYK A;  4GZN C;  4GEQ B;  2YT4 A;  1TN9 A;  4GKK E;  2R76 A;  4F9C B;  2KOU A;  2LJH A;  2YTJ A;  2KHX A;  4F9A B;  1T38 A;  2EMY A;  2CTD A;  1N3G A;  2EM2 A;  2BB8 A;  3OTO E;  2YTE A;  3DF6 A;  5LL6 R;  2FTX B;  3HTX A;  1FKA E;  2EPK X;  5IWA E;  1HNX E;  4O5G A;  1WXR A;  3THO B;  1IMU A;  1TF3 A;  2WCC 3;  3L00 A;  2EMF A;  4R2A A;  1IBK E;  4LF6 E;  4JI6 E;  1STU A;  2YTF A;  4DV0 E;  1WRJ A;  2EPC A;  2JYA A;  2EP3 A;  4IS1 C;  2L2M A;  4B3R E;  2YU8 A;  2GLI A;  2EPX A;  1GZ6 A;  2B7V A;  2GHF A;  1WHQ A;  2EMA A;  4X9J A;  3HXL A;  5LMN E;  2L33 A;  2EOM A;  2EN1 A;  1MGT A;  2V88 A;  1XMQ E;  1GTK A;  3J81 C;  4BC9 A;  2L2N A;  3BGH A;  3DJW A;  1A1G A;  3AV0 A;  2G7H A;  2JP9 A;  2RTX A;  3MSW A;  4M9V C;  2ENH A;  4LU9 A;  2YTI A;  1A1H A;  4DR4 E;  2UXC E;  1NEI A; 
#chains in the Genus database with same CATH homology
 2JR1 A;  1EKZ A;  2FV4 B;  2KON A;  4LF7 E;  4DV4 E;  2UUA E;  4F54 A;  4JI4 E;  2MC5 A;  3ADJ A;  4WSP A;  3ZOQ B;  3J7Y p;  2N3G A;  4BCA A;  2VQF E;  4X8W A;  3IWB A;  4LTY A;  4B3M E;  4M2Z A;  1XNR E;  2NUF A;  4L8N A;  2RS7 A;  2RS6 A;  5AE1 A;  2V89 A;  2L3C A;  2B9D A;  5T6J A;  2VQE E;  5LMU E;  1HR0 E;  1J26 A;  4DR6 E;  3VYX A;  2E5L E;  4X65 E;  5AE2 A;  4JI1 E;  4LF5 E;  4JI5 E;  4BBY A;  4NXM E;  2M1S A;  2DSY A;  1UIL A;  1IBM E;  4K0K E;  4DKK A;  4JYA E;  2V87 A;  4DV7 E;  4LFA E;  4DR7 E;  2LMZ A;  3C4T A;  2YZT A;  5FLX C;  2UXB E;  4X64 E;  1GQE A;  1HNW E;  4DUY E;  1SR9 A;  2LE2 A;  3OML A;  4WPY A;  5A2Q C;  2L2K B;  2UXD E;  4BMJ A;  4WFT A;  2JWO A;  4DR1 E;  1HNZ E;  3JTZ A;  3JU0 A;  1ZBQ A;  3P1X A;  3HQ1 A;  3VK6 A;  4LF8 E;  4BS9 A;  4LF4 E;  1N32 E;  3RMP A;  5ADZ A;  1T4N A;  1X47 A;  1O0W A;  3HPS A;  5AE3 A;  4LFB E;  2EWL A;  1DI2 A;  4DUZ E;  4M0V A;  4BC7 A;  2NUG A;  2LTR A;  4GKJ E;  4NXN E;  1N33 E;  2LTS A;  3IWD A;  3KWR A;  2ZM6 E;  1N36 E;  3ADI A;  2B7T A;  2K4V A;  2UUC E;  2DIX A;  1J5E E;  1XNQ E;  4DV2 E;  3FIG A;  4YHH E;  2L3J A;  2L8T A;  2NUE A;  4R8O A;  5BR8 E;  2JOB A;  3IWC A;  2M4I A;  4KZS A;  3K6Q A;  1QU6 A;  2VF1 A;  1IBL E;  4DR2 E;  4B3S E;  4R03 A;  4DMI A;  5F3W A;  4JI2 E;  1YYK A;  3HPZ A;  4GEQ B;  2B3T B;  2E1M A;  3LML A;  4DR5 E;  2YT4 A;  3ADL A;  4GKK E;  1XMO E;  2LBS B;  2UUB E;  4F9C B;  2CPN A;  2KOU A;  2LJH A;  2DB2 A;  2V86 A;  2V85 A;  1X49 A;  2DMY A;  2JY9 A;  3F6H A;  2KHX A;  3LLH A;  4WYQ B;  4F9A B;  5CFF E;  2LRS A;  4TUI A;  3C4B A;  2LUQ A;  1T4L B;  4JI8 E;  3AUZ A;  5IT9 C;  4J8Z A;  1RC7 A;  3OTO E;  2FGG A;  3DF6 A;  5LL6 R;  1T4O A;  2FTX B;  1PKP A;  2ODR C;  2V8Q B;  1FKA E;  3HTX A;  5AAS A;  1YZ9 A;  5IWA E;  1HNX E;  4OOG C;  1WXR A;  3T1Y E;  2HHH E;  1ZBT A;  1UHZ A;  4Q28 A;  1RQ0 A;  4LF9 E;  2N3H A;  4P7D A;  4JI7 E;  4OX9 E;  2L6M A;  3J7A G;  2RSM A;  2JVA A;  1IBK E;  1I94 E;  4M30 A;  4LF6 E;  4JI6 E;  1STU A;  2NA2 A;  4DV5 E;  4DV0 E;  3ADG A;  4DV6 E;  2WZO A;  4L5N C;  4JV5 E;  2L2M A;  4B3R E;  2EZ6 A;  2V83 A;  2JOX A;  4X66 E;  1YYW A;  4DV3 E;  2MC6 A;  1WHN A;  2L92 A;  1DQ3 A;  1GZ6 A;  2B7V A;  2MDR A;  4AQY E;  3VYY A;  4YY3 E;  1WHQ A;  5LMN E;  4JI0 E;  3HXL A;  2L33 A;  3J80 C;  2LUP B;  2IHR 1;  5DNY A;  2UU9 E;  2V88 A;  4DV1 E;  1XMQ E;  3J81 C;  4LFC E;  4BC9 A;  1YYO A;  2L2N A;  3H09 A;  2M7Q A;  4B3T E;  4DR3 E;  3F6G A;  4KHP E;  3DJW A;  4X62 E;  3AV0 A;  4P78 A;  1N34 E;  2G7H A;  2RTX A;  2F4V E;  4I8O A;  4TUG A;  4JI3 E;  2VE7 C;  4F9B B;  3JAM C;  1X48 A;  3MSW A;  3T1H E;  2ODR D;  4DR4 E;  4LU9 A;  1FJG E;  2F8B A;  2UXC E;  2H36 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...