2LJHA

Nmr structure of double-stranded rna-specific editase adar
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
SDPKKKMCKERIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRSFIQFKDGAVLSPLKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal dsRBD of Drosophila ADAR and interaction studies with RNA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific editase Adar
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.5.-.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2ljhA01
4YY3E 2NUEA 2LUPB 2B3TB 2LBSB 2KHXA 4DR5E 2N3GA 4DR3E 4JYAE 3VYYA 1UHZA 1X49A 2LTSA 4GKJE 1RC7A 4LFBE 4DR7E 4DR6E 4NXME 1XMOE 4DV0E 1X48A 1WHNA 4JV5E 3J7Yp 4LF6E 1FJGE 2NA2A 4JI2E 2LJHA 2UUAE 4JI7E 4NXNE 4LFAE 2B7TA 2UU9E 1YYKA 3LLHA 1WHQA 2RTXA 1RQ0A 2L2MA 1HR0E 2UXBE 1J26A 4JI3E 2F4VE 5IWAE 4AQYE 2UUCE 2L3CA 2N3HA 4LF7E 2YT4A 2IHR1 2B7VA 1T4OA 1IBKE 2EZ6A 2RS7A 4DV6E 4JI5E 3ADGA 4B3ME 4KHPE 5LMNE 4LF8E 1IBLE 2RS6A 1XNRE 1HNXE 1N32E 1ZBTA 4DV5E 1YYWA 3HTXA 2ZM6E 4DV2E 1UILA 2LTRA 4DV4E 4LF4E 2JVAA 4DR4E 1T4NA 4X64E 1HNWE 3OTOE 4DV3E 5CFFE 1J5EE 1GQEA 2DB2A 3C4BA 1YZ9A 2UXDE 4LF5E 3ADIA 1PKPA 4M30A 1FKAE 1N34E 2VQEE 4WFTA 1STUA 1XMQE 1I94E 3ADLA 2L33A 1YYOA 4DUYE 1DI2A 1N36E 4LFCE 4JI6E 4WYQB 1X47A 3ADJA 2NUFA 4OX9E 4X62E 4YHHE 4B3RE 5BR8E 4X65E 4B3SE 4DV7E 4K0KE 1XNQE 2RSMA 1QU6A 4JI0E 4M2ZA 3VYXA 2LRSA 2MDRA 4B3TE 2JY9A 2UXCE 5LMUE 1EKZA 4X66E 4X8WA 2L2NA 2L2KB 4JI8E 1T4LB 2UUBE 2VQFE 1HNZE 2E5LE 4DUZE 4DR1E 2L3JA 2HHHE 1N33E 2CPNA 4DR2E 4GKKE 2DMYA 4DV1E 4DKKA 3C4TA 4JI4E 2DIXA 4LF9E 1IBME 1O0WA 2LUQA 4OOGC 3T1YE 3T1HE 2NUGA 3P1XA 4JI1E
chains in the Genus database with same CATH superfamily
4KWYA 2B3TB 1IQOA 2M7QA 1WRJA 2EPZA 2LBSB 2K7IA 3VK6A 5A6KA 3FIGA 4DR5E 1A1IA 1AAYA 1X49A 2L6MA 4GKJE 2EOEA 2ENAA 3F6GA 4DR6E 2EM3A 4NXME 3J7Yp 2V87A 1FJGE 2MKNA 4JI2E 2KOUA 3L00A 4JI7E 2YRMA 2LO3A 4LFAE 2B7TA 2UU9E 1YYKA 2UXBE 1RQ0A 1SR9A 1BBOA 1Z1BA 2BB8A 5IWAE 4AQYE 2YTIA 4BC9A 2EMXA 2G7HA 4TUIA 5IXMB 1NCSA 2EMKA 2RS7A 2ENCA 3UK3C 4KHPE 1X3CA 1A1GA 4R2RA 2EN6A 2EPRA 2WBTA 1IBLE 4WPYA 1XNRE 2KONA 1N32E 1KJKA 2HGHA 1A1JA 3HTXA 2ZM6E 2GHFA 4DV4E 1HNWE 2YSOA 4X64E 4DV3E 1J5EE 2YTGA 1GQEA 1TF3A 2DB2A 4BC7A 1YZ9A 2ADRA 4LF5E 1IQSA 1PJQA 2JR1A 3ADIA 1DQ3A 1N34E 2EM8A 2VQEE 1STUA 1XMQE 5KL4A 4R2EA 1X47A 2NUFA 1B69A 1EH6A 4BS9A 2YRKA 5BR8E 1GTKA 1YFHA 2EL5A 5AASA 1XNQE 5FLXC 1YSAC 1TF6A 2RSMA 1QU6A 5AC4A 3RMPA 4JI0E 4IJDA 1EKZA 2V89A 4O24A 4X8WA 1T4LB 2EOMA 2UUBE 2EM0A 2L3JA 4BCAA 2HHHE 4M0VA 1EH8A 2JWOA 1IBME 4OOGC 2EMBA 4BBYA 4JI1E 4YY3E 2HJJA 2LUPB 3EPKA 2EOOA 5KL2A 2EPKX 4X9JA 2YTEA 3M99B 4JYAE 1A1KA 2EMYA 4WSGA 2LTSA 3J7AG 2V88A 1G2FC 2YWQA 4M9VC 4LFBE 4DR7E 4F6NA 2F8BA 4LF6E 2EMGA 2NA2A 2V86A 2LJHA 2YPNA 2LE2A 3KWRA 2YZTA 2DRPA 1WHQA 2EMFA 3IWBA 2JP9A 1J26A 1BBGA 3OMLA 4DMIA 3J81C 3AV0A 4JI3E 3HPSA 2UUCE 2B9DA 2L3CA 2N3HA 4Q35B 2B7VA 3DF6A 2R76A 1IBKE 4BHCA 4B3ME 4IS1C 5LMNE 4O5GA 2WCC3 1N3GA 2EPPA 4F9AB 2EOJA 3DJWA 4HEIA 3BGHA 3HQ1A 4WX9A 1YYWA 2PRTA 4R2PA 5TSEA 4P78A 1UILA 2MKDA 2JVAA 3OTOE 2EPUA 3C4BA 1MGTA 2LV2A 2EN2A 2UXDE 4R2DA 3KZZA 1GZ6A 2EN4A 1FKAE 3QG5C 4Q28A 1I94E 2L33A 1TN9A 1X5WA 4LFCE 2RSIA 4WYQB 4NZVA 3MHSC 1IMUA 3HPZA 2EOYA 3J80C 4X65E 4B3SE 2LCEA 2V83A 2MC5A 3AUZA 3ECRA 1LLMC 4O43A 1PJTA 4K0KE 2EQ1A 2ENHA 2EOHA 2UXCE 4B3TE 2EN3A 4WXDA 5LMUE 1KYQA 2L2KB 1F2IG 4JI8E 3KZYA 2EMIA 2E5LE 4L5NC 2JXPA 1EH7A 2CPNA 1N33E 1L4SA 4GKKE 4GZNC 4R2AA 2VRDA 3C4TA 4JI4E 2DIXA 2HC5A 4O4KA 2JPAA 2LUQA 3MSWA 4BHBA 2WBUA 3P1XA 2CTDA 1T38A 2EN8A 4R8OA 2YTPA 1QNTA 2H36X 5KL7A 2CT1A 1G2DC 2KHXA 2YTNA 4ZYEA 2EPCA 2N3GA 2EOFA 4DR3E 5IV8B 1ZR9A 3VHTB 2EJ4A 2FTXB 5AE1A 1RC7A 1MEYC 5AE2A 2LJUA 4ZYGA 1XMOE 1X48A 1WHNA 5A6BD 4JV5E 2EOQA 5A6BA 4R2SA 3C6MA 1ZAAC 3LMLA 2RTXA 2EPXA 1PDAA 1X6HA 1ZU1A 4F2JC 4LU9A 3MHHC 2IHR1 3JTZA 1T4OA 4JI5E 4DV6E 4ZYHA 2DLQA 2JOXA 2EQ3A 4LF8E 2EORA 2EMCA 2RS6A 1ZBTA 2EL4A 4DV5E 2EPMX 4P7DA 1UBDC 2YTFA 2YTJA 1WJPA 2YTQA 3BBGA 3EPHA 2E72A 4LF4E 1T4NA 4GEQB 2EQ0A 5CFFE 2RQLA 4F9CB 2V8QB 2R1FA 1AH5A 3IWCA 4F6MA 4M30A 3ZOQB 5KL5A 2EMAA 1YYOA 1DI2A 2Q8UA 1N36E 3TQMA 4MLVA 2LMZA 4TUGA 2DLKA 3ADJA 2EM6A 3HXLA 4OX9E 2EM2A 4HTGA 5KL6A 5AC5A 2EM7A 2EM4A 2EPAA 2YTDA 4M2ZA 3VYXA 3JU0A 2LRSA 2EN1A 2MDRA 2JY9A 2ODRC 4L8NA 2DGCA 2EMLA 4F9BB 1HNZE 3K6QA 1DGCA 4DUZE 1T39A 4WSPA 3BF2A 2DMYA 5A2QC 4DV1E 5IT9C 5A6AA 3EPLA 1YUJA 4N4RB 2DSYA 2DMIA 2M1SA 2NUEA 3F6HA 4RHBB 2EPOA 3IWDA 2EMWA 2L8TA 3C6KA 3BIDA 1NEIA 2BBGA 2A25A 2E1MA 1SFEA 3VYYA 1UHZA 2LVHA 2EMHA 4BMJA 2WZOA 2MC6A 2EPLX 2RPCA 4DV0E 2EOSA 1JK1A 2MDGA 2J7JA 4KZSA 5KL3A 1WXRA 5T6JA 2UUAE 2YU5A 4NXNE 3LLHA 4LTYA 1HR0E 2L2MA 5F3WA 4MLQA 2F4VE 1PJSA 2GPIA 3H09A 4LF7E 2YT4A 3EPJA 2FV4B 2EZ6A 5ADZA 2N8XA 1X6EA 3ADGA 5A69A 3JAMC 4ZYDA 1A1HA 2ELZA 2I13A 5LLQA 1HNXE 4F54A 2I9IA 1YPNA 2EL6A 3EQ1A 4J8ZA 4DV2E 1P47A 1A1FA 2EM5A 2EN7A 2EMZA 2LTRA 4DR4E 1X6FA 5DNYA 2EP3A 4R2CA 2EPNA 4FK5C 1PKPA 2GLIA 2VE7C 4WFTA 2VF1A 4R03A 3ADLA 4DUYE 4I8OA 2ELYA 4NHRA 1JK2A 2WBSA 2YRHA 3THOB 2EOIA 2L92A 4JI6E 4X62E 4YHHE 4B3RE 4RH8A 2EOZA 2EWLA 1YUIA 3THNA 5AE3A 2NABA 4DV7E 2D9HA 2YU8A 2ODRD 2LT7A 5A6JA 2M4IA 2EE8A 1ZBQA 5LL6R 2YSPA 2JOBA 2M9AA 4X66E 2L2NA 2VQFE 2V85A 2EOXA 4DR1E 4DR2E 2EM9A 1BB8A 2FGGA 1A1LA 4R2QA 4DKKA 4LF9E 1UN6B 2CSHA 1O0WA 2JYAA 3T1YE 3T1HE 2NUGA 4WXCA 1RMDA 2YTOA 2K4VA
chains in the Genus database with same CATH topology
2M1SA 4YY3E 4R8OA 2LUPB 2B3TB 2NUEA 3F6HA 2H36X 2M7QA 3IWDA 2LBSB 2L8TA 2KHXA 3VK6A 3FIGA 4DR5E 2N3GA 4DR3E 4JYAE 2E1MA 3VYYA 1UHZA 1X49A 2L6MA 2LTSA 2FTXB 5AE1A 3J7AG 4GKJE 2V88A 1RC7A 4BMJA 2WZOA 2MC6A 4LFBE 3F6GA 4DR7E 4DR6E 4NXME 5AE2A 1XMOE 4DV0E 1X48A 1WHNA 2F8BA 3J7Yp 2V87A 4LF6E 1FJGE 4JV5E 2NA2A 4KZSA 4JI2E 2V86A 1WXRA 2LJHA 5T6JA 2UUAE 2KOUA 2LE2A 4JI7E 4NXNE 3KWRA 2YZTA 4LFAE 2B7TA 2UU9E 3LMLA 1YYKA 3LLHA 4LTYA 1WHQA 2RTXA 1RQ0A 2L2MA 3IWBA 1HR0E 1SR9A 3OMLA 4DMIA 2UXBE 1J26A 3J81C 5F3WA 3AV0A 4JI3E 2F4VE 5IWAE 3HPSA 4AQYE 2UUCE 2B9DA 3H09A 2N3HA 2L3CA 2YT4A 4LU9A 4BC9A 4LF7E 2G7HA 2IHR1 4TUIA 2B7VA 3DF6A 3JTZA 2FV4B 1T4OA 1IBKE 2EZ6A 2RS7A 5ADZA 4DV6E 3ADGA 4JI5E 4B3ME 4KHPE 3JAMC 5LMNE 2JOXA 4LF8E 4F9AB 1IBLE 3DJWA 2RS6A 4WPYA 2KONA 1HNXE 1N32E 1ZBTA 1XNRE 3HQ1A 4DV5E 4F54A 4P7DA 1YYWA 3HTXA 2ZM6E 4DV2E 4J8ZA 4P78A 1UILA 2LTRA 4DV4E 4LF4E 2JVAA 4DR4E 1T4NA 4X64E 1HNWE 4GEQB 3OTOE 4DV3E 5CFFE 1J5EE 1GQEA 2DB2A 3C4BA 4BC7A 5DNYA 4F9CB 1YZ9A 2UXDE 4LF5E 2JR1A 2V8QB 3ADIA 3IWCA 1PKPA 4M30A 1DQ3A 2VE7C 1GZ6A 3ZOQB 2VQEE 4WFTA 1STUA 2VF1A 4Q28A 4R03A 1XMQE 2L33A 1I94E 1FKAE 1YYOA 4DUYE 4I8OA 4JI1E 2DSYA 1DI2A 1N36E 4LFCE 4JI6E 2L92A 4WYQB 2LMZA 1X47A 4TUGA 3ADJA 2NUFA 3HXLA 4OX9E 4X62E 4YHHE 4B3RE 3HPZA 2EWLA 4BS9A 5BR8E 3J80C 5AE3A 4X65E 4B3SE 2V83A 3AUZA 2MC5A 4DV7E 2UXCE 4K0KE 5AASA 1XNQE 5FLXC 2ODRD 2RSMA 1QU6A 3RMPA 2M4IA 4JI0E 4M2ZA 3VYXA 3JU0A 1ZBQA 2LRSA 2MDRA 2JY9A 2ODRC 4L8NA 2JOBA 5LL6R 5LMUE 1EKZA 2V89A 4F9BB 4X66E 4X8WA 2L2NA 2L2KB 4JI8E 1T4LB 2UUBE 2VQFE 1HNZE 3K6QA 2V85A 2E5LE 4L5NC 4DUZE 2L3JA 4BCAA 4DR1E 2CPNA 4DR2E 2HHHE 1N33E 4WSPA 2FGGA 4M0VA 4B3TE 3ADLA 4GKKE 2DMYA 5A2QC 4DV1E 4DKKA 5IT9C 3C4TA 4JI4E 2DIXA 4LF9E 2JWOA 1IBME 1O0WA 2LUQA 4OOGC 3T1YE 3T1HE 3MSWA 2NUGA 2K4VA 3P1XA 1N34E 4BBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 E;  2NUE A;  2LUP B;  2B3T B;  2LBS B;  2KHX A;  4DR5 E;  2N3G A;  4DR3 E;  4JYA E;  3VYY A;  1UHZ A;  1X49 A;  2LTS A;  4GKJ E;  1RC7 A;  4LFB E;  4DR7 E;  4DR6 E;  4NXM E;  1XMO E;  4DV0 E;  1X48 A;  1WHN A;  4JV5 E;  3J7Y p;  4LF6 E;  1FJG E;  2NA2 A;  4JI2 E;  2LJH A;  2UUA E;  4JI7 E;  4NXN E;  4LFA E;  2B7T A;  2UU9 E;  1YYK A;  3LLH A;  1WHQ A;  2RTX A;  1RQ0 A;  2L2M A;  1HR0 E;  2UXB E;  1J26 A;  4JI3 E;  2F4V E;  5IWA E;  4AQY E;  2UUC E;  2L3C A;  2N3H A;  4LF7 E;  2YT4 A;  2IHR 1;  2B7V A;  1T4O A;  1IBK E;  2EZ6 A;  2RS7 A;  4DV6 E;  4JI5 E;  3ADG A;  4B3M E;  4KHP E;  5LMN E;  4LF8 E;  1IBL E;  2RS6 A;  1XNR E;  1HNX E;  1N32 E;  1ZBT A;  4DV5 E;  1YYW A;  3HTX A;  2ZM6 E;  4DV2 E;  1UIL A;  2LTR A;  4DV4 E;  4LF4 E;  2JVA A;  4DR4 E;  1T4N A;  4X64 E;  1HNW E;  3OTO E;  4DV3 E;  5CFF E;  1J5E E;  1GQE A;  2DB2 A;  3C4B A;  1YZ9 A;  2UXD E;  4LF5 E;  3ADI A;  1PKP A;  4M30 A;  1FKA E;  1N34 E;  2VQE E;  4WFT A;  1STU A;  1XMQ E;  1I94 E;  3ADL A;  2L33 A;  1YYO A;  4DUY E;  1DI2 A;  1N36 E;  4LFC E;  4JI6 E;  4WYQ B;  1X47 A;  3ADJ A;  2NUF A;  4OX9 E;  4X62 E;  4YHH E;  4B3R E;  5BR8 E;  4X65 E;  4B3S E;  4DV7 E;  4K0K E;  1XNQ E;  2RSM A;  1QU6 A;  4JI0 E;  4M2Z A;  3VYX A;  2LRS A;  2MDR A;  4B3T E;  2JY9 A;  2UXC E;  5LMU E;  1EKZ A;  4X66 E;  4X8W A;  2L2N A;  2L2K B;  4JI8 E;  1T4L B;  2UUB E;  2VQF E;  1HNZ E;  2E5L E;  4DUZ E;  4DR1 E;  2L3J A;  2HHH E;  1N33 E;  2CPN A;  4DR2 E;  4GKK E;  2DMY A;  4DV1 E;  4DKK A;  3C4T A;  4JI4 E;  2DIX A;  4LF9 E;  1IBM E;  1O0W A;  2LUQ A;  4OOG C;  3T1Y E;  3T1H E;  2NUG A;  3P1X A;  4JI1 E; 
#chains in the Genus database with same CATH topology
 4KWY A;  2B3T B;  1IQO A;  2M7Q A;  1WRJ A;  2EPZ A;  2LBS B;  2K7I A;  3VK6 A;  5A6K A;  3FIG A;  4DR5 E;  1A1I A;  1AAY A;  1X49 A;  2L6M A;  4GKJ E;  2EOE A;  2ENA A;  3F6G A;  4DR6 E;  2EM3 A;  4NXM E;  3J7Y p;  2V87 A;  1FJG E;  2MKN A;  4JI2 E;  2KOU A;  3L00 A;  4JI7 E;  2YRM A;  2LO3 A;  4LFA E;  2B7T A;  2UU9 E;  1YYK A;  2UXB E;  1RQ0 A;  1SR9 A;  1BBO A;  1Z1B A;  2BB8 A;  5IWA E;  4AQY E;  2YTI A;  4BC9 A;  2EMX A;  2G7H A;  4TUI A;  5IXM B;  1NCS A;  2EMK A;  2RS7 A;  2ENC A;  3UK3 C;  4KHP E;  1X3C A;  1A1G A;  4R2R A;  2EN6 A;  2EPR A;  2WBT A;  1IBL E;  4WPY A;  1XNR E;  2KON A;  1N32 E;  1KJK A;  2HGH A;  1A1J A;  3HTX A;  2ZM6 E;  2GHF A;  4DV4 E;  1HNW E;  2YSO A;  4X64 E;  4DV3 E;  1J5E E;  2YTG A;  1GQE A;  1TF3 A;  2DB2 A;  4BC7 A;  1YZ9 A;  2ADR A;  4LF5 E;  1IQS A;  1PJQ A;  2JR1 A;  3ADI A;  1DQ3 A;  1N34 E;  2EM8 A;  2VQE E;  1STU A;  1XMQ E;  5KL4 A;  4R2E A;  1X47 A;  2NUF A;  1B69 A;  1EH6 A;  4BS9 A;  2YRK A;  5BR8 E;  1GTK A;  1YFH A;  2EL5 A;  5AAS A;  1XNQ E;  5FLX C;  1YSA C;  1TF6 A;  2RSM A;  1QU6 A;  5AC4 A;  3RMP A;  4JI0 E;  4IJD A;  1EKZ A;  2V89 A;  4O24 A;  4X8W A;  1T4L B;  2EOM A;  2UUB E;  2EM0 A;  2L3J A;  4BCA A;  2HHH E;  4M0V A;  1EH8 A;  2JWO A;  1IBM E;  4OOG C;  2EMB A;  4BBY A;  4JI1 E;  4YY3 E;  2HJJ A;  2LUP B;  3EPK A;  2EOO A;  5KL2 A;  2EPK X;  4X9J A;  2YTE A;  3M99 B;  4JYA E;  1A1K A;  2EMY A;  4WSG A;  2LTS A;  3J7A G;  2V88 A;  1G2F C;  2YWQ A;  4M9V C;  4LFB E;  4DR7 E;  4F6N A;  2F8B A;  4LF6 E;  2EMG A;  2NA2 A;  2V86 A;  2LJH A;  2YPN A;  2LE2 A;  3KWR A;  2YZT A;  2DRP A;  1WHQ A;  2EMF A;  3IWB A;  2JP9 A;  1J26 A;  1BBG A;  3OML A;  4DMI A;  3J81 C;  3AV0 A;  4JI3 E;  3HPS A;  2UUC E;  2B9D A;  2L3C A;  2N3H A;  4Q35 B;  2B7V A;  3DF6 A;  2R76 A;  1IBK E;  4BHC A;  4B3M E;  4IS1 C;  5LMN E;  4O5G A;  2WCC 3;  1N3G A;  2EPP A;  4F9A B;  2EOJ A;  3DJW A;  4HEI A;  3BGH A;  3HQ1 A;  4WX9 A;  1YYW A;  2PRT A;  4R2P A;  5TSE A;  4P78 A;  1UIL A;  2MKD A;  2JVA A;  3OTO E;  2EPU A;  3C4B A;  1MGT A;  2LV2 A;  2EN2 A;  2UXD E;  4R2D A;  3KZZ A;  1GZ6 A;  2EN4 A;  1FKA E;  3QG5 C;  4Q28 A;  1I94 E;  2L33 A;  1TN9 A;  1X5W A;  4LFC E;  2RSI A;  4WYQ B;  4NZV A;  3MHS C;  1IMU A;  3HPZ A;  2EOY A;  3J80 C;  4X65 E;  4B3S E;  2LCE A;  2V83 A;  2MC5 A;  3AUZ A;  3ECR A;  1LLM C;  4O43 A;  1PJT A;  4K0K E;  2EQ1 A;  2ENH A;  2EOH A;  2UXC E;  4B3T E;  2EN3 A;  4WXD A;  5LMU E;  1KYQ A;  2L2K B;  1F2I G;  4JI8 E;  3KZY A;  2EMI A;  2E5L E;  4L5N C;  2JXP A;  1EH7 A;  2CPN A;  1N33 E;  1L4S A;  4GKK E;  4GZN C;  4R2A A;  2VRD A;  3C4T A;  4JI4 E;  2DIX A;  2HC5 A;  4O4K A;  2JPA A;  2LUQ A;  3MSW A;  4BHB A;  2WBU A;  3P1X A;  2CTD A;  1T38 A;  2EN8 A;  4R8O A;  2YTP A;  1QNT A;  2H36 X;  5KL7 A;  2CT1 A;  1G2D C;  2KHX A;  2YTN A;  4ZYE A;  2EPC A;  2N3G A;  2EOF A;  4DR3 E;  5IV8 B;  1ZR9 A;  3VHT B;  2EJ4 A;  2FTX B;  5AE1 A;  1RC7 A;  1MEY C;  5AE2 A;  2LJU A;  4ZYG A;  1XMO E;  1X48 A;  1WHN A;  5A6B D;  4JV5 E;  2EOQ A;  5A6B A;  4R2S A;  3C6M A;  1ZAA C;  3LML A;  2RTX A;  2EPX A;  1PDA A;  1X6H A;  1ZU1 A;  4F2J C;  4LU9 A;  3MHH C;  2IHR 1;  3JTZ A;  1T4O A;  4JI5 E;  4DV6 E;  4ZYH A;  2DLQ A;  2JOX A;  2EQ3 A;  4LF8 E;  2EOR A;  2EMC A;  2RS6 A;  1ZBT A;  2EL4 A;  4DV5 E;  2EPM X;  4P7D A;  1UBD C;  2YTF A;  2YTJ A;  1WJP A;  2YTQ A;  3BBG A;  3EPH A;  2E72 A;  4LF4 E;  1T4N A;  4GEQ B;  2EQ0 A;  5CFF E;  2RQL A;  4F9C B;  2V8Q B;  2R1F A;  1AH5 A;  3IWC A;  4F6M A;  4M30 A;  3ZOQ B;  5KL5 A;  2EMA A;  1YYO A;  1DI2 A;  2Q8U A;  1N36 E;  3TQM A;  4MLV A;  2LMZ A;  4TUG A;  2DLK A;  3ADJ A;  2EM6 A;  3HXL A;  4OX9 E;  2EM2 A;  4HTG A;  5KL6 A;  5AC5 A;  2EM7 A;  2EM4 A;  2EPA A;  2YTD A;  4M2Z A;  3VYX A;  3JU0 A;  2LRS A;  2EN1 A;  2MDR A;  2JY9 A;  2ODR C;  4L8N A;  2DGC A;  2EML A;  4F9B B;  1HNZ E;  3K6Q A;  1DGC A;  4DUZ E;  1T39 A;  4WSP A;  3BF2 A;  2DMY A;  5A2Q C;  4DV1 E;  5IT9 C;  5A6A A;  3EPL A;  1YUJ A;  4N4R B;  2DSY A;  2DMI A;  2M1S A;  2NUE A;  3F6H A;  4RHB B;  2EPO A;  3IWD A;  2EMW A;  2L8T A;  3C6K A;  3BID A;  1NEI A;  2BBG A;  2A25 A;  2E1M A;  1SFE A;  3VYY A;  1UHZ A;  2LVH A;  2EMH A;  4BMJ A;  2WZO A;  2MC6 A;  2EPL X;  2RPC A;  4DV0 E;  2EOS A;  1JK1 A;  2MDG A;  2J7J A;  4KZS A;  5KL3 A;  1WXR A;  5T6J A;  2UUA E;  2YU5 A;  4NXN E;  3LLH A;  4LTY A;  1HR0 E;  2L2M A;  5F3W A;  4MLQ A;  2F4V E;  1PJS A;  2GPI A;  3H09 A;  4LF7 E;  2YT4 A;  3EPJ A;  2FV4 B;  2EZ6 A;  5ADZ A;  2N8X A;  1X6E A;  3ADG A;  5A69 A;  3JAM C;  4ZYD A;  1A1H A;  2ELZ A;  2I13 A;  5LLQ A;  1HNX E;  4F54 A;  2I9I A;  1YPN A;  2EL6 A;  3EQ1 A;  4J8Z A;  4DV2 E;  1P47 A;  1A1F A;  2EM5 A;  2EN7 A;  2EMZ A;  2LTR A;  4DR4 E;  1X6F A;  5DNY A;  2EP3 A;  4R2C A;  2EPN A;  4FK5 C;  1PKP A;  2GLI A;  2VE7 C;  4WFT A;  2VF1 A;  4R03 A;  3ADL A;  4DUY E;  4I8O A;  2ELY A;  4NHR A;  1JK2 A;  2WBS A;  2YRH A;  3THO B;  2EOI A;  2L92 A;  4JI6 E;  4X62 E;  4YHH E;  4B3R E;  4RH8 A;  2EOZ A;  2EWL A;  1YUI A;  3THN A;  5AE3 A;  2NAB A;  4DV7 E;  2D9H A;  2YU8 A;  2ODR D;  2LT7 A;  5A6J A;  2M4I A;  2EE8 A;  1ZBQ A;  5LL6 R;  2YSP A;  2JOB A;  2M9A A;  4X66 E;  2L2N A;  2VQF E;  2V85 A;  2EOX A;  4DR1 E;  4DR2 E;  2EM9 A;  1BB8 A;  2FGG A;  1A1L A;  4R2Q A;  4DKK A;  4LF9 E;  1UN6 B;  2CSH A;  1O0W A;  2JYA A;  3T1Y E;  3T1H E;  2NUG A;  4WXC A;  1RMD A;  2YTO A;  2K4V A; 
#chains in the Genus database with same CATH homology
 2M1S A;  4YY3 E;  4R8O A;  2LUP B;  2B3T B;  2NUE A;  3F6H A;  2H36 X;  2M7Q A;  3IWD A;  2LBS B;  2L8T A;  2KHX A;  3VK6 A;  3FIG A;  4DR5 E;  2N3G A;  4DR3 E;  4JYA E;  2E1M A;  3VYY A;  1UHZ A;  1X49 A;  2L6M A;  2LTS A;  2FTX B;  5AE1 A;  3J7A G;  4GKJ E;  2V88 A;  1RC7 A;  4BMJ A;  2WZO A;  2MC6 A;  4LFB E;  3F6G A;  4DR7 E;  4DR6 E;  4NXM E;  5AE2 A;  1XMO E;  4DV0 E;  1X48 A;  1WHN A;  2F8B A;  3J7Y p;  2V87 A;  4LF6 E;  1FJG E;  4JV5 E;  2NA2 A;  4KZS A;  4JI2 E;  2V86 A;  1WXR A;  2LJH A;  5T6J A;  2UUA E;  2KOU A;  2LE2 A;  4JI7 E;  4NXN E;  3KWR A;  2YZT A;  4LFA E;  2B7T A;  2UU9 E;  3LML A;  1YYK A;  3LLH A;  4LTY A;  1WHQ A;  2RTX A;  1RQ0 A;  2L2M A;  3IWB A;  1HR0 E;  1SR9 A;  3OML A;  4DMI A;  2UXB E;  1J26 A;  3J81 C;  5F3W A;  3AV0 A;  4JI3 E;  2F4V E;  5IWA E;  3HPS A;  4AQY E;  2UUC E;  2B9D A;  3H09 A;  2N3H A;  2L3C A;  2YT4 A;  4LU9 A;  4BC9 A;  4LF7 E;  2G7H A;  2IHR 1;  4TUI A;  2B7V A;  3DF6 A;  3JTZ A;  2FV4 B;  1T4O A;  1IBK E;  2EZ6 A;  2RS7 A;  5ADZ A;  4DV6 E;  3ADG A;  4JI5 E;  4B3M E;  4KHP E;  3JAM C;  5LMN E;  2JOX A;  4LF8 E;  4F9A B;  1IBL E;  3DJW A;  2RS6 A;  4WPY A;  2KON A;  1HNX E;  1N32 E;  1ZBT A;  1XNR E;  3HQ1 A;  4DV5 E;  4F54 A;  4P7D A;  1YYW A;  3HTX A;  2ZM6 E;  4DV2 E;  4J8Z A;  4P78 A;  1UIL A;  2LTR A;  4DV4 E;  4LF4 E;  2JVA A;  4DR4 E;  1T4N A;  4X64 E;  1HNW E;  4GEQ B;  3OTO E;  4DV3 E;  5CFF E;  1J5E E;  1GQE A;  2DB2 A;  3C4B A;  4BC7 A;  5DNY A;  4F9C B;  1YZ9 A;  2UXD E;  4LF5 E;  2JR1 A;  2V8Q B;  3ADI A;  3IWC A;  1PKP A;  4M30 A;  1DQ3 A;  2VE7 C;  1GZ6 A;  3ZOQ B;  2VQE E;  4WFT A;  1STU A;  2VF1 A;  4Q28 A;  4R03 A;  1XMQ E;  2L33 A;  1I94 E;  1FKA E;  1YYO A;  4DUY E;  4I8O A;  4JI1 E;  2DSY A;  1DI2 A;  1N36 E;  4LFC E;  4JI6 E;  2L92 A;  4WYQ B;  2LMZ A;  1X47 A;  4TUG A;  3ADJ A;  2NUF A;  3HXL A;  4OX9 E;  4X62 E;  4YHH E;  4B3R E;  3HPZ A;  2EWL A;  4BS9 A;  5BR8 E;  3J80 C;  5AE3 A;  4X65 E;  4B3S E;  2V83 A;  3AUZ A;  2MC5 A;  4DV7 E;  2UXC E;  4K0K E;  5AAS A;  1XNQ E;  5FLX C;  2ODR D;  2RSM A;  1QU6 A;  3RMP A;  2M4I A;  4JI0 E;  4M2Z A;  3VYX A;  3JU0 A;  1ZBQ A;  2LRS A;  2MDR A;  2JY9 A;  2ODR C;  4L8N A;  2JOB A;  5LL6 R;  5LMU E;  1EKZ A;  2V89 A;  4F9B B;  4X66 E;  4X8W A;  2L2N A;  2L2K B;  4JI8 E;  1T4L B;  2UUB E;  2VQF E;  1HNZ E;  3K6Q A;  2V85 A;  2E5L E;  4L5N C;  4DUZ E;  2L3J A;  4BCA A;  4DR1 E;  2CPN A;  4DR2 E;  2HHH E;  1N33 E;  4WSP A;  2FGG A;  4M0V A;  4B3T E;  3ADL A;  4GKK E;  2DMY A;  5A2Q C;  4DV1 E;  4DKK A;  5IT9 C;  3C4T A;  4JI4 E;  2DIX A;  4LF9 E;  2JWO A;  1IBM E;  1O0W A;  2LUQ A;  4OOG C;  3T1Y E;  3T1H E;  3MSW A;  2NUG A;  2K4V A;  3P1X A;  1N34 E;  4BBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...