1QU6A

Structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
179
Chain Sequence
GSHMEMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the double-stranded RNA-binding domain of the protein kinase PKR reveals the molecular basis of its dsRNA-mediated activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTEIN KINASE PKR
total genus 28
structure length 179
sequence length 179
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A02
4DV0E 4DR2E 4JI0E 4K0KE 1XMOE 1N32E 1ZBTA 1WHQA 2JY9A 2LTRA 3P1XA 4DV4E 2F4VE 2RS7A 4JI4E 1YYOA 2B3TB 1HNWE 1YYWA 4JI2E 4DR3E 4DV2E 2UXCE 2DIXA 3ADJA 3J7Yp 4DV3E 4LF8E 2L2NA 4M2ZA 2DMYA 1XNQE 2UUCE 1N33E 2UXDE 4B3SE 4DV6E 1I94E 1HR0E 4JI3E 4LFAE 2ZM6E 4B3RE 1O0WA 2NUGA 3LLHA 3C4TA 1XMQE 4JYAE 4B3ME 2UUAE 1WHNA 4NXME 1EKZA 1QU6A 4DV7E 4LF7E 1RC7A 4DR4E 5LMUE 4LF5E 2IHR1 1FJGE 3T1YE 2UU9E 1J5EE 5LMNE 2L3CA 1FKAE 1YZ9A 2EZ6A 4DUZE 4B3TE 2HHHE 4JI5E 4WYQB 4M30A 4JI1E 1IBLE 4OOGC 5BR8E 5IWAE 1J26A 1UHZA 1T4NA 1IBME 3ADGA 3OTOE 2NUEA 4LFBE 2NUFA 1PKPA 4KHPE 4YHHE 1T4LB 2VQFE 3HTXA 2L2MA 2RSMA 3ADLA 4LF4E 2DB2A 2E5LE 2YT4A 4AQYE 1UILA 1T4OA 4JI8E 2L2KB 4DV5E 1RQ0A 4DR7E 4GKKE 2B7VA 2B7TA 2KHXA 4DKKA 2UUBE 5CFFE 3VYYA 2LJHA 4LF9E 1X48A 4X8WA 4DR5E 1HNXE 4WFTA 2UXBE 4YY3E 2N3HA 4DR1E 4GKJE 4JI6E 2N3GA 3C4BA 4LF6E 3ADIA 4OX9E 4DV1E 2LUPB 1X49A 4LFCE 1YYKA 2LBSB 1HNZE 4X65E 2JVAA 2LRSA 1N34E 3VYXA 1N36E 2L33A 2NA2A 2CPNA 2LTSA 1GQEA 2L3JA 2VQEE 2RTXA 2LUQA 4NXNE 4X64E 3T1HE 4JI7E 4DR6E 2RS6A 4X62E 4JV5E 1DI2A 1STUA 4DUYE 1IBKE 2MDRA 1X47A 4X66E 1XNRE
chains in the Genus database with same CATH superfamily
4K0KE 1GTKA 2EPAA 3H09A 1XMOE 1ZBTA 3ECRA 4BHBA 1ZAAC 3VHTB 4DV4E 3P1XA 2GLIA 3MSWA 2VF1A 2EM0A 4N4RB 1YYWA 3THNA 3MHSC 1ZU1A 3ADJA 4P7DA 1RMDA 3DJWA 4GZNC 1YPNA 2FV4B 2YU5A 3EPLA 1EH8A 4O4KA 4M2ZA 1XNQE 2EOJA 1I94E 1HR0E 4LFAE 2ZM6E 2PRTA 2EOSA 3THOB 1XMQE 2M7QA 4BHCA 2DLQA 5A6KA 4NXME 4DR4E 1N3GA 2L6MA 1FJGE 2JWOA 3AV0A 1F2IG 3IWDA 2V86A 2LE2A 1AAYA 1J5EE 5KL4A 1IMUA 2EMHA 5A2QC 5T6JA 2DGCA 2L3CA 4F2JC 3IWBA 3TQMA 4ZYDA 4DUZE 4JI5E 4WYQB 3HXLA 1A1KA 5IWAE 3HQ1A 2BBGA 2EN7A 1IQOA 2E72A 2EE8A 3J81C 1PDAA 2L2MA 2LT7A 4LF4E 4GEQB 4JI8E 2EMAA 1T39A 3F6GA 3FIGA 1RQ0A 4ZYHA 4BCAA 2B7VA 2B7TA 3MHHC 2KHXA 4IS1C 5CFFE 3VYYA 4LF9E 4X8WA 2DRPA 4WFTA 1A1JA 1T38A 4LF6E 1X6FA 5A69A 2L8TA 4NHRA 2WCC3 4DV1E 2J7JA 1X49A 4BC7A 2EMZA 2G7HA 4Q35B 2VRDA 4DMIA 2EOQA 2B9DA 4IJDA 2NA2A 2JXPA 2CPNA 5KL2A 2L3JA 2ENCA 4R2AA 5AC4A 1BB8A 2CTDA 5ADZA 1YUIA 4X62E 4KWYA 5LLQA 2EMIA 4L8NA 2YPNA 2V88A 3K6QA 2EM4A 2EQ3A 4F9AB 2K4VA 3J80C 3KZZA 2RS7A 4RHBB 2EPXA 2B3TB 2EM9A 2LJUA 4DR3E 2I9IA 2UXCE 4BMJA 3J7Yp 4DV3E 2DLKA 3BBGA 3EPHA 4NZVA 2DMYA 2EOHA 1PJQA 2EMFA 1O0WA 2FTXB 5AASA 4WX9A 2WZOA 1QNTA 4LU9A 3HPZA 2M4IA 2WBSA 2EMCA 2GHFA 2UUAE 1WHNA 1EKZA 4DV7E 4LF7E 1MGTA 4WXCA 5LMUE 2VE7C 5AE3A 2V89A 2IHR1 3J7AG 3T1YE 3BIDA 3BGHA 2EPZA 2ELYA 4BBYA 5DNYA 2EOOA 5LMNE 3DF6A 1IQSA 2EOIA 2EORA 1SR9A 1NEIA 3RMPA 2M1SA 1DQ3A 2HHHE 2EN4A 4JI1E 3C6KA 2EPMX 1WXRA 5BR8E 3EPJA 5FLXC 2EWLA 1TF6A 1WJPA 1UHZA 3UK3C 4WXDA 2V85A 5A6AA 1BBOA 3OTOE 2V8QB 2NUEA 2JOBA 2N8XA 4KHPE 1T4LB 2EOYA 5KL3A 3HPSA 2DB2A 4ZYGA 2YRMA 1T4OA 4R2CA 4J8ZA 4F54A 2L2KB 4O24A 2EM5A 2EN2A 5AE2A 2YTJA 2V83A 1X48A 2YSPA 2YTOA 2UXBE 4YY3E 4FK5C 2EMGA 2NABA 2WBUA 4JI6E 4BC9A 3C4BA 2F8BA 1PJSA 3ADIA 5A6JA 1P47A 3EQ1A 4WSGA 2LBSB 4X65E 2JVAA 4P78A 2ENAA 2EMWA 2YZTA 1L4SA 4O5GA 2EMKA 4ZYEA 2LTSA 4MLVA 2LUQA 1UN6B 1DGCA 2LMZA 4R2RA 3T1HE 2RS6A 4JV5E 2Q8UA 4MLQA 1DI2A 1IBKE 2MDRA 2FGGA 4X66E 1X3CA 4JI0E 1N32E 2LCEA 1A1FA 2LTRA 3F6HA 4JI4E 1YYOA 1HNWE 1TF3A 2CSHA 4LF8E 2L2NA 2UXDE 4R2DA 2UUCE 4HEIA 4F6NA 4B3RE 2NUGA 2LV2A 2YRKA 2EM8A 3EPKA 2EL4A 2EM6A 4B3ME 2RQLA 1EH6A 1X6HA 1RC7A 2MC5A 2YTQA 1TN9A 4X9JA 5KL5A 1JK1A 5KL6A 5IT9C 2EN3A 4M9VC 1X6EA 1FKAE 2CT1A 2DSYA 2EZ6A 2RPCA 4B3TE 2EP3A 4M0VA 2EPNA 1KYQA 4M30A 2A25A 5LL6R 1AH5A 2EOMA 1J26A 2EOFA 2YTDA 3VK6A 1BBGA 1T4NA 1X5WA 2M9AA 2EPOA 3ADGA 2ODRC 4LFBE 2NUFA 4YHHE 2VQFE 4F6MA 1Z1BA 3ADLA 2EPKX 1EH7A 3JAMC 4TUGA 2E5LE 2EM3A 4AQYE 5KL7A 2DMIA 2EM2A 2EOZA 3JTZA 2JP9A 4R2PA 1A1IA 2YSOA 2EPCA 2EN1A 2YTPA 4I8OA 4DKKA 2UUBE 2LJHA 4DR5E 3BF2A 1HNXE 5F3WA 4HTGA 4BS9A 3KZYA 2MKNA 2EN8A 2N3HA 3QG5C 2MDGA 4GKJE 2EM7A 2KOUA 2YTGA 3IWCA 3C6MA 2EMLA 5AE1A 4LFCE 1YSAC 1HNZE 1YFHA 1SFEA 3VYXA 4WSPA 2EJ4A 1N36E 2H36X 1YUJA 2LO3A 4O43A 4X64E 4NXNE 4DR6E 4JI7E 2YWQA 2JOXA 1A1LA 2JPAA 4DV0E 4Q28A 4DR2E 4R2EA 1WHQA 2JY9A 2F4VE 5TSEA 1G2DC 3ZOQB 1NCSA 2ODRD 3JU0A 4JI2E 2EQ0A 4DV2E 2EQ1A 2V87A 2DIXA 3M99B 2R1FA 1UBDC 1N33E 4KZSA 4B3SE 4DV6E 4JI3E 1B69A 1LLMC 3LLHA 3C4TA 2HC5A 4JYAE 2EPPA 1QU6A 1MEYC 2MC6A 4L5NC 4WPYA 2GPIA 4R03A 4LF5E 1WRJA 3AUZA 3OMLA 5IV8B 2LVHA 2YTNA 2EMBA 2EPLX 1JK2A 1PJTA 2EMXA 2K7IA 2ELZA 4R8OA 1G2FC 2YTEA 1YZ9A 2EPRA 1GZ6A 5IXMB 1IBLE 4OOGC 2YRHA 1A1HA 2R76A 2YTIA 1IBME 1PKPA 2WBTA 2D9HA 3HTXA 2KONA 2RSIA 2RSMA 2HGHA 1KJKA 2YT4A 2ENHA 5A6BA 1UILA 2JR1A 2L92A 4LTYA 4DV5E 2EL5A 1A1GA 4DR7E 4GKKE 3L00A 2I13A 2EPUA 1ZR9A 3KWRA 2EOEA 4F9CB 4F9BB 2MKDA 1ZBQA 4TUIA 2ADRA 2E1MA 4R2QA 4DR1E 2YTFA 4RH8A 2EL6A 2N3GA 4OX9E 2LUPB 5A6BD 1YYKA 2LRSA 1N34E 3LMLA 2EOXA 2L33A 2YU8A 1GQEA 2VQEE 5AC5A 2RTXA 2BB8A 2EN6A 2EMYA 2HJJA 1STUA 4DUYE 1X47A 2UU9E 4R2SA 2JYAA 1XNRE
chains in the Genus database with same CATH topology
4DV0E 4Q28A 4DR2E 4JI0E 3H09A 1XMOE 4K0KE 1N32E 1ZBTA 2V88A 3K6QA 1WHQA 4F9AB 2JY9A 2K4VA 2LTRA 3F6HA 3P1XA 2RS7A 3MSWA 3J80C 4DV4E 4JI4E 2F4VE 2VF1A 3ZOQB 1YYOA 2ODRD 2B3TB 3JU0A 1HNWE 1YYWA 4JI2E 4DR3E 4DV2E 2V87A 2DIXA 2UXCE 3ADJA 4P7DA 3DJWA 4BMJA 3J7Yp 4DV3E 4LF8E 2FV4B 2L2NA 4M2ZA 2DMYA 4KZSA 2UUCE 1XNQE 1N33E 4B3SE 2UXDE 4DV6E 1I94E 1HR0E 4JI3E 4LFAE 2ZM6E 4B3RE 1O0WA 2NUGA 2FTXB 5AASA 3LLHA 3C4TA 2WZOA 4LU9A 3HPZA 2M4IA 1XMQE 4JYAE 2M7QA 4B3ME 2UUAE 1WHNA 4NXME 1EKZA 1QU6A 4DV7E 4LF7E 1RC7A 4DR4E 2MC6A 5LMUE 2MC5A 4L5NC 4WPYA 4R03A 2VE7C 5AE3A 4LF5E 2V89A 3AUZA 3OMLA 2IHR1 2L6MA 1FJGE 5IT9C 2JWOA 3AV0A 3J7AG 3IWDA 3T1YE 2UU9E 2V86A 2LE2A 4BBYA 5DNYA 1J5EE 5LMNE 3DF6A 5A2QC 5T6JA 4R8OA 2L3CA 1SR9A 1FKAE 1YZ9A 2DSYA 3IWBA 2EZ6A 3RMPA 4DUZE 2M1SA 4B3TE 1DQ3A 2HHHE 4M0VA 4JI5E 1GZ6A 4WYQB 4M30A 3HXLA 4JI1E 1IBLE 4OOGC 1WXRA 5BR8E 5IWAE 3HQ1A 5LL6R 5FLXC 2EWLA 1J26A 3VK6A 1UHZA 1T4NA 2V85A 1IBME 3ADGA 3OTOE 2ODRC 2V8QB 2NUEA 4LFBE 2NUFA 1PKPA 2JOBA 3J81C 4KHPE 4YHHE 1T4LB 2VQFE 3HTXA 2KONA 2L2MA 2RSMA 3ADLA 3JAMC 3HPSA 4TUGA 4LF4E 2DB2A 2E5LE 2YT4A 4AQYE 4GEQB 1UILA 1T4OA 2JR1A 3JTZA 4J8ZA 4JI8E 4F54A 2L92A 2L2KB 3F6GA 4LTYA 4DV5E 3FIGA 1RQ0A 5AE2A 4DR7E 4BCAA 4GKKE 2B7VA 2B7TA 2KHXA 4I8OA 4DKKA 2UUBE 3KWRA 5CFFE 2V83A 3VYYA 2LJHA 4LF9E 1X48A 4X8WA 4F9CB 4DR5E 1HNXE 5F3WA 4WFTA 4F9BB 2UXBE 4BS9A 4YY3E 1ZBQA 4TUIA 2N3HA 2E1MA 4DR1E 4GKJE 4JI6E 2KOUA 4BC9A 3IWCA 2N3GA 2F8BA 3C4BA 4LF6E 2L8TA 3ADIA 4OX9E 4DV1E 2LUPB 1X49A 5AE1A 4LFCE 1YYKA 4BC7A 2LBSB 1HNZE 4X65E 2G7HA 2JVAA 4P78A 2LRSA 1N34E 3VYXA 3LMLA 4DMIA 4WSPA 4L8NA 2YZTA 1N36E 2H36X 2B9DA 2L33A 2NA2A 2CPNA 2LTSA 1GQEA 2L3JA 2VQEE 2RTXA 2LUQA 4NXNE 4X64E 2LMZA 4JI7E 5ADZA 2RS6A 3T1HE 4X62E 4DR6E 4JV5E 1DI2A 1STUA 4DUYE 1IBKE 2MDRA 2JOXA 1X47A 4X66E 2FGGA 1XNRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  4DR2 E;  4JI0 E;  4K0K E;  1XMO E;  1N32 E;  1ZBT A;  1WHQ A;  2JY9 A;  2LTR A;  3P1X A;  4DV4 E;  2F4V E;  2RS7 A;  4JI4 E;  1YYO A;  2B3T B;  1HNW E;  1YYW A;  4JI2 E;  4DR3 E;  4DV2 E;  2UXC E;  2DIX A;  3ADJ A;  3J7Y p;  4DV3 E;  4LF8 E;  2L2N A;  4M2Z A;  2DMY A;  1XNQ E;  2UUC E;  1N33 E;  2UXD E;  4B3S E;  4DV6 E;  1I94 E;  1HR0 E;  4JI3 E;  4LFA E;  2ZM6 E;  4B3R E;  1O0W A;  2NUG A;  3LLH A;  3C4T A;  1XMQ E;  4JYA E;  4B3M E;  2UUA E;  1WHN A;  4NXM E;  1EKZ A;  1QU6 A;  4DV7 E;  4LF7 E;  1RC7 A;  4DR4 E;  5LMU E;  4LF5 E;  2IHR 1;  1FJG E;  3T1Y E;  2UU9 E;  1J5E E;  5LMN E;  2L3C A;  1FKA E;  1YZ9 A;  2EZ6 A;  4DUZ E;  4B3T E;  2HHH E;  4JI5 E;  4WYQ B;  4M30 A;  4JI1 E;  1IBL E;  4OOG C;  5BR8 E;  5IWA E;  1J26 A;  1UHZ A;  1T4N A;  1IBM E;  3ADG A;  3OTO E;  2NUE A;  4LFB E;  2NUF A;  1PKP A;  4KHP E;  4YHH E;  1T4L B;  2VQF E;  3HTX A;  2L2M A;  2RSM A;  3ADL A;  4LF4 E;  2DB2 A;  2E5L E;  2YT4 A;  4AQY E;  1UIL A;  1T4O A;  4JI8 E;  2L2K B;  4DV5 E;  1RQ0 A;  4DR7 E;  4GKK E;  2B7V A;  2B7T A;  2KHX A;  4DKK A;  2UUB E;  5CFF E;  3VYY A;  2LJH A;  4LF9 E;  1X48 A;  4X8W A;  4DR5 E;  1HNX E;  4WFT A;  2UXB E;  4YY3 E;  2N3H A;  4DR1 E;  4GKJ E;  4JI6 E;  2N3G A;  3C4B A;  4LF6 E;  3ADI A;  4OX9 E;  4DV1 E;  2LUP B;  1X49 A;  4LFC E;  1YYK A;  2LBS B;  1HNZ E;  4X65 E;  2JVA A;  2LRS A;  1N34 E;  3VYX A;  1N36 E;  2L33 A;  2NA2 A;  2CPN A;  2LTS A;  1GQE A;  2L3J A;  2VQE E;  2RTX A;  2LUQ A;  4NXN E;  4X64 E;  3T1H E;  4JI7 E;  4DR6 E;  2RS6 A;  4X62 E;  4JV5 E;  1DI2 A;  1STU A;  4DUY E;  1IBK E;  2MDR A;  1X47 A;  4X66 E;  1XNR E; 
#chains in the Genus database with same CATH topology
 4K0K E;  1GTK A;  2EPA A;  3H09 A;  1XMO E;  1ZBT A;  3ECR A;  4BHB A;  1ZAA C;  3VHT B;  4DV4 E;  3P1X A;  2GLI A;  3MSW A;  2VF1 A;  2EM0 A;  4N4R B;  1YYW A;  3THN A;  3MHS C;  1ZU1 A;  3ADJ A;  4P7D A;  1RMD A;  3DJW A;  4GZN C;  1YPN A;  2FV4 B;  2YU5 A;  3EPL A;  1EH8 A;  4O4K A;  4M2Z A;  1XNQ E;  2EOJ A;  1I94 E;  1HR0 E;  4LFA E;  2ZM6 E;  2PRT A;  2EOS A;  3THO B;  1XMQ E;  2M7Q A;  4BHC A;  2DLQ A;  5A6K A;  4NXM E;  4DR4 E;  1N3G A;  2L6M A;  1FJG E;  2JWO A;  3AV0 A;  1F2I G;  3IWD A;  2V86 A;  2LE2 A;  1AAY A;  1J5E E;  5KL4 A;  1IMU A;  2EMH A;  5A2Q C;  5T6J A;  2DGC A;  2L3C A;  4F2J C;  3IWB A;  3TQM A;  4ZYD A;  4DUZ E;  4JI5 E;  4WYQ B;  3HXL A;  1A1K A;  5IWA E;  3HQ1 A;  2BBG A;  2EN7 A;  1IQO A;  2E72 A;  2EE8 A;  3J81 C;  1PDA A;  2L2M A;  2LT7 A;  4LF4 E;  4GEQ B;  4JI8 E;  2EMA A;  1T39 A;  3F6G A;  3FIG A;  1RQ0 A;  4ZYH A;  4BCA A;  2B7V A;  2B7T A;  3MHH C;  2KHX A;  4IS1 C;  5CFF E;  3VYY A;  4LF9 E;  4X8W A;  2DRP A;  4WFT A;  1A1J A;  1T38 A;  4LF6 E;  1X6F A;  5A69 A;  2L8T A;  4NHR A;  2WCC 3;  4DV1 E;  2J7J A;  1X49 A;  4BC7 A;  2EMZ A;  2G7H A;  4Q35 B;  2VRD A;  4DMI A;  2EOQ A;  2B9D A;  4IJD A;  2NA2 A;  2JXP A;  2CPN A;  5KL2 A;  2L3J A;  2ENC A;  4R2A A;  5AC4 A;  1BB8 A;  2CTD A;  5ADZ A;  1YUI A;  4X62 E;  4KWY A;  5LLQ A;  2EMI A;  4L8N A;  2YPN A;  2V88 A;  3K6Q A;  2EM4 A;  2EQ3 A;  4F9A B;  2K4V A;  3J80 C;  3KZZ A;  2RS7 A;  4RHB B;  2EPX A;  2B3T B;  2EM9 A;  2LJU A;  4DR3 E;  2I9I A;  2UXC E;  4BMJ A;  3J7Y p;  4DV3 E;  2DLK A;  3BBG A;  3EPH A;  4NZV A;  2DMY A;  2EOH A;  1PJQ A;  2EMF A;  1O0W A;  2FTX B;  5AAS A;  4WX9 A;  2WZO A;  1QNT A;  4LU9 A;  3HPZ A;  2M4I A;  2WBS A;  2EMC A;  2GHF A;  2UUA E;  1WHN A;  1EKZ A;  4DV7 E;  4LF7 E;  1MGT A;  4WXC A;  5LMU E;  2VE7 C;  5AE3 A;  2V89 A;  2IHR 1;  3J7A G;  3T1Y E;  3BID A;  3BGH A;  2EPZ A;  2ELY A;  4BBY A;  5DNY A;  2EOO A;  5LMN E;  3DF6 A;  1IQS A;  2EOI A;  2EOR A;  1SR9 A;  1NEI A;  3RMP A;  2M1S A;  1DQ3 A;  2HHH E;  2EN4 A;  4JI1 E;  3C6K A;  2EPM X;  1WXR A;  5BR8 E;  3EPJ A;  5FLX C;  2EWL A;  1TF6 A;  1WJP A;  1UHZ A;  3UK3 C;  4WXD A;  2V85 A;  5A6A A;  1BBO A;  3OTO E;  2V8Q B;  2NUE A;  2JOB A;  2N8X A;  4KHP E;  1T4L B;  2EOY A;  5KL3 A;  3HPS A;  2DB2 A;  4ZYG A;  2YRM A;  1T4O A;  4R2C A;  4J8Z A;  4F54 A;  2L2K B;  4O24 A;  2EM5 A;  2EN2 A;  5AE2 A;  2YTJ A;  2V83 A;  1X48 A;  2YSP A;  2YTO A;  2UXB E;  4YY3 E;  4FK5 C;  2EMG A;  2NAB A;  2WBU A;  4JI6 E;  4BC9 A;  3C4B A;  2F8B A;  1PJS A;  3ADI A;  5A6J A;  1P47 A;  3EQ1 A;  4WSG A;  2LBS B;  4X65 E;  2JVA A;  4P78 A;  2ENA A;  2EMW A;  2YZT A;  1L4S A;  4O5G A;  2EMK A;  4ZYE A;  2LTS A;  4MLV A;  2LUQ A;  1UN6 B;  1DGC A;  2LMZ A;  4R2R A;  3T1H E;  2RS6 A;  4JV5 E;  2Q8U A;  4MLQ A;  1DI2 A;  1IBK E;  2MDR A;  2FGG A;  4X66 E;  1X3C A;  4JI0 E;  1N32 E;  2LCE A;  1A1F A;  2LTR A;  3F6H A;  4JI4 E;  1YYO A;  1HNW E;  1TF3 A;  2CSH A;  4LF8 E;  2L2N A;  2UXD E;  4R2D A;  2UUC E;  4HEI A;  4F6N A;  4B3R E;  2NUG A;  2LV2 A;  2YRK A;  2EM8 A;  3EPK A;  2EL4 A;  2EM6 A;  4B3M E;  2RQL A;  1EH6 A;  1X6H A;  1RC7 A;  2MC5 A;  2YTQ A;  1TN9 A;  4X9J A;  5KL5 A;  1JK1 A;  5KL6 A;  5IT9 C;  2EN3 A;  4M9V C;  1X6E A;  1FKA E;  2CT1 A;  2DSY A;  2EZ6 A;  2RPC A;  4B3T E;  2EP3 A;  4M0V A;  2EPN A;  1KYQ A;  4M30 A;  2A25 A;  5LL6 R;  1AH5 A;  2EOM A;  1J26 A;  2EOF A;  2YTD A;  3VK6 A;  1BBG A;  1T4N A;  1X5W A;  2M9A A;  2EPO A;  3ADG A;  2ODR C;  4LFB E;  2NUF A;  4YHH E;  2VQF E;  4F6M A;  1Z1B A;  3ADL A;  2EPK X;  1EH7 A;  3JAM C;  4TUG A;  2E5L E;  2EM3 A;  4AQY E;  5KL7 A;  2DMI A;  2EM2 A;  2EOZ A;  3JTZ A;  2JP9 A;  4R2P A;  1A1I A;  2YSO A;  2EPC A;  2EN1 A;  2YTP A;  4I8O A;  4DKK A;  2UUB E;  2LJH A;  4DR5 E;  3BF2 A;  1HNX E;  5F3W A;  4HTG A;  4BS9 A;  3KZY A;  2MKN A;  2EN8 A;  2N3H A;  3QG5 C;  2MDG A;  4GKJ E;  2EM7 A;  2KOU A;  2YTG A;  3IWC A;  3C6M A;  2EML A;  5AE1 A;  4LFC E;  1YSA C;  1HNZ E;  1YFH A;  1SFE A;  3VYX A;  4WSP A;  2EJ4 A;  1N36 E;  2H36 X;  1YUJ A;  2LO3 A;  4O43 A;  4X64 E;  4NXN E;  4DR6 E;  4JI7 E;  2YWQ A;  2JOX A;  1A1L A;  2JPA A;  4DV0 E;  4Q28 A;  4DR2 E;  4R2E A;  1WHQ A;  2JY9 A;  2F4V E;  5TSE A;  1G2D C;  3ZOQ B;  1NCS A;  2ODR D;  3JU0 A;  4JI2 E;  2EQ0 A;  4DV2 E;  2EQ1 A;  2V87 A;  2DIX A;  3M99 B;  2R1F A;  1UBD C;  1N33 E;  4KZS A;  4B3S E;  4DV6 E;  4JI3 E;  1B69 A;  1LLM C;  3LLH A;  3C4T A;  2HC5 A;  4JYA E;  2EPP A;  1QU6 A;  1MEY C;  2MC6 A;  4L5N C;  4WPY A;  2GPI A;  4R03 A;  4LF5 E;  1WRJ A;  3AUZ A;  3OML A;  5IV8 B;  2LVH A;  2YTN A;  2EMB A;  2EPL X;  1JK2 A;  1PJT A;  2EMX A;  2K7I A;  2ELZ A;  4R8O A;  1G2F C;  2YTE A;  1YZ9 A;  2EPR A;  1GZ6 A;  5IXM B;  1IBL E;  4OOG C;  2YRH A;  1A1H A;  2R76 A;  2YTI A;  1IBM E;  1PKP A;  2WBT A;  2D9H A;  3HTX A;  2KON A;  2RSI A;  2RSM A;  2HGH A;  1KJK A;  2YT4 A;  2ENH A;  5A6B A;  1UIL A;  2JR1 A;  2L92 A;  4LTY A;  4DV5 E;  2EL5 A;  1A1G A;  4DR7 E;  4GKK E;  3L00 A;  2I13 A;  2EPU A;  1ZR9 A;  3KWR A;  2EOE A;  4F9C B;  4F9B B;  2MKD A;  1ZBQ A;  4TUI A;  2ADR A;  2E1M A;  4R2Q A;  4DR1 E;  2YTF A;  4RH8 A;  2EL6 A;  2N3G A;  4OX9 E;  2LUP B;  5A6B D;  1YYK A;  2LRS A;  1N34 E;  3LML A;  2EOX A;  2L33 A;  2YU8 A;  1GQE A;  2VQE E;  5AC5 A;  2RTX A;  2BB8 A;  2EN6 A;  2EMY A;  2HJJ A;  1STU A;  4DUY E;  1X47 A;  2UU9 E;  4R2S A;  2JYA A;  1XNR E; 
#chains in the Genus database with same CATH homology
 4DV0 E;  4Q28 A;  4DR2 E;  4JI0 E;  3H09 A;  1XMO E;  4K0K E;  1N32 E;  1ZBT A;  2V88 A;  3K6Q A;  1WHQ A;  4F9A B;  2JY9 A;  2K4V A;  2LTR A;  3F6H A;  3P1X A;  2RS7 A;  3MSW A;  3J80 C;  4DV4 E;  4JI4 E;  2F4V E;  2VF1 A;  3ZOQ B;  1YYO A;  2ODR D;  2B3T B;  3JU0 A;  1HNW E;  1YYW A;  4JI2 E;  4DR3 E;  4DV2 E;  2V87 A;  2DIX A;  2UXC E;  3ADJ A;  4P7D A;  3DJW A;  4BMJ A;  3J7Y p;  4DV3 E;  4LF8 E;  2FV4 B;  2L2N A;  4M2Z A;  2DMY A;  4KZS A;  2UUC E;  1XNQ E;  1N33 E;  4B3S E;  2UXD E;  4DV6 E;  1I94 E;  1HR0 E;  4JI3 E;  4LFA E;  2ZM6 E;  4B3R E;  1O0W A;  2NUG A;  2FTX B;  5AAS A;  3LLH A;  3C4T A;  2WZO A;  4LU9 A;  3HPZ A;  2M4I A;  1XMQ E;  4JYA E;  2M7Q A;  4B3M E;  2UUA E;  1WHN A;  4NXM E;  1EKZ A;  1QU6 A;  4DV7 E;  4LF7 E;  1RC7 A;  4DR4 E;  2MC6 A;  5LMU E;  2MC5 A;  4L5N C;  4WPY A;  4R03 A;  2VE7 C;  5AE3 A;  4LF5 E;  2V89 A;  3AUZ A;  3OML A;  2IHR 1;  2L6M A;  1FJG E;  5IT9 C;  2JWO A;  3AV0 A;  3J7A G;  3IWD A;  3T1Y E;  2UU9 E;  2V86 A;  2LE2 A;  4BBY A;  5DNY A;  1J5E E;  5LMN E;  3DF6 A;  5A2Q C;  5T6J A;  4R8O A;  2L3C A;  1SR9 A;  1FKA E;  1YZ9 A;  2DSY A;  3IWB A;  2EZ6 A;  3RMP A;  4DUZ E;  2M1S A;  4B3T E;  1DQ3 A;  2HHH E;  4M0V A;  4JI5 E;  1GZ6 A;  4WYQ B;  4M30 A;  3HXL A;  4JI1 E;  1IBL E;  4OOG C;  1WXR A;  5BR8 E;  5IWA E;  3HQ1 A;  5LL6 R;  5FLX C;  2EWL A;  1J26 A;  3VK6 A;  1UHZ A;  1T4N A;  2V85 A;  1IBM E;  3ADG A;  3OTO E;  2ODR C;  2V8Q B;  2NUE A;  4LFB E;  2NUF A;  1PKP A;  2JOB A;  3J81 C;  4KHP E;  4YHH E;  1T4L B;  2VQF E;  3HTX A;  2KON A;  2L2M A;  2RSM A;  3ADL A;  3JAM C;  3HPS A;  4TUG A;  4LF4 E;  2DB2 A;  2E5L E;  2YT4 A;  4AQY E;  4GEQ B;  1UIL A;  1T4O A;  2JR1 A;  3JTZ A;  4J8Z A;  4JI8 E;  4F54 A;  2L92 A;  2L2K B;  3F6G A;  4LTY A;  4DV5 E;  3FIG A;  1RQ0 A;  5AE2 A;  4DR7 E;  4BCA A;  4GKK E;  2B7V A;  2B7T A;  2KHX A;  4I8O A;  4DKK A;  2UUB E;  3KWR A;  5CFF E;  2V83 A;  3VYY A;  2LJH A;  4LF9 E;  1X48 A;  4X8W A;  4F9C B;  4DR5 E;  1HNX E;  5F3W A;  4WFT A;  4F9B B;  2UXB E;  4BS9 A;  4YY3 E;  1ZBQ A;  4TUI A;  2N3H A;  2E1M A;  4DR1 E;  4GKJ E;  4JI6 E;  2KOU A;  4BC9 A;  3IWC A;  2N3G A;  2F8B A;  3C4B A;  4LF6 E;  2L8T A;  3ADI A;  4OX9 E;  4DV1 E;  2LUP B;  1X49 A;  5AE1 A;  4LFC E;  1YYK A;  4BC7 A;  2LBS B;  1HNZ E;  4X65 E;  2G7H A;  2JVA A;  4P78 A;  2LRS A;  1N34 E;  3VYX A;  3LML A;  4DMI A;  4WSP A;  4L8N A;  2YZT A;  1N36 E;  2H36 X;  2B9D A;  2L33 A;  2NA2 A;  2CPN A;  2LTS A;  1GQE A;  2L3J A;  2VQE E;  2RTX A;  2LUQ A;  4NXN E;  4X64 E;  2LMZ A;  4JI7 E;  5ADZ A;  2RS6 A;  3T1H E;  4X62 E;  4DR6 E;  4JV5 E;  1DI2 A;  1STU A;  4DUY E;  1IBK E;  2MDR A;  2JOX A;  1X47 A;  4X66 E;  2FGG A;  1XNR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...