1QU6A

Structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
179
Chain Sequence
GSHMEMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE PKR
publication title Structure of the double-stranded RNA-binding domain of the protein kinase PKR reveals the molecular basis of its dsRNA-mediated activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 28
structure length 179
sequence length 179
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A02
1XNRE 1X49A 3VYYA 1IBME 4YY3E 4LF9E 2DB2A 4JI0E 1FJGE 4X64E 1X48A 1YYKA 2RS7A 4DV0E 4DR7E 4X8WA 4LF5E 4NXME 1STUA 4OX9E 1HNZE 2L3JA 4AQYE 4DR3E 1WHNA 4X62E 4JV5E 1HNWE 4B3ME 1YYOA 4LF4E 3T1YE 1YYWA 2LUPB 2RSMA 4JI8E 1EKZA 2DMYA 3OTOE 2B7VA 4LF7E 4GKJE 4X65E 4DV3E 1PKPA 2VQFE 4JI4E 4K0KE 1QU6A 2UUBE 5LMNE 1ZBTA 2MDRA 2CPNA 4JYAE 4LFCE 2L2NA 3C4TA 1T4LB 1T4NA 4B3SE 2VQEE 3ADIA 2UXDE 2L33A 2L2MA 4DV1E 2L3CA 3VYXA 1GQEA 1RQ0A 3J7Yp 1XNQE 3ADLA 1UILA 5BR8E 2DIXA 2UXCE 2N3GA 4X66E 2LTSA 4M2ZA 2YT4A 4DR2E 5LMUE 2F4VE 4JI1E 3ADGA 2JVAA 2LTRA 4LFBE 1N32E 2UUCE 4DV6E 3T1HE 3ADJA 4OOGC 1IBLE 1O0WA 1N34E 1T4OA 5IWAE 4NXNE 1IBKE 4DR5E 2RTXA 4JI5E 3HTXA 5CFFE 1RC7A 2LUQA 2LJHA 4JI6E 1HNXE 2KHXA 4DR4E 4DR1E 4LF6E 2UXBE 4KHPE 4GKKE 1DI2A 4JI2E 1HR0E 4WFTA 1YZ9A 2RS6A 2N3HA 4DR6E 2IHR1 2NA2A 4LF8E 2LBSB 4B3TE 4DKKA 4DUYE 1N33E 4DV5E 2B3TB 2NUEA 1UHZA 1J5EE 4DV2E 2L2KB 1FKAE 2NUGA 4DUZE 1WHQA 4JI7E 1XMQE 1I94E 2UU9E 3C4BA 2EZ6A 1N36E 2JY9A 2B7TA 4DV7E 4M30A 3LLHA 1X47A 2ZM6E 1J26A 4JI3E 2HHHE 4B3RE 4YHHE 4DV4E 2E5LE 4WYQB 2NUFA 4LFAE 2LRSA 2UUAE 3P1XA 1XMOE
chains in the Genus database with same CATH superfamily
4R2PA 2RPCA 1X49A 4LF9E 2DB2A 3DJWA 4X64E 2EPOA 2RS7A 2EN6A 4X8WA 5A6AA 1AH5A 2CTDA 2A25A 2L3JA 2EM3A 1PJQA 1YYOA 4GEQB 2EMAA 3MHSC 3THNA 1YYWA 4M0VA 3UK3C 2LUPB 2RSMA 3FIGA 1EKZA 2DMYA 5AASA 5T6JA 2KOUA 4R2CA 4JI4E 5IXMB 2EOYA 4ZYGA 2YRHA 5LMNE 2UUBE 1X3CA 2CPNA 2EL6A 4JYAE 2V87A 4BC9A 4R8OA 1JK1A 4M9VC 3EQ1A 1A1KA 3BGHA 3ADIA 1X6HA 3BIDA 4ZYEA 2KONA 2L3CA 3VYXA 4BHCA 2N3GA 5KL2A 3AUZA 4X66E 4M2ZA 2EMHA 3IWBA 4LU9A 2WBTA 1GTKA 2H36X 1JK2A 3ADGA 2JVAA 2LE2A 2LTRA 2K4VA 4LFBE 4WXCA 2YU5A 3T1HE 2EN1A 3ADJA 2EOZA 4TUIA 5AC4A 3HTXA 1YFHA 1MGTA 4TUGA 5LL6R 4F9BB 2EN8A 5KL5A 2PRTA 4WSGA 1B69A 1HR0E 2HGHA 4J8ZA 2EM8A 1X5WA 1F2IG 5F3WA 4P78A 1DGCA 4L5NC 5FLXC 2B3TB 2NUEA 1UHZA 3C6KA 2EM4A 3VK6A 4L8NA 1J5EE 3AV0A 5AC5A 2L2KB 1A1IA 1FKAE 2M9AA 3J81C 2NABA 3C4BA 4GZNC 5ADZA 1ZBQA 2JYAA 5A6BA 1ZR9A 2I9IA 2EQ1A 4O43A 5AE2A 4WPYA 4DV7E 2ZM6E 2E1MA 2MKDA 2WBSA 4YHHE 4DV4E 5AE1A 4R2QA 2EPAA 4WYQB 2ENHA 2EOFA 3J80C 2FGGA 3VYYA 1LLMC 1IBME 3JTZA 4JI0E 1FJGE 2EPUA 1X48A 1UN6B 4LF5E 4NXME 4R03A 3C6MA 2YTOA 3MSWA 4AQYE 2EM2A 2EQ3A 4B3ME 3IWDA 1KJKA 4LF4E 3T1YE 4R2DA 2EPXA 2EP3A 1SFEA 1SR9A 2B7VA 2M7QA 3J7AG 4IS1C 4WXDA 2EM5A 1YSAC 1PKPA 2VQFE 2YSOA 1QU6A 2EMXA 2J7JA 4KWYA 4HTGA 4X9JA 3KWRA 2EPZA 1A1GA 4BCAA 3C4TA 4O24A 2GLIA 2JR1A 2M1SA 1EH8A 1RQ0A 3J7Yp 1XNQE 4BMJA 1UILA 4ZYDA 1PJSA 2I13A 2CT1A 2VF1A 3EPHA 1IQOA 1QNTA 2YPNA 4JI1E 1RMDA 3HPSA 3EPJA 2EMKA 3JAMC 1T39A 2E72A 1O0WA 1T4OA 5IWAE 2EOMA 4DR5E 2GHFA 2LUQA 4NZVA 2JPAA 2YWQA 5IT9C 5A6JA 2KHXA 2YTPA 4N4RB 4GKKE 1DI2A 2JOXA 3THOB 4JI2E 3BBGA 2MDGA 1A1FA 2YTNA 2M4IA 4P7DA 2GPIA 2IHR1 2NA2A 2LBSB 2VE7C 4Q28A 4BHBA 1A1JA 2EPCA 4B3TE 4NHRA 1N33E 4DV5E 2YRKA 2L8TA 1NEIA 4BC7A 2EMZA 2EN7A 1G2DC 2LT7A 1I94E 4Q35B 2Q8UA 2ELZA 4O4KA 2MKNA 4DMIA 5A69A 1J26A 4JI3E 4HEIA 2HHHE 2MC5A 3ECRA 2EM6A 4B3RE 1T38A 1EH7A 2NUFA 4LFAE 4MLQA 3P1XA 1XMOE 2DRPA 3MHHC 1EH6A 4IJDA 4O5GA 1PJTA 4YY3E 1UBDC 1YYKA 2RSIA 3BF2A 4DV0E 2DMIA 4I8OA 4DR7E 2G7HA 2YRMA 2EWLA 2L92A 4OX9E 1WHNA 2JOBA 4X62E 4JV5E 2EORA 2EMYA 1IQSA 1X6EA 5KL4A 2VRDA 5A6BD 3HXLA 4GKJE 2LCEA 1A1LA 2EPLX 2EPMX 2FV4B 4K0KE 1ZBTA 2MDRA 3JU0A 2EOQA 2N8XA 5A2QC 4LFCE 1T4NA 4B3SE 1Z1BA 2UXDE 2L33A 1BBGA 1TN9A 2L2MA 2WBUA 2HC5A 5KL6A 4BBYA 4KZSA 2BB8A 2YTFA 4BS9A 1GQEA 2EMFA 3H09A 2DIXA 1N3GA 2EPNA 2UXCE 3F6HA 2EN3A 5KL3A 2LMZA 4R2EA 1WJPA 2YT4A 1YUJA 4DR2E 2BBGA 2F4VE 2V88A 2EM9A 1N32E 2UUCE 2DSYA 4DV6E 2B9DA 4OOGC 2K7IA 1N34E 4NXNE 4WSPA 2RTXA 5CFFE 1RC7A 2YTEA 3EPKA 4JI6E 3K6QA 4LF6E 2YZTA 2EMBA 1YZ9A 2WZOA 3HPZA 2N3HA 1MEYC 2EOEA 2EOJA 4DR6E 3F6GA 4LF8E 2EOOA 2V85A 4DUYE 2R76A 2NUGA 4F6MA 4DUZE 4JI7E 1XMQE 2UU9E 4R2AA 2F8BA 4RHBB 1ZU1A 2EZ6A 5A6KA 3IWCA 2B7TA 2R1FA 2V83A 3VHTB 1IMUA 3LLHA 2EL4A 4WX9A 5LLQA 1KYQA 2LVHA 1YPNA 2E5LE 2EN2A 2EOIA 3LMLA 1GZ6A 2EMWA 1XNRE 2EE8A 2YTGA 2D9HA 3KZYA 2LV2A 2JXPA 2EJ4A 2EMCA 2ELYA 2FTXB 3TQMA 1STUA 2WCC3 1PDAA 1HNZE 2EPKX 4DR3E 2ODRC 1HNWE 2EN4A 2EOSA 1TF3A 2LJUA 2YTQA 2EMLA 4JI8E 5DNYA 4R2RA 3OTOE 2HJJA 4F9CB 4LF7E 3RMPA 2DLKA 4X65E 4DV3E 2EPRA 2V86A 1P47A 2YSPA 2DGCA 4R2SA 3QG5C 1NCSA 2L2NA 2CSHA 1T4LB 2RQLA 2YTDA 3M99B 4MLVA 2VQEE 2JP9A 1G2FC 2DLQA 4DV1E 2V8QB 2V89A 3KZZA 2YU8A 3ADLA 4F6NA 5BR8E 4LTYA 2LO3A 1BB8A 2EMGA 2LTSA 2EL5A 5LMUE 4FK5C 1AAYA 2EOHA 2ENAA 5KL7A 1ZAAC 5IV8B 2EOXA 4RH8A 1IBLE 1IBKE 4JI5E 3HQ1A 2LJHA 2MC6A 1HNXE 4DR4E 4DR1E 2UXBE 1YUIA 4KHPE 5AE3A 3ZOQB 1X6FA 4WFTA 4F9AB 2RS6A 2EQ0A 1A1HA 4ZYHA 4F54A 2EM0A 1DQ3A 4DKKA 5TSEA 2YTIA 2EMIA 4DV2E 2ODRD 1WRJA 1WHQA 2EM7A 3L00A 1N36E 2JY9A 2L6MA 1TF6A 2YTJA 4M30A 1X47A 2EPPA 3DF6A 1WXRA 1L4SA 1BBOA 2ENCA 3OMLA 2LRSA 2JWOA 2UUAE 4F2JC 3EPLA 2ADRA
chains in the Genus database with same CATH topology
3J80C 1XNRE 1X49A 2FGGA 3VYYA 1IBME 3JTZA 4YY3E 4LF9E 2DB2A 4JI0E 3DJWA 1FJGE 4X64E 1X48A 1YYKA 2RS7A 4DV0E 4I8OA 4DR7E 2FTXB 4X8WA 4LF5E 4NXME 2G7HA 1STUA 2EWLA 2L92A 4OX9E 1HNZE 2L3JA 4R03A 4AQYE 3MSWA 4DR3E 1WHNA 2JOBA 2ODRC 4X62E 4B3ME 4JV5E 3IWDA 1YYOA 1HNWE 4LF4E 4GEQB 3T1YE 1YYWA 4M0VA 2LUPB 2RSMA 3FIGA 4JI8E 5DNYA 2DMYA 1SR9A 5AASA 3OTOE 1EKZA 4F9CB 2B7VA 2M7QA 5T6JA 4LF7E 3HXLA 2KOUA 3RMPA 3J7AG 4GKJE 4X65E 4DV3E 1PKPA 2VQFE 4JI4E 2V86A 2FV4B 4K0KE 1QU6A 2UUBE 5LMNE 1ZBTA 2MDRA 2CPNA 3JU0A 3KWRA 4JYAE 4BCAA 5A2QC 4LFCE 2L2NA 3C4TA 2V87A 4BC9A 1T4LB 4R8OA 1T4NA 4B3SE 2VQEE 3ADIA 2UXDE 2L33A 2L2MA 2JR1A 4DV1E 2KONA 2M1SA 2V8QB 4BBYA 2V89A 4KZSA 2L3CA 3VYXA 4BS9A 1GQEA 1RQ0A 3J7Yp 1XNQE 4BMJA 3ADLA 1UILA 5BR8E 3H09A 4LTYA 2DIXA 2UXCE 2N3GA 3AUZA 4X66E 3F6HA 2LTSA 4M2ZA 2VF1A 2LMZA 2YT4A 3IWBA 4LU9A 4DR2E 2H36X 5LMUE 4JI1E 3ADGA 2JVAA 2LE2A 2LTRA 2F4VE 2K4VA 4LFBE 2V88A 3HPSA 1N32E 2UUCE 2DSYA 4DV6E 3JAMC 3T1HE 2B9DA 3ADJA 4OOGC 1IBLE 1O0WA 1N34E 1T4OA 5IWAE 4WSPA 1IBKE 4NXNE 4DR5E 2RTXA 4TUIA 4JI5E 3HQ1A 3HTXA 5CFFE 1RC7A 4TUGA 2LUQA 2LJHA 2MC6A 5LL6R 4F9BB 4JI6E 3K6QA 1HNXE 5IT9C 2KHXA 4DR4E 4DR1E 4LF6E 2UXBE 4KHPE 4GKKE 5AE3A 3ZOQB 2JOXA 2YZTA 1DI2A 4JI2E 1HR0E 4J8ZA 4WFTA 2WZOA 3HPZA 4F9AB 1YZ9A 2RS6A 2N3HA 2M4IA 4P7DA 4DR6E 2IHR1 3F6GA 2NA2A 5F3WA 4P78A 4LF8E 4L5NC 2LBSB 2VE7C 2V85A 4Q28A 1DQ3A 4DKKA 4F54A 5FLXC 4DUYE 4B3TE 1N33E 4DV5E 2L8TA 2B3TB 4BC7A 2NUEA 1UHZA 3VK6A 4L8NA 1J5EE 4DV2E 3AV0A 2ODRD 2L2KB 1FKAE 2NUGA 4DUZE 1WHQA 4JI7E 3J81C 1XMQE 1I94E 3C4BA 2UU9E 2F8BA 5ADZA 1ZBQA 2EZ6A 1N36E 2JY9A 2L6MA 5AE2A 3IWCA 2B7TA 2V83A 4WPYA 4DV7E 4DMIA 4M30A 3LLHA 1X47A 2ZM6E 1J26A 2E1MA 3DF6A 4JI3E 1WXRA 2HHHE 2MC5A 4B3RE 4YHHE 3OMLA 4DV4E 5AE1A 2E5LE 4WYQB 2NUFA 4LFAE 2LRSA 3LMLA 2JWOA 2UUAE 3P1XA 1XMOE 1GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR E;  1X49 A;  3VYY A;  1IBM E;  4YY3 E;  4LF9 E;  2DB2 A;  4JI0 E;  1FJG E;  4X64 E;  1X48 A;  1YYK A;  2RS7 A;  4DV0 E;  4DR7 E;  4X8W A;  4LF5 E;  4NXM E;  1STU A;  4OX9 E;  1HNZ E;  2L3J A;  4AQY E;  4DR3 E;  1WHN A;  4X62 E;  4JV5 E;  1HNW E;  4B3M E;  1YYO A;  4LF4 E;  3T1Y E;  1YYW A;  2LUP B;  2RSM A;  4JI8 E;  1EKZ A;  2DMY A;  3OTO E;  2B7V A;  4LF7 E;  4GKJ E;  4X65 E;  4DV3 E;  1PKP A;  2VQF E;  4JI4 E;  4K0K E;  1QU6 A;  2UUB E;  5LMN E;  1ZBT A;  2MDR A;  2CPN A;  4JYA E;  4LFC E;  2L2N A;  3C4T A;  1T4L B;  1T4N A;  4B3S E;  2VQE E;  3ADI A;  2UXD E;  2L33 A;  2L2M A;  4DV1 E;  2L3C A;  3VYX A;  1GQE A;  1RQ0 A;  3J7Y p;  1XNQ E;  3ADL A;  1UIL A;  5BR8 E;  2DIX A;  2UXC E;  2N3G A;  4X66 E;  2LTS A;  4M2Z A;  2YT4 A;  4DR2 E;  5LMU E;  2F4V E;  4JI1 E;  3ADG A;  2JVA A;  2LTR A;  4LFB E;  1N32 E;  2UUC E;  4DV6 E;  3T1H E;  3ADJ A;  4OOG C;  1IBL E;  1O0W A;  1N34 E;  1T4O A;  5IWA E;  4NXN E;  1IBK E;  4DR5 E;  2RTX A;  4JI5 E;  3HTX A;  5CFF E;  1RC7 A;  2LUQ A;  2LJH A;  4JI6 E;  1HNX E;  2KHX A;  4DR4 E;  4DR1 E;  4LF6 E;  2UXB E;  4KHP E;  4GKK E;  1DI2 A;  4JI2 E;  1HR0 E;  4WFT A;  1YZ9 A;  2RS6 A;  2N3H A;  4DR6 E;  2IHR 1;  2NA2 A;  4LF8 E;  2LBS B;  4B3T E;  4DKK A;  4DUY E;  1N33 E;  4DV5 E;  2B3T B;  2NUE A;  1UHZ A;  1J5E E;  4DV2 E;  2L2K B;  1FKA E;  2NUG A;  4DUZ E;  1WHQ A;  4JI7 E;  1XMQ E;  1I94 E;  2UU9 E;  3C4B A;  2EZ6 A;  1N36 E;  2JY9 A;  2B7T A;  4DV7 E;  4M30 A;  3LLH A;  1X47 A;  2ZM6 E;  1J26 A;  4JI3 E;  2HHH E;  4B3R E;  4YHH E;  4DV4 E;  2E5L E;  4WYQ B;  2NUF A;  4LFA E;  2LRS A;  2UUA E;  3P1X A;  1XMO E; 
#chains in the Genus database with same CATH topology
 4R2P A;  2RPC A;  1X49 A;  4LF9 E;  2DB2 A;  3DJW A;  4X64 E;  2EPO A;  2RS7 A;  2EN6 A;  4X8W A;  5A6A A;  1AH5 A;  2CTD A;  2A25 A;  2L3J A;  2EM3 A;  1PJQ A;  1YYO A;  4GEQ B;  2EMA A;  3MHS C;  3THN A;  1YYW A;  4M0V A;  3UK3 C;  2LUP B;  2RSM A;  3FIG A;  1EKZ A;  2DMY A;  5AAS A;  5T6J A;  2KOU A;  4R2C A;  4JI4 E;  5IXM B;  2EOY A;  4ZYG A;  2YRH A;  5LMN E;  2UUB E;  1X3C A;  2CPN A;  2EL6 A;  4JYA E;  2V87 A;  4BC9 A;  4R8O A;  1JK1 A;  4M9V C;  3EQ1 A;  1A1K A;  3BGH A;  3ADI A;  1X6H A;  3BID A;  4ZYE A;  2KON A;  2L3C A;  3VYX A;  4BHC A;  2N3G A;  5KL2 A;  3AUZ A;  4X66 E;  4M2Z A;  2EMH A;  3IWB A;  4LU9 A;  2WBT A;  1GTK A;  2H36 X;  1JK2 A;  3ADG A;  2JVA A;  2LE2 A;  2LTR A;  2K4V A;  4LFB E;  4WXC A;  2YU5 A;  3T1H E;  2EN1 A;  3ADJ A;  2EOZ A;  4TUI A;  5AC4 A;  3HTX A;  1YFH A;  1MGT A;  4TUG A;  5LL6 R;  4F9B B;  2EN8 A;  5KL5 A;  2PRT A;  4WSG A;  1B69 A;  1HR0 E;  2HGH A;  4J8Z A;  2EM8 A;  1X5W A;  1F2I G;  5F3W A;  4P78 A;  1DGC A;  4L5N C;  5FLX C;  2B3T B;  2NUE A;  1UHZ A;  3C6K A;  2EM4 A;  3VK6 A;  4L8N A;  1J5E E;  3AV0 A;  5AC5 A;  2L2K B;  1A1I A;  1FKA E;  2M9A A;  3J81 C;  2NAB A;  3C4B A;  4GZN C;  5ADZ A;  1ZBQ A;  2JYA A;  5A6B A;  1ZR9 A;  2I9I A;  2EQ1 A;  4O43 A;  5AE2 A;  4WPY A;  4DV7 E;  2ZM6 E;  2E1M A;  2MKD A;  2WBS A;  4YHH E;  4DV4 E;  5AE1 A;  4R2Q A;  2EPA A;  4WYQ B;  2ENH A;  2EOF A;  3J80 C;  2FGG A;  3VYY A;  1LLM C;  1IBM E;  3JTZ A;  4JI0 E;  1FJG E;  2EPU A;  1X48 A;  1UN6 B;  4LF5 E;  4NXM E;  4R03 A;  3C6M A;  2YTO A;  3MSW A;  4AQY E;  2EM2 A;  2EQ3 A;  4B3M E;  3IWD A;  1KJK A;  4LF4 E;  3T1Y E;  4R2D A;  2EPX A;  2EP3 A;  1SFE A;  1SR9 A;  2B7V A;  2M7Q A;  3J7A G;  4IS1 C;  4WXD A;  2EM5 A;  1YSA C;  1PKP A;  2VQF E;  2YSO A;  1QU6 A;  2EMX A;  2J7J A;  4KWY A;  4HTG A;  4X9J A;  3KWR A;  2EPZ A;  1A1G A;  4BCA A;  3C4T A;  4O24 A;  2GLI A;  2JR1 A;  2M1S A;  1EH8 A;  1RQ0 A;  3J7Y p;  1XNQ E;  4BMJ A;  1UIL A;  4ZYD A;  1PJS A;  2I13 A;  2CT1 A;  2VF1 A;  3EPH A;  1IQO A;  1QNT A;  2YPN A;  4JI1 E;  1RMD A;  3HPS A;  3EPJ A;  2EMK A;  3JAM C;  1T39 A;  2E72 A;  1O0W A;  1T4O A;  5IWA E;  2EOM A;  4DR5 E;  2GHF A;  2LUQ A;  4NZV A;  2JPA A;  2YWQ A;  5IT9 C;  5A6J A;  2KHX A;  2YTP A;  4N4R B;  4GKK E;  1DI2 A;  2JOX A;  3THO B;  4JI2 E;  3BBG A;  2MDG A;  1A1F A;  2YTN A;  2M4I A;  4P7D A;  2GPI A;  2IHR 1;  2NA2 A;  2LBS B;  2VE7 C;  4Q28 A;  4BHB A;  1A1J A;  2EPC A;  4B3T E;  4NHR A;  1N33 E;  4DV5 E;  2YRK A;  2L8T A;  1NEI A;  4BC7 A;  2EMZ A;  2EN7 A;  1G2D C;  2LT7 A;  1I94 E;  4Q35 B;  2Q8U A;  2ELZ A;  4O4K A;  2MKN A;  4DMI A;  5A69 A;  1J26 A;  4JI3 E;  4HEI A;  2HHH E;  2MC5 A;  3ECR A;  2EM6 A;  4B3R E;  1T38 A;  1EH7 A;  2NUF A;  4LFA E;  4MLQ A;  3P1X A;  1XMO E;  2DRP A;  3MHH C;  1EH6 A;  4IJD A;  4O5G A;  1PJT A;  4YY3 E;  1UBD C;  1YYK A;  2RSI A;  3BF2 A;  4DV0 E;  2DMI A;  4I8O A;  4DR7 E;  2G7H A;  2YRM A;  2EWL A;  2L92 A;  4OX9 E;  1WHN A;  2JOB A;  4X62 E;  4JV5 E;  2EOR A;  2EMY A;  1IQS A;  1X6E A;  5KL4 A;  2VRD A;  5A6B D;  3HXL A;  4GKJ E;  2LCE A;  1A1L A;  2EPL X;  2EPM X;  2FV4 B;  4K0K E;  1ZBT A;  2MDR A;  3JU0 A;  2EOQ A;  2N8X A;  5A2Q C;  4LFC E;  1T4N A;  4B3S E;  1Z1B A;  2UXD E;  2L33 A;  1BBG A;  1TN9 A;  2L2M A;  2WBU A;  2HC5 A;  5KL6 A;  4BBY A;  4KZS A;  2BB8 A;  2YTF A;  4BS9 A;  1GQE A;  2EMF A;  3H09 A;  2DIX A;  1N3G A;  2EPN A;  2UXC E;  3F6H A;  2EN3 A;  5KL3 A;  2LMZ A;  4R2E A;  1WJP A;  2YT4 A;  1YUJ A;  4DR2 E;  2BBG A;  2F4V E;  2V88 A;  2EM9 A;  1N32 E;  2UUC E;  2DSY A;  4DV6 E;  2B9D A;  4OOG C;  2K7I A;  1N34 E;  4NXN E;  4WSP A;  2RTX A;  5CFF E;  1RC7 A;  2YTE A;  3EPK A;  4JI6 E;  3K6Q A;  4LF6 E;  2YZT A;  2EMB A;  1YZ9 A;  2WZO A;  3HPZ A;  2N3H A;  1MEY C;  2EOE A;  2EOJ A;  4DR6 E;  3F6G A;  4LF8 E;  2EOO A;  2V85 A;  4DUY E;  2R76 A;  2NUG A;  4F6M A;  4DUZ E;  4JI7 E;  1XMQ E;  2UU9 E;  4R2A A;  2F8B A;  4RHB B;  1ZU1 A;  2EZ6 A;  5A6K A;  3IWC A;  2B7T A;  2R1F A;  2V83 A;  3VHT B;  1IMU A;  3LLH A;  2EL4 A;  4WX9 A;  5LLQ A;  1KYQ A;  2LVH A;  1YPN A;  2E5L E;  2EN2 A;  2EOI A;  3LML A;  1GZ6 A;  2EMW A;  1XNR E;  2EE8 A;  2YTG A;  2D9H A;  3KZY A;  2LV2 A;  2JXP A;  2EJ4 A;  2EMC A;  2ELY A;  2FTX B;  3TQM A;  1STU A;  2WCC 3;  1PDA A;  1HNZ E;  2EPK X;  4DR3 E;  2ODR C;  1HNW E;  2EN4 A;  2EOS A;  1TF3 A;  2LJU A;  2YTQ A;  2EML A;  4JI8 E;  5DNY A;  4R2R A;  3OTO E;  2HJJ A;  4F9C B;  4LF7 E;  3RMP A;  2DLK A;  4X65 E;  4DV3 E;  2EPR A;  2V86 A;  1P47 A;  2YSP A;  2DGC A;  4R2S A;  3QG5 C;  1NCS A;  2L2N A;  2CSH A;  1T4L B;  2RQL A;  2YTD A;  3M99 B;  4MLV A;  2VQE E;  2JP9 A;  1G2F C;  2DLQ A;  4DV1 E;  2V8Q B;  2V89 A;  3KZZ A;  2YU8 A;  3ADL A;  4F6N A;  5BR8 E;  4LTY A;  2LO3 A;  1BB8 A;  2EMG A;  2LTS A;  2EL5 A;  5LMU E;  4FK5 C;  1AAY A;  2EOH A;  2ENA A;  5KL7 A;  1ZAA C;  5IV8 B;  2EOX A;  4RH8 A;  1IBL E;  1IBK E;  4JI5 E;  3HQ1 A;  2LJH A;  2MC6 A;  1HNX E;  4DR4 E;  4DR1 E;  2UXB E;  1YUI A;  4KHP E;  5AE3 A;  3ZOQ B;  1X6F A;  4WFT A;  4F9A B;  2RS6 A;  2EQ0 A;  1A1H A;  4ZYH A;  4F54 A;  2EM0 A;  1DQ3 A;  4DKK A;  5TSE A;  2YTI A;  2EMI A;  4DV2 E;  2ODR D;  1WRJ A;  1WHQ A;  2EM7 A;  3L00 A;  1N36 E;  2JY9 A;  2L6M A;  1TF6 A;  2YTJ A;  4M30 A;  1X47 A;  2EPP A;  3DF6 A;  1WXR A;  1L4S A;  1BBO A;  2ENC A;  3OML A;  2LRS A;  2JWO A;  2UUA E;  4F2J C;  3EPL A;  2ADR A; 
#chains in the Genus database with same CATH homology
 3J80 C;  1XNR E;  1X49 A;  2FGG A;  3VYY A;  1IBM E;  3JTZ A;  4YY3 E;  4LF9 E;  2DB2 A;  4JI0 E;  3DJW A;  1FJG E;  4X64 E;  1X48 A;  1YYK A;  2RS7 A;  4DV0 E;  4I8O A;  4DR7 E;  2FTX B;  4X8W A;  4LF5 E;  4NXM E;  2G7H A;  1STU A;  2EWL A;  2L92 A;  4OX9 E;  1HNZ E;  2L3J A;  4R03 A;  4AQY E;  3MSW A;  4DR3 E;  1WHN A;  2JOB A;  2ODR C;  4X62 E;  4B3M E;  4JV5 E;  3IWD A;  1YYO A;  1HNW E;  4LF4 E;  4GEQ B;  3T1Y E;  1YYW A;  4M0V A;  2LUP B;  2RSM A;  3FIG A;  4JI8 E;  5DNY A;  2DMY A;  1SR9 A;  5AAS A;  3OTO E;  1EKZ A;  4F9C B;  2B7V A;  2M7Q A;  5T6J A;  4LF7 E;  3HXL A;  2KOU A;  3RMP A;  3J7A G;  4GKJ E;  4X65 E;  4DV3 E;  1PKP A;  2VQF E;  4JI4 E;  2V86 A;  2FV4 B;  4K0K E;  1QU6 A;  2UUB E;  5LMN E;  1ZBT A;  2MDR A;  2CPN A;  3JU0 A;  3KWR A;  4JYA E;  4BCA A;  5A2Q C;  4LFC E;  2L2N A;  3C4T A;  2V87 A;  4BC9 A;  1T4L B;  4R8O A;  1T4N A;  4B3S E;  2VQE E;  3ADI A;  2UXD E;  2L33 A;  2L2M A;  2JR1 A;  4DV1 E;  2KON A;  2M1S A;  2V8Q B;  4BBY A;  2V89 A;  4KZS A;  2L3C A;  3VYX A;  4BS9 A;  1GQE A;  1RQ0 A;  3J7Y p;  1XNQ E;  4BMJ A;  3ADL A;  1UIL A;  5BR8 E;  3H09 A;  4LTY A;  2DIX A;  2UXC E;  2N3G A;  3AUZ A;  4X66 E;  3F6H A;  2LTS A;  4M2Z A;  2VF1 A;  2LMZ A;  2YT4 A;  3IWB A;  4LU9 A;  4DR2 E;  2H36 X;  5LMU E;  4JI1 E;  3ADG A;  2JVA A;  2LE2 A;  2LTR A;  2F4V E;  2K4V A;  4LFB E;  2V88 A;  3HPS A;  1N32 E;  2UUC E;  2DSY A;  4DV6 E;  3JAM C;  3T1H E;  2B9D A;  3ADJ A;  4OOG C;  1IBL E;  1O0W A;  1N34 E;  1T4O A;  5IWA E;  4WSP A;  1IBK E;  4NXN E;  4DR5 E;  2RTX A;  4TUI A;  4JI5 E;  3HQ1 A;  3HTX A;  5CFF E;  1RC7 A;  4TUG A;  2LUQ A;  2LJH A;  2MC6 A;  5LL6 R;  4F9B B;  4JI6 E;  3K6Q A;  1HNX E;  5IT9 C;  2KHX A;  4DR4 E;  4DR1 E;  4LF6 E;  2UXB E;  4KHP E;  4GKK E;  5AE3 A;  3ZOQ B;  2JOX A;  2YZT A;  1DI2 A;  4JI2 E;  1HR0 E;  4J8Z A;  4WFT A;  2WZO A;  3HPZ A;  4F9A B;  1YZ9 A;  2RS6 A;  2N3H A;  2M4I A;  4P7D A;  4DR6 E;  2IHR 1;  3F6G A;  2NA2 A;  5F3W A;  4P78 A;  4LF8 E;  4L5N C;  2LBS B;  2VE7 C;  2V85 A;  4Q28 A;  1DQ3 A;  4DKK A;  4F54 A;  5FLX C;  4DUY E;  4B3T E;  1N33 E;  4DV5 E;  2L8T A;  2B3T B;  4BC7 A;  2NUE A;  1UHZ A;  3VK6 A;  4L8N A;  1J5E E;  4DV2 E;  3AV0 A;  2ODR D;  2L2K B;  1FKA E;  2NUG A;  4DUZ E;  1WHQ A;  4JI7 E;  3J81 C;  1XMQ E;  1I94 E;  3C4B A;  2UU9 E;  2F8B A;  5ADZ A;  1ZBQ A;  2EZ6 A;  1N36 E;  2JY9 A;  2L6M A;  5AE2 A;  3IWC A;  2B7T A;  2V83 A;  4WPY A;  4DV7 E;  4DMI A;  4M30 A;  3LLH A;  1X47 A;  2ZM6 E;  1J26 A;  2E1M A;  3DF6 A;  4JI3 E;  1WXR A;  2HHH E;  2MC5 A;  4B3R E;  4YHH E;  3OML A;  4DV4 E;  5AE1 A;  2E5L E;  4WYQ B;  2NUF A;  4LFA E;  2LRS A;  3LML A;  2JWO A;  2UUA E;  3P1X A;  1XMO E;  1GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...