2LJHA

Nmr structure of double-stranded rna-specific editase adar
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
SDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFIQFKDGAVLSPLKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific editase Adar
publication title Solution structure of the N-terminal dsRBD of Drosophila ADAR and interaction studies with RNA.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.5.-.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ljhA01
1O0WA 2LUPB 3VYYA 4DV3E 2E5LE 2DIXA 2F4VE 2L33A 4JI6E 1XNRE 5LMNE 2RS7A 4M2ZA 1I94E 2DMYA 5IWAE 2RSMA 1DI2A 4DV6E 1GQEA 4KHPE 4LFBE 4JI0E 2UU9E 4M30A 4WFTA 4DV5E 1FJGE 2HHHE 2B3TB 2ZM6E 2UUBE 2L2KB 4LFAE 4DV4E 4DV7E 1X49A 1IBME 4X8WA 5CFFE 1T4NA 4JI7E 1EKZA 4DR4E 4DR3E 1RC7A 4NXNE 3LLHA 2B7VA 4LFCE 4B3RE 3ADGA 4LF5E 1HNZE 2MDRA 4DKKA 1HNWE 2LBSB 4DV2E 2L2NA 3P1XA 1HR0E 2EZ6A 1YYWA 5BR8E 1RQ0A 3J7Yp 4DV0E 2UXCE 4X66E 4YHHE 3T1HE 1ZBTA 2LTRA 1XMOE 2UXDE 2NUGA 3T1YE 3ADIA 1YZ9A 2NUEA 3VYXA 1YYKA 1UHZA 2NA2A 2VQEE 2YT4A 1T4OA 1STUA 4JI1E 1N34E 1J5EE 3HTXA 2L3JA 4YY3E 3ADLA 2N3HA 1N33E 2L2MA 4WYQB 4OOGC 2KHXA 4JI8E 4GKJE 2JY9A 2DB2A 4LF9E 4LF8E 4LF4E 4GKKE 2CPNA 1WHQA 4DUYE 4DR1E 4LF6E 4JI2E 2L3CA 2LJHA 2N3GA 4DR2E 1QU6A 5LMUE 3OTOE 4DR5E 4X64E 4JV5E 2B7TA 4DUZE 1XMQE 4B3ME 2LRSA 2LTSA 4X65E 4JI4E 4NXME 1N32E 2RTXA 1N36E 1IBLE 2UUAE 1J26A 1WHNA 1IBKE 2LUQA 4JI3E 4JYAE 2RS6A 1FKAE 4OX9E 1X48A 1UILA 3C4TA 4LF7E 2UUCE 4X62E 2UXBE 4DR6E 4B3TE 2JVAA 4JI5E 1T4LB 2NUFA 1YYOA 4DR7E 1PKPA 4DV1E 2VQFE 2IHR1 1HNXE 1XNQE 4B3SE 3C4BA 4K0KE 1X47A 3ADJA 4AQYE
chains in the Genus database with same CATH superfamily
4HEIA 4RH8A 3VYYA 1WRJA 2DIXA 2J7JA 2L33A 4JI6E 1I94E 4BS9A 2M9AA 2RSMA 2EMFA 2YTIA 2YTDA 3BF2A 2EOFA 2JOXA 1MEYC 1EH7A 4M30A 2EM8A 4DV4E 1P47A 3JTZA 1X6HA 2EMWA 2EMCA 3H09A 4F6MA 2ODRC 1RC7A 5A6BA 5KL5A 2CTDA 2B9DA 2EOYA 3ADGA 4LF5E 2LMZA 4DKKA 4R2RA 4KZSA 2JYAA 2EM0A 3P1XA 2E1MA 3T1HE 2LJUA 2EPAA 1TF6A 1X3CA 2V87A 2EJ4A 2NUGA 3L00A 4MLVA 2EMIA 2EOJA 5TSEA 3ADIA 4DMIA 4R2EA 4R2CA 1ZU1A 1A1LA 1YSAC 2VQEE 2YU8A 1DGCA 3EPLA 2HJJA 5KL4A 2EPZA 2CSHA 2BBGA 2F8BA 4I8OA 1LLMC 4LF8E 4LF4E 2YRMA 1ZBQA 2N3GA 4IS1C 2M1SA 5LMUE 1IQSA 2DSYA 4F54A 4BBYA 2H36X 2B7TA 3HXLA 1XMQE 4JI4E 1NCSA 2EM5A 2EOZA 2RTXA 2UUAE 1J26A 4BC7A 2EL6A 2EQ1A 4ZYEA 1EH8A 5F3WA 1UILA 2DLQA 5DNYA 2UUCE 2MDGA 3HPZA 2YTJA 2NUFA 4DR7E 2VQFE 2HGHA 3IWCA 2EMGA 3C4BA 4J8ZA 2FTXB 2EORA 2YTEA 2YWQA 2LUPB 4R8OA 2YTNA 4Q35B 2EMHA 2EM6A 2LCEA 1RMDA 2EPPA 5A6JA 2WZOA 2DMYA 1DI2A 2EMYA 1GQEA 4LFBE 3EPJA 2JR1A 2JPAA 4ZYHA 5A6AA 1T39A 2UU9E 4JI0E 4DV5E 1FJGE 2B3TB 2ZM6E 2JP9A 2EMLA 1ZR9A 2D9HA 3THOB 2EN3A 1IBME 2EN7A 5CFFE 4JI7E 3KZYA 3M99B 1DQ3A 3LLHA 2B7VA 4LFCE 1JK2A 2EPOA 4HTGA 2EMKA 1PJTA 1A1KA 4R2SA 1X6EA 1EH6A 1PJQA 2I9IA 2LBSB 2YZTA 4DV2E 2UXCE 2EPRA 2LT7A 2EN4A 3IWBA 4P78A 1SR9A 2K7IA 2WCC3 2UXDE 3BBGA 4WX9A 2MC5A 2EOHA 1YZ9A 3J81C 3VK6A 2RSIA 3HPSA 2R1FA 2NUEA 2EMAA 1YYKA 1UHZA 5AE3A 4R2AA 2EMBA 2YT4A 2V89A 4JI1E 2YTGA 2YTPA 3BGHA 2JOBA 3HTXA 5FLXC 3JU0A 2EL5A 4R2QA 5AE1A 1G2FC 5KL6A 2L2MA 1N3GA 3KZZA 2ENAA 4MLQA 3RMPA 2JY9A 2EOSA 4LF9E 2V88A 3BIDA 4O5GA 1GZ6A 2MKDA 4O4KA 4GKKE 2DMIA 1WHQA 4DR1E 3EPHA 2V8QB 2EM3A 4DR2E 1IMUA 1QU6A 4BHBA 5KL2A 3OTOE 4DR5E 4X64E 4JV5E 4LU9A 4DUZE 2LTSA 1N32E 2EE8A 2EOOA 2G7HA 5IV8B 1N36E 4O43A 1A1IA 2DLKA 2LUQA 4JI3E 5KL7A 5AC5A 1TF3A 2LVHA 2RPCA 4OX9E 1X48A 4R2PA 4LF7E 2FV4B 2R76A 4X62E 1T38A 2ODRD 4B3TE 1T4LB 1Z1BA 5A2QC 1PKPA 2IHR1 1XNQE 2EN6A 1X47A 5KL3A 1O0WA 4DV3E 1G2DC 4ZYGA 2E5LE 3IWDA 2ADRA 2YPNA 4BMJA 1UN6B 1ZAAC 2YTFA 1XNRE 5LMNE 2M4IA 2RS7A 1MGTA 4M2ZA 3F6HA 4ZYDA 2EL4A 4BC9A 2DGCA 2EQ0A 2BB8A 2HHHE 4WSPA 3KWRA 2VE7C 3ZOQB 4LFAE 1B69A 3J7AG 2JWOA 1X49A 4NHRA 4R03A 1YUIA 4X8WA 1T4NA 1F2IG 1X5WA 4DR4E 4DR3E 1YUJA 2L6MA 2EOMA 4NXNE 4KWYA 4L5NC 2MKNA 3DF6A 5AC4A 1KYQA 2EPNA 1WXRA 1JK1A 3F6GA 2WBSA 3AUZA 1SFEA 1HR0E 1YYWA 5BR8E 4DV0E 2EM4A 4IJDA 4YHHE 1TN9A 4F9AB 2LV2A 2LTRA 1XMOE 3T1YE 1BBOA 4BHCA 4L8NA 4F2JC 4R2DA 3VYXA 2M7QA 5ADZA 2HC5A 2NA2A 3HQ1A 5IXMB 1STUA 3QG5C 3VHTB 1J5EE 1WJPA 2EPMX 4BCAA 4YY3E 2ENCA 4M9VC 1N33E 2VRDA 2EPLX 3FIGA 4WYQB 2L8TA 4OOGC 4JI8E 4GKJE 2DB2A 4P7DA 4M0VA 2L92A 2KOUA 3MHHC 4X9JA 2CPNA 3K6QA 4JI2E 2LJHA 4NZVA 2EOEA 2EPXA 2RQLA 4TUIA 5A69A 5AASA 3LMLA 2GLIA 4B3ME 2LRSA 4X65E 2EOXA 1BBGA 1WHNA 1IBKE 4WPYA 2A25A 2WBUA 2E72A 1FKAE 1PDAA 2KONA 1YFHA 2UXBE 4DR6E 3DJWA 1YYOA 1AAYA 2EQ3A 1HNXE 1PJSA 4B3SE 2GHFA 2CT1A 1NEIA 3AV0A 2YRHA 5LL6R 3JAMC 3EQ1A 5IT9C 2EM2A 3MSWA 4FK5C 2JXPA 2F4VE 2EMZA 2EOQA 1A1JA 5LLQA 5IWAE 2LO3A 4DV6E 4KHPE 2YSPA 1KJKA 3OMLA 2EPCA 4WXCA 4WFTA 3ECRA 2UUBE 2L2KB 4DV7E 3C6MA 4N4RB 2K4VA 1A1GA 2YSOA 2LE2A 3TQMA 1EKZA 2ELYA 3MHSC 3UK3C 1IQOA 4O24A 4F6NA 2EN1A 4B3RE 1HNZE 2Q8UA 3THNA 2MDRA 4TUGA 2EM7A 1HNWE 1YPNA 2L2NA 2EZ6A 1RQ0A 2ELZA 3J7Yp 2V86A 2YRKA 4X66E 1ZBTA 1QNTA 2EMXA 2V83A 2VF1A 2EN8A 2EP3A 5T6JA 2EWLA 1L4SA 2EN2A 1T4OA 2EM9A 1N34E 5A6KA 4GZNC 2L3JA 1UBDC 3ADLA 2N3HA 5AE2A 3J80C 2KHXA 2PRTA 2FGGA 1X6FA 2YU5A 4WSGA 1A1HA 2GPIA 4DUYE 4LF6E 2L3CA 2EOIA 2V85A 2NABA 4RHBB 2N8XA 2I13A 2DRPA 4NXME 1IBLE 4F9CB 2MC6A 4JYAE 3EPKA 4WXDA 2RS6A 2WBTA 5A6BD 3C4TA 4Q28A 1AH5A 1BB8A 2YTQA 1GTKA 2EPUA 2EPKX 2JVAA 3C6KA 4GEQB 1A1FA 4JI5E 2ENHA 4DV1E 4LTYA 4K0KE 2YTOA 4F9BB 3ADJA 4AQYE
chains in the Genus database with same CATH topology
1O0WA 2LUPB 3JAMC 3VYYA 4DV3E 4R8OA 5IT9C 2E5LE 3IWDA 3MSWA 4BMJA 2DIXA 2EZ6A 2L33A 4JI6E 1XNRE 2F4VE 5LMNE 2M4IA 2RS7A 4M2ZA 1I94E 3F6HA 2WZOA 4BS9A 2DMYA 5IWAE 2RSMA 4BC9A 4DV6E 1DI2A 1GQEA 4KHPE 4LFBE 3OMLA 2JOXA 2JR1A 4JI0E 2UU9E 4M30A 4WFTA 4DV5E 1FJGE 2HHHE 1YYWA 2B3TB 2ZM6E 4WSPA 3KWRA 2VE7C 3ZOQB 2L2KB 2UUBE 4LFAE 4DV4E 4DV7E 3J7AG 2JWOA 1X49A 2K4VA 3JTZA 4R03A 1IBME 4X8WA 2LE2A 1T4NA 5CFFE 2UXCE 4JI7E 1EKZA 4DR4E 4DR3E 3H09A 2ODRC 2L6MA 1RC7A 1DQ3A 4NXNE 3LLHA 4L5NC 2B7VA 4LFCE 3DF6A 2B9DA 4B3RE 3ADGA 4LF5E 1HNZE 2MDRA 2LMZA 4DKKA 1WXRA 4TUGA 3F6GA 4KZSA 1HNWE 2LBSB 2YZTA 3AUZA 4DV2E 2L2NA 3P1XA 4AQYE 2E1MA 1HR0E 1RQ0A 5BR8E 3J7Yp 4DV0E 3IWBA 2V86A 4X66E 4YHHE 3T1HE 1ZBTA 4P78A 4F9AB 1SR9A 2V87A 2LTRA 1XMOE 2UXDE 2NUGA 2V83A 3T1YE 2VF1A 2MC5A 5T6JA 3ADIA 1YZ9A 3J81C 3VK6A 4L8NA 3HPSA 2EWLA 2NUEA 3VYXA 1YYKA 2M7QA 1UHZA 4DMIA 5ADZA 5AE3A 2NA2A 2VQEE 3HQ1A 2YT4A 1T4OA 1STUA 2V89A 4JI1E 1N34E 1J5EE 2JOBA 3HTXA 2L3JA 4BCAA 4YY3E 3JU0A 5FLXC 3ADLA 5AE1A 2N3HA 1N33E 2F8BA 5AE2A 3FIGA 4J8ZA 2L2MA 4WYQB 2L8TA 4OOGC 3J80C 4I8OA 2KHXA 4JI8E 4GKJE 2FGGA 3RMPA 2JY9A 2DB2A 4P7DA 4LF9E 4M0VA 2L92A 2V88A 4LF8E 1GZ6A 2KOUA 4LF4E 4GKKE 2CPNA 1WHQA 3K6QA 4DUYE 1ZBQA 4DR1E 2V8QB 4JI2E 4LF6E 2L3CA 2LJHA 2N3GA 4DR2E 2V85A 1QU6A 2M1SA 4TUIA 2DSYA 5AASA 3OTOE 5LMUE 3LMLA 4DR5E 4F54A 4X64E 4BBYA 2H36X 4JV5E 2B7TA 3HXLA 4LU9A 4DUZE 2LRSA 2LTSA 4X65E 1XMQE 4B3ME 4JI4E 4NXME 1N32E 2G7HA 2RTXA 1N36E 4F9CB 2MC6A 1IBLE 2UUAE 1J26A 1WHNA 1IBKE 4BC7A 2LUQA 4JI3E 4JYAE 4WPYA 2RS6A 1FKAE 4OX9E 5F3WA 1X48A 1UILA 3C4TA 2KONA 4LF7E 2FV4B 5DNYA 4X62E 2UUCE 4DR6E 4Q28A 2UXBE 2ODRD 3HPZA 4B3TE 3DJWA 2JVAA 4JI5E 4GEQB 1T4LB 2NUFA 5A2QC 1YYOA 4DR7E 1PKPA 4DV1E 2VQFE 2IHR1 3IWCA 1HNXE 4B3SE 4LTYA 1XNQE 3C4BA 4K0KE 1X47A 3AV0A 2FTXB 4F9BB 3ADJA 5LL6R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0W A;  2LUP B;  3VYY A;  4DV3 E;  2E5L E;  2DIX A;  2F4V E;  2L33 A;  4JI6 E;  1XNR E;  5LMN E;  2RS7 A;  4M2Z A;  1I94 E;  2DMY A;  5IWA E;  2RSM A;  1DI2 A;  4DV6 E;  1GQE A;  4KHP E;  4LFB E;  4JI0 E;  2UU9 E;  4M30 A;  4WFT A;  4DV5 E;  1FJG E;  2HHH E;  2B3T B;  2ZM6 E;  2UUB E;  2L2K B;  4LFA E;  4DV4 E;  4DV7 E;  1X49 A;  1IBM E;  4X8W A;  5CFF E;  1T4N A;  4JI7 E;  1EKZ A;  4DR4 E;  4DR3 E;  1RC7 A;  4NXN E;  3LLH A;  2B7V A;  4LFC E;  4B3R E;  3ADG A;  4LF5 E;  1HNZ E;  2MDR A;  4DKK A;  1HNW E;  2LBS B;  4DV2 E;  2L2N A;  3P1X A;  1HR0 E;  2EZ6 A;  1YYW A;  5BR8 E;  1RQ0 A;  3J7Y p;  4DV0 E;  2UXC E;  4X66 E;  4YHH E;  3T1H E;  1ZBT A;  2LTR A;  1XMO E;  2UXD E;  2NUG A;  3T1Y E;  3ADI A;  1YZ9 A;  2NUE A;  3VYX A;  1YYK A;  1UHZ A;  2NA2 A;  2VQE E;  2YT4 A;  1T4O A;  1STU A;  4JI1 E;  1N34 E;  1J5E E;  3HTX A;  2L3J A;  4YY3 E;  3ADL A;  2N3H A;  1N33 E;  2L2M A;  4WYQ B;  4OOG C;  2KHX A;  4JI8 E;  4GKJ E;  2JY9 A;  2DB2 A;  4LF9 E;  4LF8 E;  4LF4 E;  4GKK E;  2CPN A;  1WHQ A;  4DUY E;  4DR1 E;  4LF6 E;  4JI2 E;  2L3C A;  2LJH A;  2N3G A;  4DR2 E;  1QU6 A;  5LMU E;  3OTO E;  4DR5 E;  4X64 E;  4JV5 E;  2B7T A;  4DUZ E;  1XMQ E;  4B3M E;  2LRS A;  2LTS A;  4X65 E;  4JI4 E;  4NXM E;  1N32 E;  2RTX A;  1N36 E;  1IBL E;  2UUA E;  1J26 A;  1WHN A;  1IBK E;  2LUQ A;  4JI3 E;  4JYA E;  2RS6 A;  1FKA E;  4OX9 E;  1X48 A;  1UIL A;  3C4T A;  4LF7 E;  2UUC E;  4X62 E;  2UXB E;  4DR6 E;  4B3T E;  2JVA A;  4JI5 E;  1T4L B;  2NUF A;  1YYO A;  4DR7 E;  1PKP A;  4DV1 E;  2VQF E;  2IHR 1;  1HNX E;  1XNQ E;  4B3S E;  3C4B A;  4K0K E;  1X47 A;  3ADJ A;  4AQY E; 
#chains in the Genus database with same CATH topology
 4HEI A;  4RH8 A;  3VYY A;  1WRJ A;  2DIX A;  2J7J A;  2L33 A;  4JI6 E;  1I94 E;  4BS9 A;  2M9A A;  2RSM A;  2EMF A;  2YTI A;  2YTD A;  3BF2 A;  2EOF A;  2JOX A;  1MEY C;  1EH7 A;  4M30 A;  2EM8 A;  4DV4 E;  1P47 A;  3JTZ A;  1X6H A;  2EMW A;  2EMC A;  3H09 A;  4F6M A;  2ODR C;  1RC7 A;  5A6B A;  5KL5 A;  2CTD A;  2B9D A;  2EOY A;  3ADG A;  4LF5 E;  2LMZ A;  4DKK A;  4R2R A;  4KZS A;  2JYA A;  2EM0 A;  3P1X A;  2E1M A;  3T1H E;  2LJU A;  2EPA A;  1TF6 A;  1X3C A;  2V87 A;  2EJ4 A;  2NUG A;  3L00 A;  4MLV A;  2EMI A;  2EOJ A;  5TSE A;  3ADI A;  4DMI A;  4R2E A;  4R2C A;  1ZU1 A;  1A1L A;  1YSA C;  2VQE E;  2YU8 A;  1DGC A;  3EPL A;  2HJJ A;  5KL4 A;  2EPZ A;  2CSH A;  2BBG A;  2F8B A;  4I8O A;  1LLM C;  4LF8 E;  4LF4 E;  2YRM A;  1ZBQ A;  2N3G A;  4IS1 C;  2M1S A;  5LMU E;  1IQS A;  2DSY A;  4F54 A;  4BBY A;  2H36 X;  2B7T A;  3HXL A;  1XMQ E;  4JI4 E;  1NCS A;  2EM5 A;  2EOZ A;  2RTX A;  2UUA E;  1J26 A;  4BC7 A;  2EL6 A;  2EQ1 A;  4ZYE A;  1EH8 A;  5F3W A;  1UIL A;  2DLQ A;  5DNY A;  2UUC E;  2MDG A;  3HPZ A;  2YTJ A;  2NUF A;  4DR7 E;  2VQF E;  2HGH A;  3IWC A;  2EMG A;  3C4B A;  4J8Z A;  2FTX B;  2EOR A;  2YTE A;  2YWQ A;  2LUP B;  4R8O A;  2YTN A;  4Q35 B;  2EMH A;  2EM6 A;  2LCE A;  1RMD A;  2EPP A;  5A6J A;  2WZO A;  2DMY A;  1DI2 A;  2EMY A;  1GQE A;  4LFB E;  3EPJ A;  2JR1 A;  2JPA A;  4ZYH A;  5A6A A;  1T39 A;  2UU9 E;  4JI0 E;  4DV5 E;  1FJG E;  2B3T B;  2ZM6 E;  2JP9 A;  2EML A;  1ZR9 A;  2D9H A;  3THO B;  2EN3 A;  1IBM E;  2EN7 A;  5CFF E;  4JI7 E;  3KZY A;  3M99 B;  1DQ3 A;  3LLH A;  2B7V A;  4LFC E;  1JK2 A;  2EPO A;  4HTG A;  2EMK A;  1PJT A;  1A1K A;  4R2S A;  1X6E A;  1EH6 A;  1PJQ A;  2I9I A;  2LBS B;  2YZT A;  4DV2 E;  2UXC E;  2EPR A;  2LT7 A;  2EN4 A;  3IWB A;  4P78 A;  1SR9 A;  2K7I A;  2WCC 3;  2UXD E;  3BBG A;  4WX9 A;  2MC5 A;  2EOH A;  1YZ9 A;  3J81 C;  3VK6 A;  2RSI A;  3HPS A;  2R1F A;  2NUE A;  2EMA A;  1YYK A;  1UHZ A;  5AE3 A;  4R2A A;  2EMB A;  2YT4 A;  2V89 A;  4JI1 E;  2YTG A;  2YTP A;  3BGH A;  2JOB A;  3HTX A;  5FLX C;  3JU0 A;  2EL5 A;  4R2Q A;  5AE1 A;  1G2F C;  5KL6 A;  2L2M A;  1N3G A;  3KZZ A;  2ENA A;  4MLQ A;  3RMP A;  2JY9 A;  2EOS A;  4LF9 E;  2V88 A;  3BID A;  4O5G A;  1GZ6 A;  2MKD A;  4O4K A;  4GKK E;  2DMI A;  1WHQ A;  4DR1 E;  3EPH A;  2V8Q B;  2EM3 A;  4DR2 E;  1IMU A;  1QU6 A;  4BHB A;  5KL2 A;  3OTO E;  4DR5 E;  4X64 E;  4JV5 E;  4LU9 A;  4DUZ E;  2LTS A;  1N32 E;  2EE8 A;  2EOO A;  2G7H A;  5IV8 B;  1N36 E;  4O43 A;  1A1I A;  2DLK A;  2LUQ A;  4JI3 E;  5KL7 A;  5AC5 A;  1TF3 A;  2LVH A;  2RPC A;  4OX9 E;  1X48 A;  4R2P A;  4LF7 E;  2FV4 B;  2R76 A;  4X62 E;  1T38 A;  2ODR D;  4B3T E;  1T4L B;  1Z1B A;  5A2Q C;  1PKP A;  2IHR 1;  1XNQ E;  2EN6 A;  1X47 A;  5KL3 A;  1O0W A;  4DV3 E;  1G2D C;  4ZYG A;  2E5L E;  3IWD A;  2ADR A;  2YPN A;  4BMJ A;  1UN6 B;  1ZAA C;  2YTF A;  1XNR E;  5LMN E;  2M4I A;  2RS7 A;  1MGT A;  4M2Z A;  3F6H A;  4ZYD A;  2EL4 A;  4BC9 A;  2DGC A;  2EQ0 A;  2BB8 A;  2HHH E;  4WSP A;  3KWR A;  2VE7 C;  3ZOQ B;  4LFA E;  1B69 A;  3J7A G;  2JWO A;  1X49 A;  4NHR A;  4R03 A;  1YUI A;  4X8W A;  1T4N A;  1F2I G;  1X5W A;  4DR4 E;  4DR3 E;  1YUJ A;  2L6M A;  2EOM A;  4NXN E;  4KWY A;  4L5N C;  2MKN A;  3DF6 A;  5AC4 A;  1KYQ A;  2EPN A;  1WXR A;  1JK1 A;  3F6G A;  2WBS A;  3AUZ A;  1SFE A;  1HR0 E;  1YYW A;  5BR8 E;  4DV0 E;  2EM4 A;  4IJD A;  4YHH E;  1TN9 A;  4F9A B;  2LV2 A;  2LTR A;  1XMO E;  3T1Y E;  1BBO A;  4BHC A;  4L8N A;  4F2J C;  4R2D A;  3VYX A;  2M7Q A;  5ADZ A;  2HC5 A;  2NA2 A;  3HQ1 A;  5IXM B;  1STU A;  3QG5 C;  3VHT B;  1J5E E;  1WJP A;  2EPM X;  4BCA A;  4YY3 E;  2ENC A;  4M9V C;  1N33 E;  2VRD A;  2EPL X;  3FIG A;  4WYQ B;  2L8T A;  4OOG C;  4JI8 E;  4GKJ E;  2DB2 A;  4P7D A;  4M0V A;  2L92 A;  2KOU A;  3MHH C;  4X9J A;  2CPN A;  3K6Q A;  4JI2 E;  2LJH A;  4NZV A;  2EOE A;  2EPX A;  2RQL A;  4TUI A;  5A69 A;  5AAS A;  3LML A;  2GLI A;  4B3M E;  2LRS A;  4X65 E;  2EOX A;  1BBG A;  1WHN A;  1IBK E;  4WPY A;  2A25 A;  2WBU A;  2E72 A;  1FKA E;  1PDA A;  2KON A;  1YFH A;  2UXB E;  4DR6 E;  3DJW A;  1YYO A;  1AAY A;  2EQ3 A;  1HNX E;  1PJS A;  4B3S E;  2GHF A;  2CT1 A;  1NEI A;  3AV0 A;  2YRH A;  5LL6 R;  3JAM C;  3EQ1 A;  5IT9 C;  2EM2 A;  3MSW A;  4FK5 C;  2JXP A;  2F4V E;  2EMZ A;  2EOQ A;  1A1J A;  5LLQ A;  5IWA E;  2LO3 A;  4DV6 E;  4KHP E;  2YSP A;  1KJK A;  3OML A;  2EPC A;  4WXC A;  4WFT A;  3ECR A;  2UUB E;  2L2K B;  4DV7 E;  3C6M A;  4N4R B;  2K4V A;  1A1G A;  2YSO A;  2LE2 A;  3TQM A;  1EKZ A;  2ELY A;  3MHS C;  3UK3 C;  1IQO A;  4O24 A;  4F6N A;  2EN1 A;  4B3R E;  1HNZ E;  2Q8U A;  3THN A;  2MDR A;  4TUG A;  2EM7 A;  1HNW E;  1YPN A;  2L2N A;  2EZ6 A;  1RQ0 A;  2ELZ A;  3J7Y p;  2V86 A;  2YRK A;  4X66 E;  1ZBT A;  1QNT A;  2EMX A;  2V83 A;  2VF1 A;  2EN8 A;  2EP3 A;  5T6J A;  2EWL A;  1L4S A;  2EN2 A;  1T4O A;  2EM9 A;  1N34 E;  5A6K A;  4GZN C;  2L3J A;  1UBD C;  3ADL A;  2N3H A;  5AE2 A;  3J80 C;  2KHX A;  2PRT A;  2FGG A;  1X6F A;  2YU5 A;  4WSG A;  1A1H A;  2GPI A;  4DUY E;  4LF6 E;  2L3C A;  2EOI A;  2V85 A;  2NAB A;  4RHB B;  2N8X A;  2I13 A;  2DRP A;  4NXM E;  1IBL E;  4F9C B;  2MC6 A;  4JYA E;  3EPK A;  4WXD A;  2RS6 A;  2WBT A;  5A6B D;  3C4T A;  4Q28 A;  1AH5 A;  1BB8 A;  2YTQ A;  1GTK A;  2EPU A;  2EPK X;  2JVA A;  3C6K A;  4GEQ B;  1A1F A;  4JI5 E;  2ENH A;  4DV1 E;  4LTY A;  4K0K E;  2YTO A;  4F9B B;  3ADJ A;  4AQY E; 
#chains in the Genus database with same CATH homology
 1O0W A;  2LUP B;  3JAM C;  3VYY A;  4DV3 E;  4R8O A;  5IT9 C;  2E5L E;  3IWD A;  3MSW A;  4BMJ A;  2DIX A;  2EZ6 A;  2L33 A;  4JI6 E;  1XNR E;  2F4V E;  5LMN E;  2M4I A;  2RS7 A;  4M2Z A;  1I94 E;  3F6H A;  2WZO A;  4BS9 A;  2DMY A;  5IWA E;  2RSM A;  4BC9 A;  4DV6 E;  1DI2 A;  1GQE A;  4KHP E;  4LFB E;  3OML A;  2JOX A;  2JR1 A;  4JI0 E;  2UU9 E;  4M30 A;  4WFT A;  4DV5 E;  1FJG E;  2HHH E;  1YYW A;  2B3T B;  2ZM6 E;  4WSP A;  3KWR A;  2VE7 C;  3ZOQ B;  2L2K B;  2UUB E;  4LFA E;  4DV4 E;  4DV7 E;  3J7A G;  2JWO A;  1X49 A;  2K4V A;  3JTZ A;  4R03 A;  1IBM E;  4X8W A;  2LE2 A;  1T4N A;  5CFF E;  2UXC E;  4JI7 E;  1EKZ A;  4DR4 E;  4DR3 E;  3H09 A;  2ODR C;  2L6M A;  1RC7 A;  1DQ3 A;  4NXN E;  3LLH A;  4L5N C;  2B7V A;  4LFC E;  3DF6 A;  2B9D A;  4B3R E;  3ADG A;  4LF5 E;  1HNZ E;  2MDR A;  2LMZ A;  4DKK A;  1WXR A;  4TUG A;  3F6G A;  4KZS A;  1HNW E;  2LBS B;  2YZT A;  3AUZ A;  4DV2 E;  2L2N A;  3P1X A;  4AQY E;  2E1M A;  1HR0 E;  1RQ0 A;  5BR8 E;  3J7Y p;  4DV0 E;  3IWB A;  2V86 A;  4X66 E;  4YHH E;  3T1H E;  1ZBT A;  4P78 A;  4F9A B;  1SR9 A;  2V87 A;  2LTR A;  1XMO E;  2UXD E;  2NUG A;  2V83 A;  3T1Y E;  2VF1 A;  2MC5 A;  5T6J A;  3ADI A;  1YZ9 A;  3J81 C;  3VK6 A;  4L8N A;  3HPS A;  2EWL A;  2NUE A;  3VYX A;  1YYK A;  2M7Q A;  1UHZ A;  4DMI A;  5ADZ A;  5AE3 A;  2NA2 A;  2VQE E;  3HQ1 A;  2YT4 A;  1T4O A;  1STU A;  2V89 A;  4JI1 E;  1N34 E;  1J5E E;  2JOB A;  3HTX A;  2L3J A;  4BCA A;  4YY3 E;  3JU0 A;  5FLX C;  3ADL A;  5AE1 A;  2N3H A;  1N33 E;  2F8B A;  5AE2 A;  3FIG A;  4J8Z A;  2L2M A;  4WYQ B;  2L8T A;  4OOG C;  3J80 C;  4I8O A;  2KHX A;  4JI8 E;  4GKJ E;  2FGG A;  3RMP A;  2JY9 A;  2DB2 A;  4P7D A;  4LF9 E;  4M0V A;  2L92 A;  2V88 A;  4LF8 E;  1GZ6 A;  2KOU A;  4LF4 E;  4GKK E;  2CPN A;  1WHQ A;  3K6Q A;  4DUY E;  1ZBQ A;  4DR1 E;  2V8Q B;  4JI2 E;  4LF6 E;  2L3C A;  2LJH A;  2N3G A;  4DR2 E;  2V85 A;  1QU6 A;  2M1S A;  4TUI A;  2DSY A;  5AAS A;  3OTO E;  5LMU E;  3LML A;  4DR5 E;  4F54 A;  4X64 E;  4BBY A;  2H36 X;  4JV5 E;  2B7T A;  3HXL A;  4LU9 A;  4DUZ E;  2LRS A;  2LTS A;  4X65 E;  1XMQ E;  4B3M E;  4JI4 E;  4NXM E;  1N32 E;  2G7H A;  2RTX A;  1N36 E;  4F9C B;  2MC6 A;  1IBL E;  2UUA E;  1J26 A;  1WHN A;  1IBK E;  4BC7 A;  2LUQ A;  4JI3 E;  4JYA E;  4WPY A;  2RS6 A;  1FKA E;  4OX9 E;  5F3W A;  1X48 A;  1UIL A;  3C4T A;  2KON A;  4LF7 E;  2FV4 B;  5DNY A;  4X62 E;  2UUC E;  4DR6 E;  4Q28 A;  2UXB E;  2ODR D;  3HPZ A;  4B3T E;  3DJW A;  2JVA A;  4JI5 E;  4GEQ B;  1T4L B;  2NUF A;  5A2Q C;  1YYO A;  4DR7 E;  1PKP A;  4DV1 E;  2VQF E;  2IHR 1;  3IWC A;  1HNX E;  4B3S E;  4LTY A;  1XNQ E;  3C4B A;  4K0K E;  1X47 A;  3AV0 A;  2FTX B;  4F9B B;  3ADJ A;  5LL6 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...