2L2NA

Backbone 1h, 13c, and 15n chemical shift assignments for the first dsrbd of protein hyl1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
FKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hyponastic leave 1
publication title Structure and RNA Interactions of the Plant MicroRNA Processing-Associated Protein HYL1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein, plant protein
total genus 16
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2nA00
4B3RE 4OOGC 3ADJA 4GKJE 4NXNE 1YYOA 4WFTA 1PKPA 2UUBE 3LLHA 2NUEA 2MDRA 4X8WA 4LFAE 4LF6E 1X47A 1HNXE 1FKAE 2UUCE 2DB2A 4LF4E 4B3SE 2LBSB 4JI5E 4DV5E 4X65E 3ADLA 4GKKE 2KHXA 1IBME 3VYYA 2UXBE 4M2ZA 4JI2E 4OX9E 3HTXA 4DV2E 2NUGA 1QU6A 2IHR1 2JY9A 4DV4E 4DV7E 4DV3E 2NUFA 2B7TA 2RS6A 4LF8E 2L2KB 1T4OA 1YZ9A 2DMYA 2LJHA 1ZBTA 1I94E 3ADGA 3ADIA 1UHZA 4X66E 2CPNA 3P1XA 4B3ME 4AQYE 4JV5E 4NXME 4JI8E 1GQEA 2L2NA 4LFCE 3VYXA 4KHPE 1N36E 4JI3E 2E5LE 1O0WA 4DUYE 2RS7A 4LF9E 4DR3E 1N33E 4JI1E 4JI6E 2L3CA 1RQ0A 2YT4A 4DR2E 2RSMA 2HHHE 1HNWE 2UXDE 4DR6E 4DR7E 1WHQA 4DV1E 4DR4E 2VQFE 3C4TA 4JI0E 2LUPB 4WYQB 1EKZA 2RTXA 1DI2A 2L33A 3C4BA 1XNQE 4K0KE 4YY3E 4JYAE 1HNZE 2JVAA 4DUZE 5CFFE 4X62E 1UILA 1T4LB 2UU9E 1XNRE 4M30A 1X48A 4DR1E 3OTOE 2L2MA 5BR8E 1IBKE 1N34E 4DV6E 1HR0E 4DR5E 1FJGE 2NA2A 2LTRA 2N3GA 4JI4E 1STUA 5LMNE 2ZM6E 4X64E 2B7VA 2LUQA 1RC7A 3T1YE 2L3JA 1X49A 4LF5E 3T1HE 4YHHE 2LTSA 2UXCE 2DIXA 2LRSA 1J5EE 1YYKA 4DV0E 2UUAE 1N32E 1T4NA 4LF7E 1J26A 1IBLE 2B3TB 1XMOE 4DKKA 4JI7E 5LMUE 1XMQE 4B3TE 2VQEE 2EZ6A 2N3HA 1WHNA 1YYWA 4LFBE 2F4VE 3J7Yp 5IWAE
chains in the Genus database with same CATH superfamily
1SR9A 5A6BA 2EPXA 2V88A 3F6HA 5KL7A 3KWRA 2M1SA 2EOQA 1PKPA 2NUEA 1G2DC 1X47A 1HNXE 4R2EA 4B3SE 2J7JA 5FLXC 2EMZA 2EOMA 1IBME 3VYYA 5LL6R 3H09A 2BB8A 2YSOA 4KZSA 2EL6A 2R76A 1PJQA 2EMFA 2YTGA 2YTOA 2MC6A 2RS6A 4LF8E 1YSAC 2N8XA 1ZBTA 3L00A 1WJPA 3ADGA 4NZVA 1UHZA 4WX9A 2E1MA 4AQYE 3THOB 2JOXA 2LO3A 1N36E 2Q8UA 1ZU1A 4DUYE 2EMLA 4JI1E 1MEYC 2DMIA 2YT4A 2RSMA 2EM6A 4X9JA 4DR6E 5KL4A 5IV8B 2VQFE 2LUPB 4WSPA 2A25A 2ENAA 1AH5A 3C4BA 1AAYA 4JYAE 1HNZE 2DLQA 2EMAA 4X62E 5IXMB 5AC4A 2EMIA 2EOZA 3OTOE 2EMBA 2EP3A 4F6NA 5BR8E 2D9HA 1EH7A 4F6MA 1HR0E 1FJGE 1MGTA 1A1GA 2V87A 3IWBA 2LTRA 1IQSA 2CSHA 3T1YE 4LF5E 1EH6A 2LV2A 4R03A 2RSIA 2ODRD 1J26A 2B3TB 2EOOA 3HPZA 2LCEA 2EZ6A 4LFBE 1A1FA 3J7Yp 1JK2A 5A6KA 4R2DA 4B3RE 2EOEA 4P78A 2EM5A 4WPYA 3ADJA 3JAMC 4GKJE 4NXNE 2EMWA 1TF3A 3J80C 1ZR9A 4WFTA 5A2QC 2EM7A 2UUBE 3LLHA 2VRDA 2EL5A 2V86A 3AV0A 2JYAA 4BC9A 4LFAE 2I13A 1X5WA 2UUCE 2EPOA 2LJUA 2YTEA 4BMJA 3JU0A 5AE1A 2YTQA 4GKKE 2B9DA 4I8OA 2V89A 2VF1A 5KL2A 4OX9E 3HTXA 5A6BD 1B69A 4DV2E 2NUGA 2EPUA 2IHR1 4DV4E 4DV7E 4DV3E 2EPZA 2KONA 2YRMA 3F6GA 3EPLA 2NUFA 1Z1BA 4WXCA 3KZYA 1YZ9A 2DMYA 4F9BB 3EPHA 3ADIA 1PDAA 4X66E 3VK6A 4B3ME 4ZYHA 3C6MA 3EPJA 4GZNC 4R2SA 2EM0A 2YZTA 4LF9E 3MHSC 2ELZA 1NEIA 4JI6E 2JOBA 1X3CA 1HNWE 2DLKA 2HGHA 2EMGA 2EN7A 5DNYA 3C4TA 4DV1E 4DR4E 1ZBQA 4J8ZA 2WCC3 2GHFA 2VE7C 3UK3C 4IS1C 5A6JA 1QNTA 5AASA 1DI2A 2M7QA 2YTNA 1XNQE 2G7HA 2WBSA 2GLIA 1A1IA 2LT7A 1T4LB 2UU9E 1DGCA 2L8TA 2V83A 2WZOA 4WSGA 2L2MA 2MC5A 2YRKA 1IBKE 2KOUA 2M4IA 1X6HA 1T39A 4R2AA 5LMNE 4BC7A 1RC7A 2H36X 3IWCA 2L3JA 2ODRC 5ADZA 2EN4A 2LTSA 2UXCE 2DSYA 2E72A 2EL4A 1J5EE 2UUAE 1N32E 1IMUA 2EORA 1XMOE 1JK1A 5T6JA 5LMUE 3EQ1A 3DF6A 4BCAA 2VQEE 3TQMA 4TUGA 5AE2A 2EMXA 4GEQB 5F3WA 2EE8A 2N3HA 3M99B 1YPNA 4M0VA 2F4VE 5IT9C 2LMZA 1ZAAC 4R2RA 1YYOA 4R2QA 4HTGA 2EQ1A 2EM8A 3C6KA 1BBGA 3HPSA 1NCSA 2DB2A 4RH8A 3BGHA 2LBSB 2MKNA 2L92A 2EM3A 4O24A 3K6QA 4M9VC 2KHXA 2ELYA 2UXBE 4M2ZA 1BBOA 4NHRA 2FGGA 2YTFA 2MKDA 2JY9A 4MLQA 2LVHA 4BS9A 5A69A 2YTPA 2B7TA 2JWOA 2V85A 5KL5A 1T4OA 4N4RB 1SFEA 2LJHA 4BHBA 1A1LA 2JR1A 2CPNA 4O5GA 4JV5E 1L4SA 4RHBB 4JI8E 1GQEA 2L2NA 4R2PA 4LFCE 4KHPE 2K7IA 3MSWA 2EPPA 2EPMX 4F9CB 1WXRA 1O0WA 2RS7A 4DR3E 1N33E 2EJ4A 2CT1A 3QG5C 1TN9A 2UXDE 3ECRA 2ADRA 2DRPA 1WHQA 3HQ1A 2FTXB 2EM9A 2L6MA 4JI0E 4WYQB 1EKZA 2HJJA 2RTXA 5AC5A 2BBGA 2EPLX 3BIDA 2EN8A 3MHHC 4F9AB 3VHTB 4YY3E 2EMCA 2YRHA 2JVAA 4FK5C 1TF6A 4DUZE 4MLVA 2EQ0A 5KL6A 1IQOA 2EMHA 1X48A 4BHCA 1YUIA 2RQLA 2EMKA 1PJTA 4DMIA 2YPNA 2WBUA 1N34E 4DR5E 2NA2A 4IJDA 1GZ6A 2EOYA 2N3GA 5LLQA 2EN1A 3BF2A 1STUA 2EOJA 4X64E 2B7VA 4L5NC 1N3GA 5AE3A 1UBDC 2EPRA 3T1HE 4YHHE 3IWDA 2DIXA 2LRSA 2I9IA 1YYKA 4DV0E 1A1KA 4LF7E 1YFHA 2PRTA 2JP9A 4BBYA 1DQ3A 2V8QB 4R8OA 3EPKA 2YTDA 3ZOQB 3THNA 4ZYEA 3BBGA 4OOGC 1PJSA 1YUJA 1A1JA 2EPKX 2EWLA 2EQ3A 2JPAA 4TUIA 3AUZA 5KL3A 1LLMC 2YTJA 2MDRA 2R1FA 4P7DA 4X8WA 4F54A 1WRJA 4LF6E 4KWYA 2K4VA 1P47A 2EPAA 3J81C 1FKAE 4LF4E 4JI5E 4DV5E 4X65E 3ADLA 2EN6A 4R2CA 4JI2E 3KZZA 4ZYGA 4O43A 1QU6A 2GPIA 4F2JC 1X6FA 1X6EA 3OMLA 4LU9A 2L2KB 1F2IG 4Q35B 4ZYDA 1I94E 2JXPA 1GTKA 3P1XA 1T38A 5A6AA 4NXME 2YU5A 3VYXA 4JI3E 2E5LE 4LTYA 2L3CA 1RQ0A 4DR2E 2HHHE 4DR7E 2MDGA 1KYQA 3J7AG 2L33A 4K0KE 4WXDA 2M9AA 1KJKA 2WBTA 5CFFE 2YWQA 4Q28A 2DGCA 3FIGA 1UILA 2YTIA 2EOSA 1XNRE 4M30A 4DR1E 4L8NA 2EMYA 4O4KA 3LMLA 2EN2A 4DV6E 2EM2A 2EPCA 3RMPA 2ENCA 4JI4E 2ZM6E 1A1HA 2LUQA 1UN6B 4HEIA 1X49A 1BB8A 2HC5A 2EOHA 1T4NA 2YU8A 2ENHA 1IBLE 2YSPA 2F8BA 1G2FC 4DKKA 1EH8A 4JI7E 2EM4A 2LE2A 2EOFA 1XMQE 4B3TE 2RPCA 2EPNA 1RMDA 2EOIA 2EN3A 2EOXA 1WHNA 1YYWA 2NABA 2FV4B 5TSEA 3HXLA 3DJWA 2CTDA 3JTZA 5IWAE
chains in the Genus database with same CATH topology
1SR9A 2LMZA 3ZOQB 4B3RE 4P78A 2V88A 4OOGC 3F6HA 4WPYA 3ADJA 3JAMC 4GKJE 2EWLA 3KWRA 4NXNE 3J80C 2M1SA 1YYOA 4TUIA 4WFTA 3AUZA 5A2QC 1PKPA 2UUBE 3LLHA 2NUEA 2V86A 3AV0A 2MDRA 3HPSA 4P7DA 4X8WA 4BC9A 4F54A 4LFAE 4LF6E 1X47A 1HNXE 2K4VA 1FKAE 2UUCE 2DB2A 3J81C 4LF4E 4B3SE 2LBSB 4JI5E 4DV5E 4X65E 2L92A 5FLXC 4BMJA 3JU0A 3ADLA 5AE1A 3K6QA 4GKKE 2KHXA 2B9DA 3VYYA 1IBME 5LL6R 2UXBE 4I8OA 4M2ZA 2V89A 3J7Yp 2VF1A 4JI2E 4OX9E 3H09A 3HTXA 2FGGA 4DV2E 2NUGA 1QU6A 4KZSA 2IHR1 2JY9A 4DV4E 4DV7E 4DV3E 4BS9A 2KONA 3F6GA 2MC6A 2NUFA 2B7TA 2JWOA 2RS6A 2V85A 4LF8E 3OMLA 2L2KB 1T4OA 4LU9A 4DR4E 1YZ9A 2DMYA 4F9BB 2LJHA 1ZBTA 1I94E 3ADGA 3ADIA 1UHZA 4X66E 2JR1A 2CPNA 2E1MA 3P1XA 3VK6A 4AQYE 4B3ME 4NXME 4JV5E 2JOXA 1GQEA 2L2NA 4JI8E 4LFCE 3VYXA 3MSWA 1N36E 4KHPE 4F9CB 1WXRA 2YZTA 1O0WA 4LTYA 2RS7A 4DUYE 4DR3E 2E5LE 4JI3E 4JI1E 4LF9E 1N33E 4JI6E 2L3CA 1RQ0A 2YT4A 4DR2E 2RSMA 2JOBA 2HHHE 1HNWE 2UXDE 4DR6E 4DR7E 1WHQA 3HQ1A 5DNYA 2FTXB 2L6MA 3C4TA 2VQFE 4DV1E 1ZBQA 4J8ZA 4WYQB 2RTXA 2VE7C 4WSPA 2LUPB 1EKZA 1DI2A 5AASA 3J7AG 2L33A 4F9AB 3C4BA 2M7QA 1XNQE 4K0KE 4YY3E 2G7HA 4JYAE 1HNZE 2JVAA 4DUZE 5CFFE 4Q28A 4X62E 3FIGA 1UILA 1T4LB 2UU9E 1XNRE 4M30A 1X48A 2L8TA 2V83A 2WZOA 3OTOE 4DR1E 2L2MA 2MC5A 4L8NA 5BR8E 4DMIA 3LMLA 1IBKE 1N34E 2KOUA 4DV6E 4DR5E 1HR0E 2NA2A 1FJGE 2V87A 2M4IA 3IWBA 2LTRA 1GZ6A 2N3GA 3RMPA 4JI4E 1STUA 5LMNE 2ZM6E 4X64E 2B7VA 2LUQA 4BC7A 1RC7A 3T1YE 2H36X 3IWCA 4L5NC 1X49A 2ODRC 5AE3A 2L3JA 4LF5E 3T1HE 5ADZA 3IWDA 4YHHE 2LTSA 2UXCE 2DIXA 2DSYA 2LRSA 4R03A 1J5EE 1YYKA 4DV0E 2ODRD 2UUAE 1T4NA 4LF7E 1N32E 1IBLE 1J26A 2B3TB 1XMOE 5T6JA 2F8BA 4DKKA 4JI7E 5LMUE 3HPZA 2LE2A 3DF6A 1XMQE 4BCAA 4BBYA 2VQEE 4B3TE 1DQ3A 4TUGA 5AE2A 2EZ6A 4GEQB 4JI0E 2V8QB 4R8OA 2N3HA 1WHNA 1YYWA 4M0VA 4LFBE 2F4VE 2FV4B 3HXLA 3DJWA 5F3WA 3JTZA 5IT9C 5IWAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R E;  4OOG C;  3ADJ A;  4GKJ E;  4NXN E;  1YYO A;  4WFT A;  1PKP A;  2UUB E;  3LLH A;  2NUE A;  2MDR A;  4X8W A;  4LFA E;  4LF6 E;  1X47 A;  1HNX E;  1FKA E;  2UUC E;  2DB2 A;  4LF4 E;  4B3S E;  2LBS B;  4JI5 E;  4DV5 E;  4X65 E;  3ADL A;  4GKK E;  2KHX A;  1IBM E;  3VYY A;  2UXB E;  4M2Z A;  4JI2 E;  4OX9 E;  3HTX A;  4DV2 E;  2NUG A;  1QU6 A;  2IHR 1;  2JY9 A;  4DV4 E;  4DV7 E;  4DV3 E;  2NUF A;  2B7T A;  2RS6 A;  4LF8 E;  2L2K B;  1T4O A;  1YZ9 A;  2DMY A;  2LJH A;  1ZBT A;  1I94 E;  3ADG A;  3ADI A;  1UHZ A;  4X66 E;  2CPN A;  3P1X A;  4B3M E;  4AQY E;  4JV5 E;  4NXM E;  4JI8 E;  1GQE A;  2L2N A;  4LFC E;  3VYX A;  4KHP E;  1N36 E;  4JI3 E;  2E5L E;  1O0W A;  4DUY E;  2RS7 A;  4LF9 E;  4DR3 E;  1N33 E;  4JI1 E;  4JI6 E;  2L3C A;  1RQ0 A;  2YT4 A;  4DR2 E;  2RSM A;  2HHH E;  1HNW E;  2UXD E;  4DR6 E;  4DR7 E;  1WHQ A;  4DV1 E;  4DR4 E;  2VQF E;  3C4T A;  4JI0 E;  2LUP B;  4WYQ B;  1EKZ A;  2RTX A;  1DI2 A;  2L33 A;  3C4B A;  1XNQ E;  4K0K E;  4YY3 E;  4JYA E;  1HNZ E;  2JVA A;  4DUZ E;  5CFF E;  4X62 E;  1UIL A;  1T4L B;  2UU9 E;  1XNR E;  4M30 A;  1X48 A;  4DR1 E;  3OTO E;  2L2M A;  5BR8 E;  1IBK E;  1N34 E;  4DV6 E;  1HR0 E;  4DR5 E;  1FJG E;  2NA2 A;  2LTR A;  2N3G A;  4JI4 E;  1STU A;  5LMN E;  2ZM6 E;  4X64 E;  2B7V A;  2LUQ A;  1RC7 A;  3T1Y E;  2L3J A;  1X49 A;  4LF5 E;  3T1H E;  4YHH E;  2LTS A;  2UXC E;  2DIX A;  2LRS A;  1J5E E;  1YYK A;  4DV0 E;  2UUA E;  1N32 E;  1T4N A;  4LF7 E;  1J26 A;  1IBL E;  2B3T B;  1XMO E;  4DKK A;  4JI7 E;  5LMU E;  1XMQ E;  4B3T E;  2VQE E;  2EZ6 A;  2N3H A;  1WHN A;  1YYW A;  4LFB E;  2F4V E;  3J7Y p;  5IWA E; 
#chains in the Genus database with same CATH topology
 1SR9 A;  5A6B A;  2EPX A;  2V88 A;  3F6H A;  5KL7 A;  3KWR A;  2M1S A;  2EOQ A;  1PKP A;  2NUE A;  1G2D C;  1X47 A;  1HNX E;  4R2E A;  4B3S E;  2J7J A;  5FLX C;  2EMZ A;  2EOM A;  1IBM E;  3VYY A;  5LL6 R;  3H09 A;  2BB8 A;  2YSO A;  4KZS A;  2EL6 A;  2R76 A;  1PJQ A;  2EMF A;  2YTG A;  2YTO A;  2MC6 A;  2RS6 A;  4LF8 E;  1YSA C;  2N8X A;  1ZBT A;  3L00 A;  1WJP A;  3ADG A;  4NZV A;  1UHZ A;  4WX9 A;  2E1M A;  4AQY E;  3THO B;  2JOX A;  2LO3 A;  1N36 E;  2Q8U A;  1ZU1 A;  4DUY E;  2EML A;  4JI1 E;  1MEY C;  2DMI A;  2YT4 A;  2RSM A;  2EM6 A;  4X9J A;  4DR6 E;  5KL4 A;  5IV8 B;  2VQF E;  2LUP B;  4WSP A;  2A25 A;  2ENA A;  1AH5 A;  3C4B A;  1AAY A;  4JYA E;  1HNZ E;  2DLQ A;  2EMA A;  4X62 E;  5IXM B;  5AC4 A;  2EMI A;  2EOZ A;  3OTO E;  2EMB A;  2EP3 A;  4F6N A;  5BR8 E;  2D9H A;  1EH7 A;  4F6M A;  1HR0 E;  1FJG E;  1MGT A;  1A1G A;  2V87 A;  3IWB A;  2LTR A;  1IQS A;  2CSH A;  3T1Y E;  4LF5 E;  1EH6 A;  2LV2 A;  4R03 A;  2RSI A;  2ODR D;  1J26 A;  2B3T B;  2EOO A;  3HPZ A;  2LCE A;  2EZ6 A;  4LFB E;  1A1F A;  3J7Y p;  1JK2 A;  5A6K A;  4R2D A;  4B3R E;  2EOE A;  4P78 A;  2EM5 A;  4WPY A;  3ADJ A;  3JAM C;  4GKJ E;  4NXN E;  2EMW A;  1TF3 A;  3J80 C;  1ZR9 A;  4WFT A;  5A2Q C;  2EM7 A;  2UUB E;  3LLH A;  2VRD A;  2EL5 A;  2V86 A;  3AV0 A;  2JYA A;  4BC9 A;  4LFA E;  2I13 A;  1X5W A;  2UUC E;  2EPO A;  2LJU A;  2YTE A;  4BMJ A;  3JU0 A;  5AE1 A;  2YTQ A;  4GKK E;  2B9D A;  4I8O A;  2V89 A;  2VF1 A;  5KL2 A;  4OX9 E;  3HTX A;  5A6B D;  1B69 A;  4DV2 E;  2NUG A;  2EPU A;  2IHR 1;  4DV4 E;  4DV7 E;  4DV3 E;  2EPZ A;  2KON A;  2YRM A;  3F6G A;  3EPL A;  2NUF A;  1Z1B A;  4WXC A;  3KZY A;  1YZ9 A;  2DMY A;  4F9B B;  3EPH A;  3ADI A;  1PDA A;  4X66 E;  3VK6 A;  4B3M E;  4ZYH A;  3C6M A;  3EPJ A;  4GZN C;  4R2S A;  2EM0 A;  2YZT A;  4LF9 E;  3MHS C;  2ELZ A;  1NEI A;  4JI6 E;  2JOB A;  1X3C A;  1HNW E;  2DLK A;  2HGH A;  2EMG A;  2EN7 A;  5DNY A;  3C4T A;  4DV1 E;  4DR4 E;  1ZBQ A;  4J8Z A;  2WCC 3;  2GHF A;  2VE7 C;  3UK3 C;  4IS1 C;  5A6J A;  1QNT A;  5AAS A;  1DI2 A;  2M7Q A;  2YTN A;  1XNQ E;  2G7H A;  2WBS A;  2GLI A;  1A1I A;  2LT7 A;  1T4L B;  2UU9 E;  1DGC A;  2L8T A;  2V83 A;  2WZO A;  4WSG A;  2L2M A;  2MC5 A;  2YRK A;  1IBK E;  2KOU A;  2M4I A;  1X6H A;  1T39 A;  4R2A A;  5LMN E;  4BC7 A;  1RC7 A;  2H36 X;  3IWC A;  2L3J A;  2ODR C;  5ADZ A;  2EN4 A;  2LTS A;  2UXC E;  2DSY A;  2E72 A;  2EL4 A;  1J5E E;  2UUA E;  1N32 E;  1IMU A;  2EOR A;  1XMO E;  1JK1 A;  5T6J A;  5LMU E;  3EQ1 A;  3DF6 A;  4BCA A;  2VQE E;  3TQM A;  4TUG A;  5AE2 A;  2EMX A;  4GEQ B;  5F3W A;  2EE8 A;  2N3H A;  3M99 B;  1YPN A;  4M0V A;  2F4V E;  5IT9 C;  2LMZ A;  1ZAA C;  4R2R A;  1YYO A;  4R2Q A;  4HTG A;  2EQ1 A;  2EM8 A;  3C6K A;  1BBG A;  3HPS A;  1NCS A;  2DB2 A;  4RH8 A;  3BGH A;  2LBS B;  2MKN A;  2L92 A;  2EM3 A;  4O24 A;  3K6Q A;  4M9V C;  2KHX A;  2ELY A;  2UXB E;  4M2Z A;  1BBO A;  4NHR A;  2FGG A;  2YTF A;  2MKD A;  2JY9 A;  4MLQ A;  2LVH A;  4BS9 A;  5A69 A;  2YTP A;  2B7T A;  2JWO A;  2V85 A;  5KL5 A;  1T4O A;  4N4R B;  1SFE A;  2LJH A;  4BHB A;  1A1L A;  2JR1 A;  2CPN A;  4O5G A;  4JV5 E;  1L4S A;  4RHB B;  4JI8 E;  1GQE A;  2L2N A;  4R2P A;  4LFC E;  4KHP E;  2K7I A;  3MSW A;  2EPP A;  2EPM X;  4F9C B;  1WXR A;  1O0W A;  2RS7 A;  4DR3 E;  1N33 E;  2EJ4 A;  2CT1 A;  3QG5 C;  1TN9 A;  2UXD E;  3ECR A;  2ADR A;  2DRP A;  1WHQ A;  3HQ1 A;  2FTX B;  2EM9 A;  2L6M A;  4JI0 E;  4WYQ B;  1EKZ A;  2HJJ A;  2RTX A;  5AC5 A;  2BBG A;  2EPL X;  3BID A;  2EN8 A;  3MHH C;  4F9A B;  3VHT B;  4YY3 E;  2EMC A;  2YRH A;  2JVA A;  4FK5 C;  1TF6 A;  4DUZ E;  4MLV A;  2EQ0 A;  5KL6 A;  1IQO A;  2EMH A;  1X48 A;  4BHC A;  1YUI A;  2RQL A;  2EMK A;  1PJT A;  4DMI A;  2YPN A;  2WBU A;  1N34 E;  4DR5 E;  2NA2 A;  4IJD A;  1GZ6 A;  2EOY A;  2N3G A;  5LLQ A;  2EN1 A;  3BF2 A;  1STU A;  2EOJ A;  4X64 E;  2B7V A;  4L5N C;  1N3G A;  5AE3 A;  1UBD C;  2EPR A;  3T1H E;  4YHH E;  3IWD A;  2DIX A;  2LRS A;  2I9I A;  1YYK A;  4DV0 E;  1A1K A;  4LF7 E;  1YFH A;  2PRT A;  2JP9 A;  4BBY A;  1DQ3 A;  2V8Q B;  4R8O A;  3EPK A;  2YTD A;  3ZOQ B;  3THN A;  4ZYE A;  3BBG A;  4OOG C;  1PJS A;  1YUJ A;  1A1J A;  2EPK X;  2EWL A;  2EQ3 A;  2JPA A;  4TUI A;  3AUZ A;  5KL3 A;  1LLM C;  2YTJ A;  2MDR A;  2R1F A;  4P7D A;  4X8W A;  4F54 A;  1WRJ A;  4LF6 E;  4KWY A;  2K4V A;  1P47 A;  2EPA A;  3J81 C;  1FKA E;  4LF4 E;  4JI5 E;  4DV5 E;  4X65 E;  3ADL A;  2EN6 A;  4R2C A;  4JI2 E;  3KZZ A;  4ZYG A;  4O43 A;  1QU6 A;  2GPI A;  4F2J C;  1X6F A;  1X6E A;  3OML A;  4LU9 A;  2L2K B;  1F2I G;  4Q35 B;  4ZYD A;  1I94 E;  2JXP A;  1GTK A;  3P1X A;  1T38 A;  5A6A A;  4NXM E;  2YU5 A;  3VYX A;  4JI3 E;  2E5L E;  4LTY A;  2L3C A;  1RQ0 A;  4DR2 E;  2HHH E;  4DR7 E;  2MDG A;  1KYQ A;  3J7A G;  2L33 A;  4K0K E;  4WXD A;  2M9A A;  1KJK A;  2WBT A;  5CFF E;  2YWQ A;  4Q28 A;  2DGC A;  3FIG A;  1UIL A;  2YTI A;  2EOS A;  1XNR E;  4M30 A;  4DR1 E;  4L8N A;  2EMY A;  4O4K A;  3LML A;  2EN2 A;  4DV6 E;  2EM2 A;  2EPC A;  3RMP A;  2ENC A;  4JI4 E;  2ZM6 E;  1A1H A;  2LUQ A;  1UN6 B;  4HEI A;  1X49 A;  1BB8 A;  2HC5 A;  2EOH A;  1T4N A;  2YU8 A;  2ENH A;  1IBL E;  2YSP A;  2F8B A;  1G2F C;  4DKK A;  1EH8 A;  4JI7 E;  2EM4 A;  2LE2 A;  2EOF A;  1XMQ E;  4B3T E;  2RPC A;  2EPN A;  1RMD A;  2EOI A;  2EN3 A;  2EOX A;  1WHN A;  1YYW A;  2NAB A;  2FV4 B;  5TSE A;  3HXL A;  3DJW A;  2CTD A;  3JTZ A;  5IWA E; 
#chains in the Genus database with same CATH homology
 1SR9 A;  2LMZ A;  3ZOQ B;  4B3R E;  4P78 A;  2V88 A;  4OOG C;  3F6H A;  4WPY A;  3ADJ A;  3JAM C;  4GKJ E;  2EWL A;  3KWR A;  4NXN E;  3J80 C;  2M1S A;  1YYO A;  4TUI A;  4WFT A;  3AUZ A;  5A2Q C;  1PKP A;  2UUB E;  3LLH A;  2NUE A;  2V86 A;  3AV0 A;  2MDR A;  3HPS A;  4P7D A;  4X8W A;  4BC9 A;  4F54 A;  4LFA E;  4LF6 E;  1X47 A;  1HNX E;  2K4V A;  1FKA E;  2UUC E;  2DB2 A;  3J81 C;  4LF4 E;  4B3S E;  2LBS B;  4JI5 E;  4DV5 E;  4X65 E;  2L92 A;  5FLX C;  4BMJ A;  3JU0 A;  3ADL A;  5AE1 A;  3K6Q A;  4GKK E;  2KHX A;  2B9D A;  3VYY A;  1IBM E;  5LL6 R;  2UXB E;  4I8O A;  4M2Z A;  2V89 A;  3J7Y p;  2VF1 A;  4JI2 E;  4OX9 E;  3H09 A;  3HTX A;  2FGG A;  4DV2 E;  2NUG A;  1QU6 A;  4KZS A;  2IHR 1;  2JY9 A;  4DV4 E;  4DV7 E;  4DV3 E;  4BS9 A;  2KON A;  3F6G A;  2MC6 A;  2NUF A;  2B7T A;  2JWO A;  2RS6 A;  2V85 A;  4LF8 E;  3OML A;  2L2K B;  1T4O A;  4LU9 A;  4DR4 E;  1YZ9 A;  2DMY A;  4F9B B;  2LJH A;  1ZBT A;  1I94 E;  3ADG A;  3ADI A;  1UHZ A;  4X66 E;  2JR1 A;  2CPN A;  2E1M A;  3P1X A;  3VK6 A;  4AQY E;  4B3M E;  4NXM E;  4JV5 E;  2JOX A;  1GQE A;  2L2N A;  4JI8 E;  4LFC E;  3VYX A;  3MSW A;  1N36 E;  4KHP E;  4F9C B;  1WXR A;  2YZT A;  1O0W A;  4LTY A;  2RS7 A;  4DUY E;  4DR3 E;  2E5L E;  4JI3 E;  4JI1 E;  4LF9 E;  1N33 E;  4JI6 E;  2L3C A;  1RQ0 A;  2YT4 A;  4DR2 E;  2RSM A;  2JOB A;  2HHH E;  1HNW E;  2UXD E;  4DR6 E;  4DR7 E;  1WHQ A;  3HQ1 A;  5DNY A;  2FTX B;  2L6M A;  3C4T A;  2VQF E;  4DV1 E;  1ZBQ A;  4J8Z A;  4WYQ B;  2RTX A;  2VE7 C;  4WSP A;  2LUP B;  1EKZ A;  1DI2 A;  5AAS A;  3J7A G;  2L33 A;  4F9A B;  3C4B A;  2M7Q A;  1XNQ E;  4K0K E;  4YY3 E;  2G7H A;  4JYA E;  1HNZ E;  2JVA A;  4DUZ E;  5CFF E;  4Q28 A;  4X62 E;  3FIG A;  1UIL A;  1T4L B;  2UU9 E;  1XNR E;  4M30 A;  1X48 A;  2L8T A;  2V83 A;  2WZO A;  3OTO E;  4DR1 E;  2L2M A;  2MC5 A;  4L8N A;  5BR8 E;  4DMI A;  3LML A;  1IBK E;  1N34 E;  2KOU A;  4DV6 E;  4DR5 E;  1HR0 E;  2NA2 A;  1FJG E;  2V87 A;  2M4I A;  3IWB A;  2LTR A;  1GZ6 A;  2N3G A;  3RMP A;  4JI4 E;  1STU A;  5LMN E;  2ZM6 E;  4X64 E;  2B7V A;  2LUQ A;  4BC7 A;  1RC7 A;  3T1Y E;  2H36 X;  3IWC A;  4L5N C;  1X49 A;  2ODR C;  5AE3 A;  2L3J A;  4LF5 E;  3T1H E;  5ADZ A;  3IWD A;  4YHH E;  2LTS A;  2UXC E;  2DIX A;  2DSY A;  2LRS A;  4R03 A;  1J5E E;  1YYK A;  4DV0 E;  2ODR D;  2UUA E;  1T4N A;  4LF7 E;  1N32 E;  1IBL E;  1J26 A;  2B3T B;  1XMO E;  5T6J A;  2F8B A;  4DKK A;  4JI7 E;  5LMU E;  3HPZ A;  2LE2 A;  3DF6 A;  1XMQ E;  4BCA A;  4BBY A;  2VQE E;  4B3T E;  1DQ3 A;  4TUG A;  5AE2 A;  2EZ6 A;  4GEQ B;  4JI0 E;  2V8Q B;  4R8O A;  2N3H A;  1WHN A;  1YYW A;  4M0V A;  4LFB E;  2F4V E;  2FV4 B;  3HXL A;  3DJW A;  5F3W A;  3JTZ A;  5IT9 C;  5IWA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...