2LJHA

Nmr structure of double-stranded rna-specific editase adar
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
SDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFIQFKDGAVLSPLKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase Adar
publication title Solution structure of the N-terminal dsRBD of Drosophila ADAR and interaction studies with RNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.5.-.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ljhA01
2F4VE 1ZBTA 5CFFE 1N32E 1YYOA 1DI2A 3OTOE 4OOGC 3T1HE 4JI7E 4JI4E 1XMOE 2DB2A 3C4BA 1X47A 1XNRE 2L33A 4WYQB 3ADLA 2NUEA 2UXBE 2N3GA 2VQEE 4OX9E 2NA2A 4NXME 2RSMA 1QU6A 4LF5E 4B3ME 4LFCE 5LMUE 4B3SE 2L3JA 1T4LB 2LUQA 2UUBE 1RC7A 2DMYA 4M2ZA 1UHZA 2JY9A 1HR0E 2RS6A 2LTRA 2EZ6A 1HNXE 4JI0E 1T4NA 1PKPA 4JI1E 1UILA 4DUZE 2ZM6E 4JYAE 1T4OA 1WHNA 2KHXA 3ADGA 3LLHA 4DV2E 1IBME 5LMNE 4JI6E 4LFAE 2LJHA 4B3RE 2B3TB 4GKJE 1IBKE 5IWAE 3P1XA 1X49A 3ADJA 2UU9E 2RS7A 4DV1E 4JI5E 2L2MA 4LF4E 1WHQA 4DV6E 2E5LE 4DR2E 4DR4E 4DUYE 4LF6E 4DV3E 2JVAA 1STUA 2L2NA 4DR3E 4YHHE 2LUPB 1RQ0A 1FKAE 4YY3E 2N3HA 4AQYE 1HNWE 4DV7E 3ADIA 3VYXA 4WFTA 2B7VA 2UUAE 1J5EE 4X65E 4X66E 2LBSB 2HHHE 1FJGE 1XMQE 2IHR1 1EKZA 2NUFA 3VYYA 1GQEA 4DR6E 2RTXA 2LTSA 1IBLE 4GKKE 4DKKA 3T1YE 2YT4A 1HNZE 4LF7E 2B7TA 4DR1E 4JI8E 4DV5E 3C4TA 4DR5E 1XNQE 4NXNE 4LF8E 4X64E 4DV4E 4B3TE 1J26A 4LF9E 2VQFE 1N34E 2UXCE 2L2KB 4X62E 4JI2E 1X48A 1N36E 3J7Yp 2UUCE 2MDRA 3HTXA 4KHPE 4X8WA 2L3CA 4LFBE 4K0KE 2NUGA 5BR8E 4JI3E 4M30A 1YZ9A 2LRSA 2UXDE 2DIXA 1N33E 1YYKA 1YYWA 4DV0E 4DR7E 1O0WA 2CPNA 4JV5E 1I94E
chains in the Genus database with same CATH superfamily
2VF1A 4BMJA 5CFFE 5A2QC 2EL6A 3TQMA 4LU9A 4L5NC 2YU5A 2ODRD 4JI7E 3HPZA 1X47A 4IS1C 4O24A 1XNRE 2VRDA 5KL7A 3ADLA 2D9HA 4O4KA 2UXBE 1UN6B 1YSAC 2G7HA 4MLVA 4NXME 2RSMA 4B3ME 2I13A 2EMZA 4F6NA 1G2FC 2UUBE 5KL2A 3JU0A 1EH7A 4BS9A 2LTRA 2EMCA 4JI0E 3BIDA 2WZOA 3HPSA 1PKPA 2EMAA 4R2PA 3ZOQB 4DUZE 4F6MA 2EPCA 2FGGA 5IXMB 2ZM6E 1WHNA 2KHXA 3LLHA 4B3RE 2E72A 2MKNA 4GKJE 2EE8A 2JOXA 2UU9E 4DV1E 2CSHA 5A6BD 1IMUA 4F2JC 1ZR9A 1EH8A 2EPPA 2LO3A 1AAYA 4WX9A 1WHQA 4DR2E 4TUGA 4LF6E 3KWRA 2EN7A 5KL4A 1STUA 2L2NA 1PJTA 3J81C 1RQ0A 1A1HA 2EN1A 4AQYE 1X6HA 2JXPA 2B7VA 2LV2A 3EPJA 1PDAA 2IHR1 3ECRA 1EKZA 1DQ3A 5IT9C 2LT7A 2GHFA 2EM0A 2V8QB 2YSOA 4P78A 1GQEA 3MHSC 1ZU1A 3C6KA 4GKKE 4DKKA 1MGTA 2GPIA 2MC5A 2B7TA 2EMFA 4KWYA 4JI8E 4ZYHA 4DV5E 4GZNC 4DR5E 2MDGA 2HJJA 2V86A 3MSWA 4B3TE 2M1SA 4LF9E 2EM2A 1A1JA 1GTKA 3BF2A 1X48A 2UUCE 2JR1A 2EOFA 4K0KE 2NUGA 2YTQA 2EMKA 2EMXA 4R2SA 2DSYA 2LRSA 2UXDE 2YTDA 1PJSA 5KL5A 1YPNA 2YRMA 5KL3A 4JV5E 1N32E 4HEIA 3H09A 2EMWA 2M4IA 1YYOA 3OTOE 4M0VA 3T1HE 3UK3C 2YU8A 1A1KA 4JI4E 3C4BA 2YTOA 2DLQA 1GZ6A 4WXDA 5LL6R 4WYQB 2NUEA 2N3GA 1JK2A 2EL5A 2KOUA 3KZZA 2EP3A 1QU6A 4LFCE 4B3SE 1T4LB 1X6EA 3FIGA 1RC7A 4M2ZA 2EORA 2YZTA 2EQ1A 2JY9A 1X6FA 4WXCA 2FV4B 3L00A 4ZYEA 2ENAA 5F3WA 2ELYA 1X5WA 4X9JA 1ZBQA 3THNA 4JI1E 2HC5A 5AE1A 4RH8A 3JTZA 1EH6A 2EPZA 1T4OA 2EM9A 2L8TA 4LFAE 1IQOA 5A6JA 3HQ1A 1IBKE 4R2DA 1F2IG 3P1XA 1KJKA 2EMHA 2EPNA 2E1MA 2GLIA 2EN6A 2EM7A 2EN4A 5T6JA 1A1GA 2JPAA 4M9VC 2V87A 4DV3E 2JVAA 2YTFA 4YY3E 1PJQA 1WRJA 2EPAA 2F8BA 2YSPA 3QG5C 4DV7E 2EJ4A 4WFTA 4R2RA 2EPOA 2LE2A 5KL6A 2WCC3 1G2DC 2CTDA 4X66E 2LBSB 4BHBA 4BC9A 1Z1BA 2EM3A 2NUFA 2N8XA 3K6QA 3VYYA 5ADZA 2V83A 2RQLA 4DR6E 3RMPA 2LTSA 4O5GA 3T1YE 2LVHA 4DR1E 2YTGA 2EPUA 1XNQE 1BBGA 2EOOA 2DLKA 3VK6A 4X64E 4DV4E 2YTEA 2EOJA 2EOZA 2YWQA 1YUIA 4TUIA 3F6GA 1DGCA 4JI2E 1T39A 2EMBA 4ZYDA 2EPRA 2EM4A 2EPXA 1YZ9A 2NABA 1LLMC 2EOXA 2EQ0A 5AE2A 2EOYA 1YYWA 4R03A 5IV8B 2LJUA 4N4RB 2K7IA 4RHBB 3IWDA 2EM6A 3C6MA 2F4VE 2EOQA 2EWLA 2ODRC 4OOGC 4R2EA 4NHRA 1XMOE 2EPLX 2ENHA 2L33A 3EPKA 1N3GA 2R1FA 2VQEE 2MC6A 2VE7C 2M7QA 4LF5E 2I9IA 2DRPA 5AC5A 5LMUE 4IJDA 3J80C 2L3JA 2LUQA 4Q28A 1YFHA 2BBGA 4P7DA 1UHZA 2EOSA 2RS6A 2EN8A 2YRHA 1HNXE 3IWBA 4L8NA 1IQSA 2JP9A 2EOHA 4JI6E 4BCAA 5LMNE 2YRKA 2LJHA 5IWAE 4LTYA 1TF6A 4R2QA 1X49A 3M99B 1L4SA 2EMYA 2L2MA 2EMGA 4I8OA 2WBUA 2EPMX 4DUYE 2H36X 3F6HA 2YTIA 1UBDC 1FKAE 1WJPA 3HXLA 2N3HA 2EM5A 3VYXA 2YTNA 1J5EE 4X65E 2ADRA 2PRTA 2V85A 1FJGE 1XMQE 3OMLA 1B69A 1NCSA 2FTXB 2MKDA 2WBSA 1TF3A 3EQ1A 2V88A 2L6MA 1AH5A 2V89A 1HNZE 2EPKX 3EPHA 1P47A 4MLQA 4NZVA 3C4TA 2EL4A 5LLQA 4LF8E 1J26A 4O43A 2DMIA 2VQFE 2UXCE 2BB8A 5AE3A 1N36E 3HTXA 2WBTA 2JOBA 4X8WA 4LFBE 2EM8A 2RPCA 4WPYA 5A6AA 5A6KA 3AV0A 4HTGA 4F9BB 4DV0E 2CPNA 1BB8A 1YUJA 1I94E 4R8OA 1MEYC 1ZBTA 2ENCA 4J8ZA 1DI2A 5DNYA 2YTPA 1SFEA 5A69A 2A25A 2DB2A 2EN3A 3VHTB 2EQ3A 2B9DA 3JAMC 4OX9E 2EMLA 2NA2A 3DJWA 2DGCA 2Q8UA 2HGHA 2EOEA 3J7AG 1BBOA 2DMYA 1ZAAC 1HR0E 1RMDA 2EZ6A 2EMIA 4BHCA 1T4NA 2LMZA 3IWCA 1UILA 2M9AA 4R2AA 1T38A 4JYAE 2J7JA 2L92A 2YPNA 3ADGA 4DV2E 1IBME 1QNTA 4KZSA 5AC4A 2B3TB 4BC7A 1A1IA 3EPLA 3LMLA 3ADJA 2EOMA 2RS7A 1WXRA 5A6BA 4JI5E 3DF6A 4ZYGA 4LF4E 4DV6E 2E5LE 4DR4E 3BGHA 4DMIA 1SR9A 2KONA 4BBYA 4DR3E 4YHHE 2LUPB 3BBGA 4R2CA 2EN2A 2K4VA 1HNWE 3ADIA 2UUAE 4GEQB 2EOIA 2HHHE 4F9AB 1JK1A 1NEIA 2LCEA 5FLXC 1A1FA 2YTJA 1TN9A 4F54A 2RTXA 1IBLE 2YT4A 4LF7E 3THOB 3AUZA 3KZYA 4WSPA 4NXNE 2JYAA 1KYQA 1N34E 2RSIA 2L2KB 4X62E 2ELZA 2CT1A 4KHPE 2R76A 3J7Yp 2MDRA 2L3CA 3MHHC 5BR8E 4JI3E 4M30A 2DIXA 1N33E 5TSEA 1YYKA 4FK5C 4Q35B 1X3CA 2JWOA 1A1LA 4DR7E 1O0WA 4WSGA 4F9CB 5AASA
chains in the Genus database with same CATH topology
2VF1A 2F4VE 4BMJA 1ZBTA 5CFFE 5A2QC 1N32E 3H09A 2M4IA 4J8ZA 3OTOE 1YYOA 1DI2A 4LU9A 2EWLA 2ODRC 4L5NC 4M0VA 4OOGC 5DNYA 3T1HE 2ODRD 4JI7E 3HPZA 4JI4E 1XMOE 2DB2A 3C4BA 1X47A 1GZ6A 1XNRE 2L33A 5LL6R 4WYQB 3ADLA 3JAMC 2B9DA 2N3GA 2NUEA 2UXBE 2KOUA 2VQEE 4OX9E 2MC6A 2VE7C 2NA2A 2G7HA 3DJWA 2M7QA 2RSMA 1QU6A 4LF5E 4NXME 4B3ME 4LFCE 5LMUE 3J7AG 3J80C 2L3JA 4B3SE 1T4LB 2LUQA 3FIGA 4Q28A 3JU0A 2UUBE 1RC7A 2DMYA 4P7DA 2YZTA 1UHZA 4BS9A 4M2ZA 2JY9A 1HR0E 2RS6A 2LTRA 2FV4B 2EZ6A 4KHPE 5F3WA 1HNXE 4JI0E 3IWBA 1T4NA 2LMZA 2WZOA 3HPSA 3IWCA 4L8NA 1PKPA 1ZBQA 4JI1E 1UILA 3ZOQB 5AE1A 4DUZE 3JTZA 2ZM6E 2FGGA 4JYAE 1T4OA 2L92A 1WHNA 2KHXA 2L8TA 3ADGA 3LLHA 4BCAA 5LMNE 4DV2E 1IBME 4JI6E 4LFAE 2LJHA 4KZSA 4B3RE 2B3TB 3HQ1A 1IBKE 4GKJE 4BC7A 5IWAE 4LTYA 3P1XA 2JOXA 2E1MA 1X49A 3ADJA 3LMLA 2UU9E 2RS7A 1WXRA 4DV1E 4JI5E 3DF6A 2L2MA 4LF4E 1WHQA 4I8OA 4DV6E 2E5LE 4DR2E 4TUGA 5T6JA 4DUYE 3KWRA 5AASA 4LF6E 4DR4E 2V87A 4DMIA 1SR9A 4DV3E 2H36X 2JVAA 1STUA 2KONA 2L2NA 4BBYA 4YHHE 3J81C 1RQ0A 4DR3E 3F6HA 2LUPB 1FKAE 4YY3E 2K4VA 3HXLA 2F8BA 2N3HA 4AQYE 1HNWE 4DV7E 3ADIA 3VYXA 4WFTA 2B7VA 2UUAE 1J5EE 4X65E 4GEQB 2LE2A 4X66E 2LBSB 2HHHE 2V85A 4F9AB 1FJGE 1XMQE 2IHR1 3OMLA 4BC9A 2FTXB 1EKZA 5FLXC 1DQ3A 5IT9C 2NUFA 3K6QA 2V88A 3VYYA 5ADZA 2V8QB 4F54A 2V83A 4P78A 1GQEA 2L6MA 2RTXA 2LTSA 3RMPA 1IBLE 4DR6E 4DKKA 3T1YE 4GKKE 2V89A 2YT4A 1HNZE 2MC5A 4LF7E 2B7TA 4DR1E 4JI8E 4DV5E 3C4TA 4DR5E 1XNQE 3AUZA 4WSPA 3VK6A 4NXNE 4LF8E 4X64E 2V86A 3MSWA 4DV4E 4B3TE 1J26A 2M1SA 4LF9E 2VQFE 4TUIA 1N34E 3F6GA 2UXCE 2L2KB 5AE3A 4X62E 4JI2E 1X48A 1N36E 3J7Yp 2UUCE 2MDRA 2JR1A 2JOBA 4X8WA 2L3CA 3HTXA 4LFBE 4K0KE 2NUGA 5BR8E 4JI3E 4M30A 1YZ9A 4WPYA 2DSYA 2LRSA 2DIXA 1N33E 2UXDE 3AV0A 1YYKA 5AE2A 1YYWA 4R03A 4F9BB 4DV0E 2JWOA 4DR7E 1O0WA 4F9CB 2CPNA 3IWDA 4JV5E 1I94E 4R8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V E;  1ZBT A;  5CFF E;  1N32 E;  1YYO A;  1DI2 A;  3OTO E;  4OOG C;  3T1H E;  4JI7 E;  4JI4 E;  1XMO E;  2DB2 A;  3C4B A;  1X47 A;  1XNR E;  2L33 A;  4WYQ B;  3ADL A;  2NUE A;  2UXB E;  2N3G A;  2VQE E;  4OX9 E;  2NA2 A;  4NXM E;  2RSM A;  1QU6 A;  4LF5 E;  4B3M E;  4LFC E;  5LMU E;  4B3S E;  2L3J A;  1T4L B;  2LUQ A;  2UUB E;  1RC7 A;  2DMY A;  4M2Z A;  1UHZ A;  2JY9 A;  1HR0 E;  2RS6 A;  2LTR A;  2EZ6 A;  1HNX E;  4JI0 E;  1T4N A;  1PKP A;  4JI1 E;  1UIL A;  4DUZ E;  2ZM6 E;  4JYA E;  1T4O A;  1WHN A;  2KHX A;  3ADG A;  3LLH A;  4DV2 E;  1IBM E;  5LMN E;  4JI6 E;  4LFA E;  2LJH A;  4B3R E;  2B3T B;  4GKJ E;  1IBK E;  5IWA E;  3P1X A;  1X49 A;  3ADJ A;  2UU9 E;  2RS7 A;  4DV1 E;  4JI5 E;  2L2M A;  4LF4 E;  1WHQ A;  4DV6 E;  2E5L E;  4DR2 E;  4DR4 E;  4DUY E;  4LF6 E;  4DV3 E;  2JVA A;  1STU A;  2L2N A;  4DR3 E;  4YHH E;  2LUP B;  1RQ0 A;  1FKA E;  4YY3 E;  2N3H A;  4AQY E;  1HNW E;  4DV7 E;  3ADI A;  3VYX A;  4WFT A;  2B7V A;  2UUA E;  1J5E E;  4X65 E;  4X66 E;  2LBS B;  2HHH E;  1FJG E;  1XMQ E;  2IHR 1;  1EKZ A;  2NUF A;  3VYY A;  1GQE A;  4DR6 E;  2RTX A;  2LTS A;  1IBL E;  4GKK E;  4DKK A;  3T1Y E;  2YT4 A;  1HNZ E;  4LF7 E;  2B7T A;  4DR1 E;  4JI8 E;  4DV5 E;  3C4T A;  4DR5 E;  1XNQ E;  4NXN E;  4LF8 E;  4X64 E;  4DV4 E;  4B3T E;  1J26 A;  4LF9 E;  2VQF E;  1N34 E;  2UXC E;  2L2K B;  4X62 E;  4JI2 E;  1X48 A;  1N36 E;  3J7Y p;  2UUC E;  2MDR A;  3HTX A;  4KHP E;  4X8W A;  2L3C A;  4LFB E;  4K0K E;  2NUG A;  5BR8 E;  4JI3 E;  4M30 A;  1YZ9 A;  2LRS A;  2UXD E;  2DIX A;  1N33 E;  1YYK A;  1YYW A;  4DV0 E;  4DR7 E;  1O0W A;  2CPN A;  4JV5 E;  1I94 E; 
#chains in the Genus database with same CATH topology
 2VF1 A;  4BMJ A;  5CFF E;  5A2Q C;  2EL6 A;  3TQM A;  4LU9 A;  4L5N C;  2YU5 A;  2ODR D;  4JI7 E;  3HPZ A;  1X47 A;  4IS1 C;  4O24 A;  1XNR E;  2VRD A;  5KL7 A;  3ADL A;  2D9H A;  4O4K A;  2UXB E;  1UN6 B;  1YSA C;  2G7H A;  4MLV A;  4NXM E;  2RSM A;  4B3M E;  2I13 A;  2EMZ A;  4F6N A;  1G2F C;  2UUB E;  5KL2 A;  3JU0 A;  1EH7 A;  4BS9 A;  2LTR A;  2EMC A;  4JI0 E;  3BID A;  2WZO A;  3HPS A;  1PKP A;  2EMA A;  4R2P A;  3ZOQ B;  4DUZ E;  4F6M A;  2EPC A;  2FGG A;  5IXM B;  2ZM6 E;  1WHN A;  2KHX A;  3LLH A;  4B3R E;  2E72 A;  2MKN A;  4GKJ E;  2EE8 A;  2JOX A;  2UU9 E;  4DV1 E;  2CSH A;  5A6B D;  1IMU A;  4F2J C;  1ZR9 A;  1EH8 A;  2EPP A;  2LO3 A;  1AAY A;  4WX9 A;  1WHQ A;  4DR2 E;  4TUG A;  4LF6 E;  3KWR A;  2EN7 A;  5KL4 A;  1STU A;  2L2N A;  1PJT A;  3J81 C;  1RQ0 A;  1A1H A;  2EN1 A;  4AQY E;  1X6H A;  2JXP A;  2B7V A;  2LV2 A;  3EPJ A;  1PDA A;  2IHR 1;  3ECR A;  1EKZ A;  1DQ3 A;  5IT9 C;  2LT7 A;  2GHF A;  2EM0 A;  2V8Q B;  2YSO A;  4P78 A;  1GQE A;  3MHS C;  1ZU1 A;  3C6K A;  4GKK E;  4DKK A;  1MGT A;  2GPI A;  2MC5 A;  2B7T A;  2EMF A;  4KWY A;  4JI8 E;  4ZYH A;  4DV5 E;  4GZN C;  4DR5 E;  2MDG A;  2HJJ A;  2V86 A;  3MSW A;  4B3T E;  2M1S A;  4LF9 E;  2EM2 A;  1A1J A;  1GTK A;  3BF2 A;  1X48 A;  2UUC E;  2JR1 A;  2EOF A;  4K0K E;  2NUG A;  2YTQ A;  2EMK A;  2EMX A;  4R2S A;  2DSY A;  2LRS A;  2UXD E;  2YTD A;  1PJS A;  5KL5 A;  1YPN A;  2YRM A;  5KL3 A;  4JV5 E;  1N32 E;  4HEI A;  3H09 A;  2EMW A;  2M4I A;  1YYO A;  3OTO E;  4M0V A;  3T1H E;  3UK3 C;  2YU8 A;  1A1K A;  4JI4 E;  3C4B A;  2YTO A;  2DLQ A;  1GZ6 A;  4WXD A;  5LL6 R;  4WYQ B;  2NUE A;  2N3G A;  1JK2 A;  2EL5 A;  2KOU A;  3KZZ A;  2EP3 A;  1QU6 A;  4LFC E;  4B3S E;  1T4L B;  1X6E A;  3FIG A;  1RC7 A;  4M2Z A;  2EOR A;  2YZT A;  2EQ1 A;  2JY9 A;  1X6F A;  4WXC A;  2FV4 B;  3L00 A;  4ZYE A;  2ENA A;  5F3W A;  2ELY A;  1X5W A;  4X9J A;  1ZBQ A;  3THN A;  4JI1 E;  2HC5 A;  5AE1 A;  4RH8 A;  3JTZ A;  1EH6 A;  2EPZ A;  1T4O A;  2EM9 A;  2L8T A;  4LFA E;  1IQO A;  5A6J A;  3HQ1 A;  1IBK E;  4R2D A;  1F2I G;  3P1X A;  1KJK A;  2EMH A;  2EPN A;  2E1M A;  2GLI A;  2EN6 A;  2EM7 A;  2EN4 A;  5T6J A;  1A1G A;  2JPA A;  4M9V C;  2V87 A;  4DV3 E;  2JVA A;  2YTF A;  4YY3 E;  1PJQ A;  1WRJ A;  2EPA A;  2F8B A;  2YSP A;  3QG5 C;  4DV7 E;  2EJ4 A;  4WFT A;  4R2R A;  2EPO A;  2LE2 A;  5KL6 A;  2WCC 3;  1G2D C;  2CTD A;  4X66 E;  2LBS B;  4BHB A;  4BC9 A;  1Z1B A;  2EM3 A;  2NUF A;  2N8X A;  3K6Q A;  3VYY A;  5ADZ A;  2V83 A;  2RQL A;  4DR6 E;  3RMP A;  2LTS A;  4O5G A;  3T1Y E;  2LVH A;  4DR1 E;  2YTG A;  2EPU A;  1XNQ E;  1BBG A;  2EOO A;  2DLK A;  3VK6 A;  4X64 E;  4DV4 E;  2YTE A;  2EOJ A;  2EOZ A;  2YWQ A;  1YUI A;  4TUI A;  3F6G A;  1DGC A;  4JI2 E;  1T39 A;  2EMB A;  4ZYD A;  2EPR A;  2EM4 A;  2EPX A;  1YZ9 A;  2NAB A;  1LLM C;  2EOX A;  2EQ0 A;  5AE2 A;  2EOY A;  1YYW A;  4R03 A;  5IV8 B;  2LJU A;  4N4R B;  2K7I A;  4RHB B;  3IWD A;  2EM6 A;  3C6M A;  2F4V E;  2EOQ A;  2EWL A;  2ODR C;  4OOG C;  4R2E A;  4NHR A;  1XMO E;  2EPL X;  2ENH A;  2L33 A;  3EPK A;  1N3G A;  2R1F A;  2VQE E;  2MC6 A;  2VE7 C;  2M7Q A;  4LF5 E;  2I9I A;  2DRP A;  5AC5 A;  5LMU E;  4IJD A;  3J80 C;  2L3J A;  2LUQ A;  4Q28 A;  1YFH A;  2BBG A;  4P7D A;  1UHZ A;  2EOS A;  2RS6 A;  2EN8 A;  2YRH A;  1HNX E;  3IWB A;  4L8N A;  1IQS A;  2JP9 A;  2EOH A;  4JI6 E;  4BCA A;  5LMN E;  2YRK A;  2LJH A;  5IWA E;  4LTY A;  1TF6 A;  4R2Q A;  1X49 A;  3M99 B;  1L4S A;  2EMY A;  2L2M A;  2EMG A;  4I8O A;  2WBU A;  2EPM X;  4DUY E;  2H36 X;  3F6H A;  2YTI A;  1UBD C;  1FKA E;  1WJP A;  3HXL A;  2N3H A;  2EM5 A;  3VYX A;  2YTN A;  1J5E E;  4X65 E;  2ADR A;  2PRT A;  2V85 A;  1FJG E;  1XMQ E;  3OML A;  1B69 A;  1NCS A;  2FTX B;  2MKD A;  2WBS A;  1TF3 A;  3EQ1 A;  2V88 A;  2L6M A;  1AH5 A;  2V89 A;  1HNZ E;  2EPK X;  3EPH A;  1P47 A;  4MLQ A;  4NZV A;  3C4T A;  2EL4 A;  5LLQ A;  4LF8 E;  1J26 A;  4O43 A;  2DMI A;  2VQF E;  2UXC E;  2BB8 A;  5AE3 A;  1N36 E;  3HTX A;  2WBT A;  2JOB A;  4X8W A;  4LFB E;  2EM8 A;  2RPC A;  4WPY A;  5A6A A;  5A6K A;  3AV0 A;  4HTG A;  4F9B B;  4DV0 E;  2CPN A;  1BB8 A;  1YUJ A;  1I94 E;  4R8O A;  1MEY C;  1ZBT A;  2ENC A;  4J8Z A;  1DI2 A;  5DNY A;  2YTP A;  1SFE A;  5A69 A;  2A25 A;  2DB2 A;  2EN3 A;  3VHT B;  2EQ3 A;  2B9D A;  3JAM C;  4OX9 E;  2EML A;  2NA2 A;  3DJW A;  2DGC A;  2Q8U A;  2HGH A;  2EOE A;  3J7A G;  1BBO A;  2DMY A;  1ZAA C;  1HR0 E;  1RMD A;  2EZ6 A;  2EMI A;  4BHC A;  1T4N A;  2LMZ A;  3IWC A;  1UIL A;  2M9A A;  4R2A A;  1T38 A;  4JYA E;  2J7J A;  2L92 A;  2YPN A;  3ADG A;  4DV2 E;  1IBM E;  1QNT A;  4KZS A;  5AC4 A;  2B3T B;  4BC7 A;  1A1I A;  3EPL A;  3LML A;  3ADJ A;  2EOM A;  2RS7 A;  1WXR A;  5A6B A;  4JI5 E;  3DF6 A;  4ZYG A;  4LF4 E;  4DV6 E;  2E5L E;  4DR4 E;  3BGH A;  4DMI A;  1SR9 A;  2KON A;  4BBY A;  4DR3 E;  4YHH E;  2LUP B;  3BBG A;  4R2C A;  2EN2 A;  2K4V A;  1HNW E;  3ADI A;  2UUA E;  4GEQ B;  2EOI A;  2HHH E;  4F9A B;  1JK1 A;  1NEI A;  2LCE A;  5FLX C;  1A1F A;  2YTJ A;  1TN9 A;  4F54 A;  2RTX A;  1IBL E;  2YT4 A;  4LF7 E;  3THO B;  3AUZ A;  3KZY A;  4WSP A;  4NXN E;  2JYA A;  1KYQ A;  1N34 E;  2RSI A;  2L2K B;  4X62 E;  2ELZ A;  2CT1 A;  4KHP E;  2R76 A;  3J7Y p;  2MDR A;  2L3C A;  3MHH C;  5BR8 E;  4JI3 E;  4M30 A;  2DIX A;  1N33 E;  5TSE A;  1YYK A;  4FK5 C;  4Q35 B;  1X3C A;  2JWO A;  1A1L A;  4DR7 E;  1O0W A;  4WSG A;  4F9C B;  5AAS A; 
#chains in the Genus database with same CATH homology
 2VF1 A;  2F4V E;  4BMJ A;  1ZBT A;  5CFF E;  5A2Q C;  1N32 E;  3H09 A;  2M4I A;  4J8Z A;  3OTO E;  1YYO A;  1DI2 A;  4LU9 A;  2EWL A;  2ODR C;  4L5N C;  4M0V A;  4OOG C;  5DNY A;  3T1H E;  2ODR D;  4JI7 E;  3HPZ A;  4JI4 E;  1XMO E;  2DB2 A;  3C4B A;  1X47 A;  1GZ6 A;  1XNR E;  2L33 A;  5LL6 R;  4WYQ B;  3ADL A;  3JAM C;  2B9D A;  2N3G A;  2NUE A;  2UXB E;  2KOU A;  2VQE E;  4OX9 E;  2MC6 A;  2VE7 C;  2NA2 A;  2G7H A;  3DJW A;  2M7Q A;  2RSM A;  1QU6 A;  4LF5 E;  4NXM E;  4B3M E;  4LFC E;  5LMU E;  3J7A G;  3J80 C;  2L3J A;  4B3S E;  1T4L B;  2LUQ A;  3FIG A;  4Q28 A;  3JU0 A;  2UUB E;  1RC7 A;  2DMY A;  4P7D A;  2YZT A;  1UHZ A;  4BS9 A;  4M2Z A;  2JY9 A;  1HR0 E;  2RS6 A;  2LTR A;  2FV4 B;  2EZ6 A;  4KHP E;  5F3W A;  1HNX E;  4JI0 E;  3IWB A;  1T4N A;  2LMZ A;  2WZO A;  3HPS A;  3IWC A;  4L8N A;  1PKP A;  1ZBQ A;  4JI1 E;  1UIL A;  3ZOQ B;  5AE1 A;  4DUZ E;  3JTZ A;  2ZM6 E;  2FGG A;  4JYA E;  1T4O A;  2L92 A;  1WHN A;  2KHX A;  2L8T A;  3ADG A;  3LLH A;  4BCA A;  5LMN E;  4DV2 E;  1IBM E;  4JI6 E;  4LFA E;  2LJH A;  4KZS A;  4B3R E;  2B3T B;  3HQ1 A;  1IBK E;  4GKJ E;  4BC7 A;  5IWA E;  4LTY A;  3P1X A;  2JOX A;  2E1M A;  1X49 A;  3ADJ A;  3LML A;  2UU9 E;  2RS7 A;  1WXR A;  4DV1 E;  4JI5 E;  3DF6 A;  2L2M A;  4LF4 E;  1WHQ A;  4I8O A;  4DV6 E;  2E5L E;  4DR2 E;  4TUG A;  5T6J A;  4DUY E;  3KWR A;  5AAS A;  4LF6 E;  4DR4 E;  2V87 A;  4DMI A;  1SR9 A;  4DV3 E;  2H36 X;  2JVA A;  1STU A;  2KON A;  2L2N A;  4BBY A;  4YHH E;  3J81 C;  1RQ0 A;  4DR3 E;  3F6H A;  2LUP B;  1FKA E;  4YY3 E;  2K4V A;  3HXL A;  2F8B A;  2N3H A;  4AQY E;  1HNW E;  4DV7 E;  3ADI A;  3VYX A;  4WFT A;  2B7V A;  2UUA E;  1J5E E;  4X65 E;  4GEQ B;  2LE2 A;  4X66 E;  2LBS B;  2HHH E;  2V85 A;  4F9A B;  1FJG E;  1XMQ E;  2IHR 1;  3OML A;  4BC9 A;  2FTX B;  1EKZ A;  5FLX C;  1DQ3 A;  5IT9 C;  2NUF A;  3K6Q A;  2V88 A;  3VYY A;  5ADZ A;  2V8Q B;  4F54 A;  2V83 A;  4P78 A;  1GQE A;  2L6M A;  2RTX A;  2LTS A;  3RMP A;  1IBL E;  4DR6 E;  4DKK A;  3T1Y E;  4GKK E;  2V89 A;  2YT4 A;  1HNZ E;  2MC5 A;  4LF7 E;  2B7T A;  4DR1 E;  4JI8 E;  4DV5 E;  3C4T A;  4DR5 E;  1XNQ E;  3AUZ A;  4WSP A;  3VK6 A;  4NXN E;  4LF8 E;  4X64 E;  2V86 A;  3MSW A;  4DV4 E;  4B3T E;  1J26 A;  2M1S A;  4LF9 E;  2VQF E;  4TUI A;  1N34 E;  3F6G A;  2UXC E;  2L2K B;  5AE3 A;  4X62 E;  4JI2 E;  1X48 A;  1N36 E;  3J7Y p;  2UUC E;  2MDR A;  2JR1 A;  2JOB A;  4X8W A;  2L3C A;  3HTX A;  4LFB E;  4K0K E;  2NUG A;  5BR8 E;  4JI3 E;  4M30 A;  1YZ9 A;  4WPY A;  2DSY A;  2LRS A;  2DIX A;  1N33 E;  2UXD E;  3AV0 A;  1YYK A;  5AE2 A;  1YYW A;  4R03 A;  4F9B B;  4DV0 E;  2JWO A;  4DR7 E;  1O0W A;  4F9C B;  2CPN A;  3IWD A;  4JV5 E;  1I94 E;  4R8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...