2L2NA

Backbone 1h, 13c, and 15n chemical shift assignments for the first dsrbd of protein hyl1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
71
structure length
71
Chain Sequence
FKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELAKSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and RNA Interactions of the Plant MicroRNA Processing-Associated Protein HYL1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein, plant protein
molecule keywords Hyponastic leave 1
total genus 16
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l2nA00
2DIXA 3C4TA 4WFTA 4B3SE 1XNRE 4DR3E 1T4OA 1IBLE 2JY9A 4B3RE 4X65E 2L3JA 1HNZE 1DI2A 4JI4E 1FKAE 1N34E 4DV6E 1N36E 2N3GA 1YYWA 2RS7A 4JI1E 2NA2A 4M30A 4JV5E 1O0WA 5CFFE 3VYYA 4X64E 1YYOA 1IBME 2KHXA 4NXNE 2LJHA 4DUYE 4DV4E 1EKZA 2UUCE 4DV3E 1WHQA 2HHHE 4LF6E 4DV0E 4DR5E 2UU9E 4M2ZA 4B3TE 4LFAE 4LFBE 1STUA 4DKKA 2EZ6A 3HTXA 4KHPE 4LFCE 1X47A 4OOGC 4JI2E 3P1XA 2N3HA 1WHNA 1QU6A 2ZM6E 3ADIA 2LUQA 2JVAA 1YYKA 3OTOE 1RC7A 4WYQB 1N33E 4YHHE 2DMYA 4B3ME 4DR1E 4DUZE 3LLHA 4DV5E 1GQEA 1N32E 4JI6E 4LF4E 3ADJA 2LTSA 4JI3E 4DR2E 4DV2E 1XNQE 2L33A 1J26A 2UXBE 4LF7E 2B7TA 4DR7E 5LMUE 1HR0E 5IWAE 3C4BA 4JYAE 2LBSB 1IBKE 3J7Yp 2RTXA 4JI0E 4OX9E 1PKPA 2RSMA 5LMNE 2B7VA 2YT4A 2IHR1 1UILA 1RQ0A 4X62E 2L3CA 2LUPB 1FJGE 2L2KB 4DV1E 2LTRA 4X8WA 1X48A 2B3TB 4DV7E 1UHZA 2UUAE 1X49A 3T1YE 4GKKE 1HNXE 2NUFA 2VQFE 3T1HE 1XMOE 4LF8E 4LF9E 2LRSA 2NUEA 2DB2A 2NUGA 2F4VE 1T4LB 4X66E 3VYXA 2CPNA 3ADGA 4DR6E 4K0KE 1ZBTA 4LF5E 2UUBE 4JI7E 4YY3E 2VQEE 1HNWE 1YZ9A 3ADLA 1J5EE 1T4NA 1XMQE 2E5LE 2L2MA 1I94E 4JI8E 4NXME 2UXDE 2UXCE 4DR4E 2RS6A 4GKJE 4AQYE 5BR8E 2L2NA 2MDRA 4JI5E
chains in the Genus database with same CATH superfamily
2RSIA 4WFTA 4O5GA 3VHTB 1IBLE 5LLQA 4B3RE 2YTPA 1DI2A 1G2DC 4JI4E 1T39A 4O4KA 2EWLA 3MSWA 2F8BA 1N36E 2EN7A 4WPYA 4JI1E 5KL2A 5KL4A 1BB8A 4JV5E 2R1FA 2MC5A 2EMGA 1PDAA 4ZYDA 2DLKA 2EPPA 2YWQA 2EMWA 4NZVA 1YSAC 2HHHE 4LF6E 2ODRC 2M4IA 2N8XA 1NCSA 2EZ6A 4LTYA 2EMIA 4BBYA 3C6KA 5AE3A 1WHNA 1EH7A 3HQ1A 2EM3A 2LUQA 2JVAA 2V8QB 1RC7A 2D9HA 3EQ1A 4WYQB 4YHHE 4DR1E 5IXMB 2EORA 4DUZE 4GZNC 4WXDA 1N32E 2LJUA 2EOEA 4JI6E 3ADJA 4DR2E 1XNQE 2L33A 1YUJA 5A2QC 2A25A 2VRDA 2B7TA 4DR7E 2MC6A 3TQMA 2GLIA 3J80C 2V88A 5AE1A 1GTKA 1IBKE 2EQ3A 4M0VA 3RMPA 1PKPA 2YT4A 2B7VA 4X62E 2IHR1 4J8ZA 2WBUA 2L2KB 4DV1E 1EH8A 2EPKX 4R2AA 1X48A 1X3CA 1UHZA 5LL6R 4GKKE 1X6EA 2VQFE 5FLXC 2B9DA 2EM2A 2DB2A 2DLQA 4X66E 2EOSA 2YU5A 1ZU1A 3ADGA 4K0KE 4R2QA 4KZSA 2YRKA 3L00A 4BMJA 4P78A 2E5LE 3H09A 2UXDE 3EPJA 2RS6A 4WSPA 2DSYA 4TUGA 2MDGA 2ELYA 3BGHA 4RHBB 4B3SE 1XNRE 4R03A 2M9AA 2EOZA 3ECRA 1WXRA 1TF6A 1NEIA 1A1JA 4IJDA 4X65E 4BCAA 4MLQA 3AV0A 3KZZA 2LVHA 3KWRA 5AE2A 2YTGA 2K7IA 4BS9A 5CFFE 5F3WA 3VYYA 1A1IA 2EL5A 4NXNE 2LJHA 3HXLA 3FIGA 1PJSA 1WHQA 4F9BB 2RPCA 4M2ZA 2EN2A 5A69A 2EMHA 4DKKA 3HTXA 4LFCE 2V89A 1GZ6A 1IQOA 1YYKA 4ZYGA 3OTOE 1N33E 4RH8A 2EPZA 1IMUA 1JK2A 3LLHA 4DV5E 2LO3A 2E1MA 2FTXB 4BHCA 4FK5C 4DV2E 1ZAAC 1BBGA 2UXBE 2BBGA 4LF7E 4X9JA 3MHHC 1A1GA 5IWAE 2YSPA 3C4BA 5A6AA 1F2IG 2EP3A 4M9VC 3AUZA 2EOQA 2EMLA 2L3CA 4MLVA 3IWCA 1FJGE 2LTRA 2YTIA 4X8WA 2EMBA 2EL4A 3KZYA 1X49A 2V83A 2LMZA 1XMOE 2GHFA 2NUEA 2WCC3 4R2DA 3THOB 2EPOA 1T4LB 2V85A 2ENAA 4P7DA 4R2EA 4LF5E 1PJQA 2LV2A 2VQEE 1AAYA 3JAMC 1SFEA 1DGCA 1I94E 5KL7A 2UXCE 2EM4A 4DR4E 2LE2A 2YU8A 2EMAA 5BR8E 2EM9A 2L2NA 5A6BA 3T1HE 2VF1A 4JI5E 2EOFA 2ELZA 4BHBA 4R2SA 2L8TA 1YFHA 2RQLA 5AC5A 4DR3E 3BF2A 2L3JA 4R8OA 1FKAE 4L8NA 1N34E 4DV6E 2N3GA 5AASA 3DF6A 3EPKA 4F6MA 1YYWA 2RS7A 2NA2A 5A6KA 4R2CA 1A1LA 1LLMC 4HTGA 1O0WA 3F6HA 4NHRA 5T6JA 2KHXA 5KL6A 5DNYA 4DUYE 1EKZA 2UUCE 2DGCA 4DV3E 1Z1BA 4DV0E 4DR5E 2UU9E 2EPCA 1DQ3A 2JYAA 1JK1A 4LFAE 2I9IA 2KONA 4LFBE 1STUA 1RMDA 2EN3A 1X47A 4OOGC 2EOMA 1QU6A 3ADIA 5KL3A 1ZR9A 2EMCA 3THNA 2YTNA 2DMYA 2K4VA 5A6BD 1EH6A 2EPNA 3J7AG 2EOXA 4LF4E 2LTSA 2EPLX 4R2RA 1J26A 2EQ1A 2ENCA 2EPUA 2FV4B 2YRMA 2DRPA 3M99B 1IQSA 2YRHA 1A1HA 2LBSB 2EOIA 1AH5A 2RTXA 4JI0E 4OX9E 2WBTA 2RSMA 5LMNE 1UBDC 1UILA 2EM0A 2YSOA 4L5NC 1ZBQA 5TSEA 2UUAE 4KWYA 4BC9A 2KOUA 1P47A 1HNXE 2L92A 2NUFA 2EMZA 2YTFA 2M1SA 2ENHA 4LF9E 2LRSA 2Q8UA 2HC5A 2F4VE 2M7QA 3VYXA 4ZYHA 5KL5A 5IV8B 3VK6A 2EOOA 4N4RB 3UK3C 1B69A 1YZ9A 4ZYEA 3ADLA 4R2PA 1X6FA 1J5EE 3IWDA 1XMQE 2L2MA 1X5WA 4JI8E 4NXME 3ZOQB 4HEIA 4O43A 1QNTA 4IS1C 2PRTA 4AQYE 2MDRA 3JTZA 2YTDA 2DIXA 3C4TA 3HPZA 2JPAA 2JOXA 4Q35B 2I13A 2GPIA 3QG5C 3BIDA 1X6HA 1A1FA 2EPMX 1T4OA 2JY9A 1HNZE 1MEYC 2NABA 2R76A 2J7JA 2EL6A 1L4SA 2G7HA 2HJJA 4F9CB 2V87A 2CSHA 1TF3A 4F2JC 1A1KA 1G2FC 2EPRA 4M30A 2HGHA 4F9AB 4F54A 3EPHA 2EMFA 1WJPA 4X64E 1YYOA 1IBME 2EN8A 2YTQA 3J81C 2EN1A 5A6JA 4DV4E 3K6QA 3LMLA 1BBOA 2YTOA 5AC4A 2YPNA 2EOJA 4B3TE 2EM7A 3HPSA 4TUIA 2H36X 2FGGA 2CTDA 4KHPE 2DMIA 4JI2E 3P1XA 4F6NA 2N3HA 2ZM6E 2BB8A 1SR9A 1T38A 1KJKA 3MHSC 2JXPA 4B3ME 2YTJA 2EN6A 2EPAA 1GQEA 2ADRA 3IWBA 3BBGA 3EPLA 4JI3E 4I8OA 5ADZA 2EPXA 3DJWA 2VE7C 3F6GA 4LU9A 1N3GA 2EJ4A 1WRJA 2ODRD 5LMUE 2EOHA 1HR0E 4JYAE 3J7Yp 2JP9A 1YUIA 4DMIA 2EM8A 1RQ0A 2CT1A 2LUPB 2EMYA 2EOYA 4WXCA 2EE8A 2B3TB 2JR1A 4DV7E 2L6MA 2LT7A 1UN6B 3T1YE 2EM5A 1MGTA 4WSGA 5IT9C 2EM6A 4BC7A 2JOBA 4LF8E 2MKNA 4Q28A 2EN4A 1PJTA 4GEQB 2NUGA 3C6MA 2CPNA 2WBSA 1TN9A 4DR6E 1ZBTA 2UUBE 3OMLA 4JI7E 4YY3E 1HNWE 2EMKA 2YZTA 2V86A 4WX9A 1KYQA 1T4NA 2EMXA 2LCEA 2JWOA 4O24A 2MKDA 2EQ0A 1YPNA 3JU0A 4GKJE 2E72A 2YTEA 2WZOA
chains in the Genus database with same CATH topology
2DIXA 3C4TA 4WFTA 3HPZA 2L8TA 2JOXA 4B3SE 1XNRE 4R03A 1WXRA 4DR3E 1T4OA 1IBLE 2JY9A 4B3RE 4X65E 2L3JA 1HNZE 1DI2A 4JI4E 4R8OA 1FKAE 4L8NA 4BCAA 1N34E 2EWLA 2G7HA 4DV6E 3MSWA 2F8BA 1N36E 2N3GA 3AV0A 4F9CB 3KWRA 5AASA 2V87A 3DF6A 4WPYA 1YYWA 2RS7A 4JI1E 2NA2A 4M30A 4JV5E 4F9AB 2MC5A 5AE2A 4F54A 1O0WA 4BS9A 3F6HA 5CFFE 5F3WA 3VYYA 4X64E 1YYOA 1IBME 5T6JA 3J81C 2KHXA 4NXNE 2LJHA 3HXLA 5DNYA 3FIGA 4DUYE 4DV4E 1EKZA 2UUCE 3K6QA 3LMLA 4DV3E 1WHQA 4F9BB 2HHHE 4LF6E 2ODRC 4DV0E 4DR5E 2UU9E 4M2ZA 1DQ3A 4B3TE 3HPSA 4LFAE 2KONA 4TUIA 2H36X 2M4IA 2FGGA 1STUA 4LFBE 4DKKA 2EZ6A 3HTXA 4KHPE 4LTYA 4LFCE 2V89A 1X47A 4BBYA 4OOGC 4JI2E 3P1XA 5AE3A 1GZ6A 2N3HA 1WHNA 1QU6A 2ZM6E 3HQ1A 3ADIA 2LUQA 2JVAA 1SR9A 1YYKA 2V8QB 3OTOE 1RC7A 4WYQB 1N33E 4YHHE 2DMYA 2K4VA 4B3ME 4DR1E 4DUZE 3LLHA 4DV5E 1GQEA 3J7AG 2E1MA 2FTXB 1N32E 3IWBA 4JI6E 4LF4E 3ADJA 2LTSA 4JI3E 4I8OA 4DV2E 4DR2E 1XNQE 5ADZA 2L33A 1J26A 3DJWA 2VE7C 5A2QC 3F6GA 4LU9A 2UXBE 4LF7E 2B7TA 2ODRD 4DR7E 2MC6A 5LMUE 2FV4B 1HR0E 5IWAE 3C4BA 3J80C 4JYAE 2V88A 5AE1A 2LBSB 1IBKE 3J7Yp 4M0VA 2RTXA 3RMPA 4JI0E 4OX9E 4DMIA 1PKPA 2RSMA 2B7VA 2YT4A 2IHR1 1UILA 3AUZA 1RQ0A 4J8ZA 4X62E 2L3CA 5LMNE 3IWCA 2LUPB 1FJGE 2L2KB 4DV1E 2LTRA 4L5NC 1ZBQA 4X8WA 1X48A 2B3TB 2JR1A 4DV7E 2L6MA 1UHZA 5LL6R 2UUAE 1X49A 3T1YE 4GKKE 4BC9A 2KOUA 1HNXE 2L92A 2NUFA 2V83A 2VQFE 5IT9C 3T1HE 2LMZA 2JOBA 4BC7A 2M1SA 5FLXC 1XMOE 4LF8E 4Q28A 2B9DA 2LRSA 4LF9E 2NUEA 2DB2A 4GEQB 2NUGA 2F4VE 1T4LB 2M7QA 4X66E 3VYXA 2CPNA 2V85A 3VK6A 3ADGA 4DR6E 4P7DA 4K0KE 1ZBTA 4LF5E 2UUBE 3OMLA 4KZSA 4JI7E 4YY3E 2VQEE 1HNWE 3JAMC 1YZ9A 2YZTA 2V86A 3ADLA 1J5EE 1T4NA 3IWDA 1XMQE 4BMJA 4P78A 2JWOA 2E5LE 3H09A 2L2MA 1I94E 4JI8E 4NXME 2UXDE 2UXCE 4DR4E 2RS6A 3JU0A 3ZOQB 4WSPA 2DSYA 2LE2A 4GKJE 4TUGA 4AQYE 5BR8E 2L2NA 2MDRA 3JTZA 2WZOA 2VF1A 4JI5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIX A;  3C4T A;  4WFT A;  4B3S E;  1XNR E;  4DR3 E;  1T4O A;  1IBL E;  2JY9 A;  4B3R E;  4X65 E;  2L3J A;  1HNZ E;  1DI2 A;  4JI4 E;  1FKA E;  1N34 E;  4DV6 E;  1N36 E;  2N3G A;  1YYW A;  2RS7 A;  4JI1 E;  2NA2 A;  4M30 A;  4JV5 E;  1O0W A;  5CFF E;  3VYY A;  4X64 E;  1YYO A;  1IBM E;  2KHX A;  4NXN E;  2LJH A;  4DUY E;  4DV4 E;  1EKZ A;  2UUC E;  4DV3 E;  1WHQ A;  2HHH E;  4LF6 E;  4DV0 E;  4DR5 E;  2UU9 E;  4M2Z A;  4B3T E;  4LFA E;  4LFB E;  1STU A;  4DKK A;  2EZ6 A;  3HTX A;  4KHP E;  4LFC E;  1X47 A;  4OOG C;  4JI2 E;  3P1X A;  2N3H A;  1WHN A;  1QU6 A;  2ZM6 E;  3ADI A;  2LUQ A;  2JVA A;  1YYK A;  3OTO E;  1RC7 A;  4WYQ B;  1N33 E;  4YHH E;  2DMY A;  4B3M E;  4DR1 E;  4DUZ E;  3LLH A;  4DV5 E;  1GQE A;  1N32 E;  4JI6 E;  4LF4 E;  3ADJ A;  2LTS A;  4JI3 E;  4DR2 E;  4DV2 E;  1XNQ E;  2L33 A;  1J26 A;  2UXB E;  4LF7 E;  2B7T A;  4DR7 E;  5LMU E;  1HR0 E;  5IWA E;  3C4B A;  4JYA E;  2LBS B;  1IBK E;  3J7Y p;  2RTX A;  4JI0 E;  4OX9 E;  1PKP A;  2RSM A;  5LMN E;  2B7V A;  2YT4 A;  2IHR 1;  1UIL A;  1RQ0 A;  4X62 E;  2L3C A;  2LUP B;  1FJG E;  2L2K B;  4DV1 E;  2LTR A;  4X8W A;  1X48 A;  2B3T B;  4DV7 E;  1UHZ A;  2UUA E;  1X49 A;  3T1Y E;  4GKK E;  1HNX E;  2NUF A;  2VQF E;  3T1H E;  1XMO E;  4LF8 E;  4LF9 E;  2LRS A;  2NUE A;  2DB2 A;  2NUG A;  2F4V E;  1T4L B;  4X66 E;  3VYX A;  2CPN A;  3ADG A;  4DR6 E;  4K0K E;  1ZBT A;  4LF5 E;  2UUB E;  4JI7 E;  4YY3 E;  2VQE E;  1HNW E;  1YZ9 A;  3ADL A;  1J5E E;  1T4N A;  1XMQ E;  2E5L E;  2L2M A;  1I94 E;  4JI8 E;  4NXM E;  2UXD E;  2UXC E;  4DR4 E;  2RS6 A;  4GKJ E;  4AQY E;  5BR8 E;  2L2N A;  2MDR A;  4JI5 E; 
#chains in the Genus database with same CATH topology
 2RSI A;  4WFT A;  4O5G A;  3VHT B;  1IBL E;  5LLQ A;  4B3R E;  2YTP A;  1DI2 A;  1G2D C;  4JI4 E;  1T39 A;  4O4K A;  2EWL A;  3MSW A;  2F8B A;  1N36 E;  2EN7 A;  4WPY A;  4JI1 E;  5KL2 A;  5KL4 A;  1BB8 A;  4JV5 E;  2R1F A;  2MC5 A;  2EMG A;  1PDA A;  4ZYD A;  2DLK A;  2EPP A;  2YWQ A;  2EMW A;  4NZV A;  1YSA C;  2HHH E;  4LF6 E;  2ODR C;  2M4I A;  2N8X A;  1NCS A;  2EZ6 A;  4LTY A;  2EMI A;  4BBY A;  3C6K A;  5AE3 A;  1WHN A;  1EH7 A;  3HQ1 A;  2EM3 A;  2LUQ A;  2JVA A;  2V8Q B;  1RC7 A;  2D9H A;  3EQ1 A;  4WYQ B;  4YHH E;  4DR1 E;  5IXM B;  2EOR A;  4DUZ E;  4GZN C;  4WXD A;  1N32 E;  2LJU A;  2EOE A;  4JI6 E;  3ADJ A;  4DR2 E;  1XNQ E;  2L33 A;  1YUJ A;  5A2Q C;  2A25 A;  2VRD A;  2B7T A;  4DR7 E;  2MC6 A;  3TQM A;  2GLI A;  3J80 C;  2V88 A;  5AE1 A;  1GTK A;  1IBK E;  2EQ3 A;  4M0V A;  3RMP A;  1PKP A;  2YT4 A;  2B7V A;  4X62 E;  2IHR 1;  4J8Z A;  2WBU A;  2L2K B;  4DV1 E;  1EH8 A;  2EPK X;  4R2A A;  1X48 A;  1X3C A;  1UHZ A;  5LL6 R;  4GKK E;  1X6E A;  2VQF E;  5FLX C;  2B9D A;  2EM2 A;  2DB2 A;  2DLQ A;  4X66 E;  2EOS A;  2YU5 A;  1ZU1 A;  3ADG A;  4K0K E;  4R2Q A;  4KZS A;  2YRK A;  3L00 A;  4BMJ A;  4P78 A;  2E5L E;  3H09 A;  2UXD E;  3EPJ A;  2RS6 A;  4WSP A;  2DSY A;  4TUG A;  2MDG A;  2ELY A;  3BGH A;  4RHB B;  4B3S E;  1XNR E;  4R03 A;  2M9A A;  2EOZ A;  3ECR A;  1WXR A;  1TF6 A;  1NEI A;  1A1J A;  4IJD A;  4X65 E;  4BCA A;  4MLQ A;  3AV0 A;  3KZZ A;  2LVH A;  3KWR A;  5AE2 A;  2YTG A;  2K7I A;  4BS9 A;  5CFF E;  5F3W A;  3VYY A;  1A1I A;  2EL5 A;  4NXN E;  2LJH A;  3HXL A;  3FIG A;  1PJS A;  1WHQ A;  4F9B B;  2RPC A;  4M2Z A;  2EN2 A;  5A69 A;  2EMH A;  4DKK A;  3HTX A;  4LFC E;  2V89 A;  1GZ6 A;  1IQO A;  1YYK A;  4ZYG A;  3OTO E;  1N33 E;  4RH8 A;  2EPZ A;  1IMU A;  1JK2 A;  3LLH A;  4DV5 E;  2LO3 A;  2E1M A;  2FTX B;  4BHC A;  4FK5 C;  4DV2 E;  1ZAA C;  1BBG A;  2UXB E;  2BBG A;  4LF7 E;  4X9J A;  3MHH C;  1A1G A;  5IWA E;  2YSP A;  3C4B A;  5A6A A;  1F2I G;  2EP3 A;  4M9V C;  3AUZ A;  2EOQ A;  2EML A;  2L3C A;  4MLV A;  3IWC A;  1FJG E;  2LTR A;  2YTI A;  4X8W A;  2EMB A;  2EL4 A;  3KZY A;  1X49 A;  2V83 A;  2LMZ A;  1XMO E;  2GHF A;  2NUE A;  2WCC 3;  4R2D A;  3THO B;  2EPO A;  1T4L B;  2V85 A;  2ENA A;  4P7D A;  4R2E A;  4LF5 E;  1PJQ A;  2LV2 A;  2VQE E;  1AAY A;  3JAM C;  1SFE A;  1DGC A;  1I94 E;  5KL7 A;  2UXC E;  2EM4 A;  4DR4 E;  2LE2 A;  2YU8 A;  2EMA A;  5BR8 E;  2EM9 A;  2L2N A;  5A6B A;  3T1H E;  2VF1 A;  4JI5 E;  2EOF A;  2ELZ A;  4BHB A;  4R2S A;  2L8T A;  1YFH A;  2RQL A;  5AC5 A;  4DR3 E;  3BF2 A;  2L3J A;  4R8O A;  1FKA E;  4L8N A;  1N34 E;  4DV6 E;  2N3G A;  5AAS A;  3DF6 A;  3EPK A;  4F6M A;  1YYW A;  2RS7 A;  2NA2 A;  5A6K A;  4R2C A;  1A1L A;  1LLM C;  4HTG A;  1O0W A;  3F6H A;  4NHR A;  5T6J A;  2KHX A;  5KL6 A;  5DNY A;  4DUY E;  1EKZ A;  2UUC E;  2DGC A;  4DV3 E;  1Z1B A;  4DV0 E;  4DR5 E;  2UU9 E;  2EPC A;  1DQ3 A;  2JYA A;  1JK1 A;  4LFA E;  2I9I A;  2KON A;  4LFB E;  1STU A;  1RMD A;  2EN3 A;  1X47 A;  4OOG C;  2EOM A;  1QU6 A;  3ADI A;  5KL3 A;  1ZR9 A;  2EMC A;  3THN A;  2YTN A;  2DMY A;  2K4V A;  5A6B D;  1EH6 A;  2EPN A;  3J7A G;  2EOX A;  4LF4 E;  2LTS A;  2EPL X;  4R2R A;  1J26 A;  2EQ1 A;  2ENC A;  2EPU A;  2FV4 B;  2YRM A;  2DRP A;  3M99 B;  1IQS A;  2YRH A;  1A1H A;  2LBS B;  2EOI A;  1AH5 A;  2RTX A;  4JI0 E;  4OX9 E;  2WBT A;  2RSM A;  5LMN E;  1UBD C;  1UIL A;  2EM0 A;  2YSO A;  4L5N C;  1ZBQ A;  5TSE A;  2UUA E;  4KWY A;  4BC9 A;  2KOU A;  1P47 A;  1HNX E;  2L92 A;  2NUF A;  2EMZ A;  2YTF A;  2M1S A;  2ENH A;  4LF9 E;  2LRS A;  2Q8U A;  2HC5 A;  2F4V E;  2M7Q A;  3VYX A;  4ZYH A;  5KL5 A;  5IV8 B;  3VK6 A;  2EOO A;  4N4R B;  3UK3 C;  1B69 A;  1YZ9 A;  4ZYE A;  3ADL A;  4R2P A;  1X6F A;  1J5E E;  3IWD A;  1XMQ E;  2L2M A;  1X5W A;  4JI8 E;  4NXM E;  3ZOQ B;  4HEI A;  4O43 A;  1QNT A;  4IS1 C;  2PRT A;  4AQY E;  2MDR A;  3JTZ A;  2YTD A;  2DIX A;  3C4T A;  3HPZ A;  2JPA A;  2JOX A;  4Q35 B;  2I13 A;  2GPI A;  3QG5 C;  3BID A;  1X6H A;  1A1F A;  2EPM X;  1T4O A;  2JY9 A;  1HNZ E;  1MEY C;  2NAB A;  2R76 A;  2J7J A;  2EL6 A;  1L4S A;  2G7H A;  2HJJ A;  4F9C B;  2V87 A;  2CSH A;  1TF3 A;  4F2J C;  1A1K A;  1G2F C;  2EPR A;  4M30 A;  2HGH A;  4F9A B;  4F54 A;  3EPH A;  2EMF A;  1WJP A;  4X64 E;  1YYO A;  1IBM E;  2EN8 A;  2YTQ A;  3J81 C;  2EN1 A;  5A6J A;  4DV4 E;  3K6Q A;  3LML A;  1BBO A;  2YTO A;  5AC4 A;  2YPN A;  2EOJ A;  4B3T E;  2EM7 A;  3HPS A;  4TUI A;  2H36 X;  2FGG A;  2CTD A;  4KHP E;  2DMI A;  4JI2 E;  3P1X A;  4F6N A;  2N3H A;  2ZM6 E;  2BB8 A;  1SR9 A;  1T38 A;  1KJK A;  3MHS C;  2JXP A;  4B3M E;  2YTJ A;  2EN6 A;  2EPA A;  1GQE A;  2ADR A;  3IWB A;  3BBG A;  3EPL A;  4JI3 E;  4I8O A;  5ADZ A;  2EPX A;  3DJW A;  2VE7 C;  3F6G A;  4LU9 A;  1N3G A;  2EJ4 A;  1WRJ A;  2ODR D;  5LMU E;  2EOH A;  1HR0 E;  4JYA E;  3J7Y p;  2JP9 A;  1YUI A;  4DMI A;  2EM8 A;  1RQ0 A;  2CT1 A;  2LUP B;  2EMY A;  2EOY A;  4WXC A;  2EE8 A;  2B3T B;  2JR1 A;  4DV7 E;  2L6M A;  2LT7 A;  1UN6 B;  3T1Y E;  2EM5 A;  1MGT A;  4WSG A;  5IT9 C;  2EM6 A;  4BC7 A;  2JOB A;  4LF8 E;  2MKN A;  4Q28 A;  2EN4 A;  1PJT A;  4GEQ B;  2NUG A;  3C6M A;  2CPN A;  2WBS A;  1TN9 A;  4DR6 E;  1ZBT A;  2UUB E;  3OML A;  4JI7 E;  4YY3 E;  1HNW E;  2EMK A;  2YZT A;  2V86 A;  4WX9 A;  1KYQ A;  1T4N A;  2EMX A;  2LCE A;  2JWO A;  4O24 A;  2MKD A;  2EQ0 A;  1YPN A;  3JU0 A;  4GKJ E;  2E72 A;  2YTE A;  2WZO A; 
#chains in the Genus database with same CATH homology
 2DIX A;  3C4T A;  4WFT A;  3HPZ A;  2L8T A;  2JOX A;  4B3S E;  1XNR E;  4R03 A;  1WXR A;  4DR3 E;  1T4O A;  1IBL E;  2JY9 A;  4B3R E;  4X65 E;  2L3J A;  1HNZ E;  1DI2 A;  4JI4 E;  4R8O A;  1FKA E;  4L8N A;  4BCA A;  1N34 E;  2EWL A;  2G7H A;  4DV6 E;  3MSW A;  2F8B A;  1N36 E;  2N3G A;  3AV0 A;  4F9C B;  3KWR A;  5AAS A;  2V87 A;  3DF6 A;  4WPY A;  1YYW A;  2RS7 A;  4JI1 E;  2NA2 A;  4M30 A;  4JV5 E;  4F9A B;  2MC5 A;  5AE2 A;  4F54 A;  1O0W A;  4BS9 A;  3F6H A;  5CFF E;  5F3W A;  3VYY A;  4X64 E;  1YYO A;  1IBM E;  5T6J A;  3J81 C;  2KHX A;  4NXN E;  2LJH A;  3HXL A;  5DNY A;  3FIG A;  4DUY E;  4DV4 E;  1EKZ A;  2UUC E;  3K6Q A;  3LML A;  4DV3 E;  1WHQ A;  4F9B B;  2HHH E;  4LF6 E;  2ODR C;  4DV0 E;  4DR5 E;  2UU9 E;  4M2Z A;  1DQ3 A;  4B3T E;  3HPS A;  4LFA E;  2KON A;  4TUI A;  2H36 X;  2M4I A;  2FGG A;  1STU A;  4LFB E;  4DKK A;  2EZ6 A;  3HTX A;  4KHP E;  4LTY A;  4LFC E;  2V89 A;  1X47 A;  4BBY A;  4OOG C;  4JI2 E;  3P1X A;  5AE3 A;  1GZ6 A;  2N3H A;  1WHN A;  1QU6 A;  2ZM6 E;  3HQ1 A;  3ADI A;  2LUQ A;  2JVA A;  1SR9 A;  1YYK A;  2V8Q B;  3OTO E;  1RC7 A;  4WYQ B;  1N33 E;  4YHH E;  2DMY A;  2K4V A;  4B3M E;  4DR1 E;  4DUZ E;  3LLH A;  4DV5 E;  1GQE A;  3J7A G;  2E1M A;  2FTX B;  1N32 E;  3IWB A;  4JI6 E;  4LF4 E;  3ADJ A;  2LTS A;  4JI3 E;  4I8O A;  4DV2 E;  4DR2 E;  1XNQ E;  5ADZ A;  2L33 A;  1J26 A;  3DJW A;  2VE7 C;  5A2Q C;  3F6G A;  4LU9 A;  2UXB E;  4LF7 E;  2B7T A;  2ODR D;  4DR7 E;  2MC6 A;  5LMU E;  2FV4 B;  1HR0 E;  5IWA E;  3C4B A;  3J80 C;  4JYA E;  2V88 A;  5AE1 A;  2LBS B;  1IBK E;  3J7Y p;  4M0V A;  2RTX A;  3RMP A;  4JI0 E;  4OX9 E;  4DMI A;  1PKP A;  2RSM A;  2B7V A;  2YT4 A;  2IHR 1;  1UIL A;  3AUZ A;  1RQ0 A;  4J8Z A;  4X62 E;  2L3C A;  5LMN E;  3IWC A;  2LUP B;  1FJG E;  2L2K B;  4DV1 E;  2LTR A;  4L5N C;  1ZBQ A;  4X8W A;  1X48 A;  2B3T B;  2JR1 A;  4DV7 E;  2L6M A;  1UHZ A;  5LL6 R;  2UUA E;  1X49 A;  3T1Y E;  4GKK E;  4BC9 A;  2KOU A;  1HNX E;  2L92 A;  2NUF A;  2V83 A;  2VQF E;  5IT9 C;  3T1H E;  2LMZ A;  2JOB A;  4BC7 A;  2M1S A;  5FLX C;  1XMO E;  4LF8 E;  4Q28 A;  2B9D A;  2LRS A;  4LF9 E;  2NUE A;  2DB2 A;  4GEQ B;  2NUG A;  2F4V E;  1T4L B;  2M7Q A;  4X66 E;  3VYX A;  2CPN A;  2V85 A;  3VK6 A;  3ADG A;  4DR6 E;  4P7D A;  4K0K E;  1ZBT A;  4LF5 E;  2UUB E;  3OML A;  4KZS A;  4JI7 E;  4YY3 E;  2VQE E;  1HNW E;  3JAM C;  1YZ9 A;  2YZT A;  2V86 A;  3ADL A;  1J5E E;  1T4N A;  3IWD A;  1XMQ E;  4BMJ A;  4P78 A;  2JWO A;  2E5L E;  3H09 A;  2L2M A;  1I94 E;  4JI8 E;  4NXM E;  2UXD E;  2UXC E;  4DR4 E;  2RS6 A;  3JU0 A;  3ZOQ B;  4WSP A;  2DSY A;  2LE2 A;  4GKJ E;  4TUG A;  4AQY E;  5BR8 E;  2L2N A;  2MDR A;  3JTZ A;  2WZO A;  2VF1 A;  4JI5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...