1QU6A

Structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
179
Chain Sequence
b'GSHMEMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE PKR
publication title Structure of the double-stranded RNA-binding domain of the protein kinase PKR reveals the molecular basis of its dsRNA-mediated activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 28
structure length 179
sequence length 179
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A02
4DV5E 4LFAE 4DR6E 2NUEA 4DUZE 1HNWE 3VYXA 4YY3E 4DUYE 3P1XA 1N32E 4X64E 4JI7E 4KHPE 2ZM6E 2RS6A 2DB2A 2HHHE 4LF6E 1XNQE 2UXBE 1GQEA 4JI4E 2B7TA 4JI3E 1RQ0A 2N3GA 1DI2A 2KHXA 3T1YE 1T4LB 4B3SE 1J5EE 2EZ6A 1T4NA 2VQFE 4LF9E 2L33A 2UUAE 3ADIA 2LTSA 1HNXE 4WFTA 3OTOE 1FKAE 4DV1E 3ADLA 1O0WA 2F4VE 2B3TB 4K0KE 4LF4E 2DIXA 1UHZA 1STUA 2UXCE 2L2NA 3T1HE 1X47A 4DR3E 5LMUE 3ADJA 1HR0E 2NUGA 2IHR1 2MDRA 1YYOA 4X8WA 2VQEE 1ZBTA 2CPNA 1IBKE 2NUFA 2YT4A 2UXDE 4M30A 2LJHA 4GKJE 5CFFE 4B3RE 4B3TE 2LUQA 2RTXA 3C4TA 4JI2E 4X65E 1XNRE 1HNZE 1FJGE 2JVAA 2LBSB 1N34E 4B3ME 4DV3E 4DV4E 2NA2A 4LF5E 3C4BA 1X49A 1IBLE 1QU6A 4M2ZA 1YZ9A 4JI6E 4OX9E 3LLHA 4JI1E 1T4OA 2LUPB 4DV0E 4DV6E 2UUCE 4DR4E 4LFBE 1WHQA 1EKZA 1RC7A 4NXME 1N36E 5IWAE 4LFCE 1YYKA 3J7Yp 5LMNE 2N3HA 4DV2E 4LF7E 4DR7E 4JV5E 3HTXA 1WHNA 1PKPA 2L2KB 2UU9E 2RSMA 2E5LE 4NXNE 1UILA 2L3CA 4JI0E 1N33E 2LTRA 4DV7E 2RS7A 2UUBE 1IBME 2JY9A 4JI5E 1X48A 4DR2E 4AQYE 4LF8E 1J26A 4GKKE 4JYAE 1YYWA 1XMQE 4OOGC 2L2MA 2L3JA 4DR5E 4WYQB 2B7VA 3ADGA 5BR8E 4YHHE 4DKKA 2LRSA 4DR1E 4X62E 3VYYA 2DMYA 1I94E 4X66E 4JI8E 1XMOE
chains in the Genus database with same CATH superfamily
4R2EA 2JPAA 4LFAE 2MC6A 4R2CA 2EM3A 2YRKA 1WXRA 4M9VC 1F2IG 3P1XA 4ZYGA 1N32E 3THNA 1X3CA 5DNYA 3EPLA 2EOQA 3EPJA 2CT1A 1XNQE 1DI2A 2LO3A 5LL6R 1T4LB 4F9BB 2YU8A 4WSGA 3UK3C 4Q35B 2EZ6A 3C6KA 4R2QA 2E1MA 2LTSA 2F4VE 4LF4E 1STUA 1N3GA 4R2PA 2YZTA 3TQMA 2UXCE 2CSHA 1KYQA 2EORA 4F54A 3IWCA 4M0VA 1X47A 3T1HE 5LMUE 1MGTA 2EL4A 4R2RA 4WSPA 2NUGA 1ZR9A 2EOOA 1YYOA 1MEYC 1A1FA 2KOUA 1PDAA 2UXDE 2NUFA 2YT4A 3HXLA 2EMFA 4GKJE 4B3RE 1WJPA 2YTIA 4X65E 1N34E 5FLXC 4DV4E 4LF5E 1X49A 2EN6A 2EPCA 2EOHA 4X9JA 1ZU1A 3KWRA 4OX9E 2E72A 2EQ3A 4P78A 2EM7A 4JI1E 1T4OA 4DV0E 1JK1A 2L8TA 2YTDA 1YUIA 2EMXA 2EOIA 2EPNA 1RC7A 1EKZA 1L4SA 3EPHA 2V83A 4LFCE 4LF7E 2N3HA 2R1FA 2L92A 2EM0A 2YTJA 2L2KB 2RSMA 2E5LE 4HEIA 2YRMA 2F8BA 2EN4A 4J8ZA 3DJWA 4BHCA 2WZOA 2LT7A 2V86A 2GPIA 2EQ0A 2YSPA 5T6JA 3MHSC 2JY9A 1KJKA 1BB8A 4LF8E 2M4IA 1J26A 4JYAE 1YYWA 2L3JA 2EMWA 4MLQA 4YHHE 3IWBA 1DQ3A 4DR1E 2H36X 4X62E 4F2JC 3IWDA 1TN9A 2M1SA 2WBSA 4R2DA 3M99B 4X66E 4DV5E 2LCEA 2EMGA 3VHTB 4YY3E 2ADRA 1IQSA 2V87A 2ZM6E 2DLKA 4ZYEA 2VRDA 2BB8A 2DB2A 1T38A 2HHHE 2UXBE 2JOXA 1GQEA 4JI3E 2EPOA 2FV4B 4MLVA 3VK6A 1LLMC 2WCC3 1A1LA 4LF9E 2L33A 1HNXE 3OTOE 4R2SA 1FKAE 3ADLA 1O0WA 2JR1A 2B3TB 2EMAA 4F6NA 4K0KE 2EN7A 2EM9A 1UHZA 3BIDA 4BCAA 3ADJA 2EOMA 2IHR1 3MSWA 4X8WA 2CPNA 1X6EA 2LJHA 4L8NA 2RTXA 4R8OA 2ELZA 4JI2E 1DGCA 1XNRE 1HNZE 2K7IA 2JVAA 1YFHA 2LBSB 2EE8A 4R03A 3C4BA 2JXPA 4F9AB 1QU6A 4M2ZA 3OMLA 2YTOA 2V88A 5LLQA 2GHFA 3F6HA 4Q28A 1SR9A 2Q8UA 2YRHA 2UUCE 2NABA 1BBOA 2D9HA 5A6JA 2V8QB 1A1HA 1YYKA 2ENCA 4WXCA 4WPYA 1WHNA 1PKPA 3MHHC 4N4RB 2JWOA 4NXNE 4L5NC 2HC5A 2L3CA 2JYAA 5AC5A 2YU5A 4JI0E 1EH6A 4DV7E 3RMPA 2EPZA 2RS7A 5F3WA 2UUBE 1WRJA 4JI5E 4TUGA 1X48A 2EMYA 2DLQA 4GKKE 4WX9A 4OOGC 5KL4A 4DR5E 2EM2A 2V85A 2LE2A 5BR8E 3KZYA 4DMIA 2B9DA 1NEIA 4FK5C 5KL3A 2G7HA 1JK2A 1A1JA 2I13A 4JI8E 5A6BD 4DR6E 5AE3A 2PRTA 2NUEA 4DUZE 3VYXA 4O43A 2LV2A 4DUYE 2WBTA 2EPRA 2ENHA 5KL7A 4X64E 4JI7E 2K4VA 4KZSA 4KHPE 2HJJA 2YTFA 1YSAC 2MKNA 2EPAA 1RQ0A 2N3GA 1P47A 5KL6A 3QG5C 2EN2A 2EPKX 2EL5A 3JTZA 1T4NA 1T39A 3ADIA 5IT9C 2I9IA 4GZNC 2DIXA 2YPNA 5IXMB 4O5GA 2DSYA 2EMLA 4BC7A 1ZAAC 2FTXB 2RPCA 3DF6A 4RH8A 2ODRC 1BBGA 2A25A 3AV0A 4O24A 2GLIA 1HR0E 3JAMC 2VQEE 2EM4A 1ZBQA 1ZBTA 5A6KA 2N8XA 1B69A 4IJDA 5CFFE 2EOYA 2LUQA 3C4TA 2JOBA 5ADZA 2EWLA 3BF2A 2VF1A 4DV3E 4WXDA 4B3ME 2EMZA 1YZ9A 2YTPA 4F6MA 3LLHA 2V89A 5AE1A 2BBGA 2LUPB 2HGHA 4DV6E 4DR4E 2EM5A 4NXME 3KZZA 1N36E 1TF3A 2M9AA 1PJSA 4I8OA 5A6AA 3J7Yp 4DV2E 2EMKA 1NCSA 2EMCA 2EL6A 3HTXA 4ZYDA 2UU9E 2FGGA 1UILA 2EPXA 4HTGA 1N33E 1YPNA 2LTRA 1X5WA 4BMJA 5KL2A 2LMZA 2RQLA 5AE2A 2R76A 5A69A 1IBME 4AQYE 2JP9A 4BBYA 1EH8A 3EPKA 2EM6A 2LJUA 4O4KA 1A1KA 3BBGA 2EMIA 4WYQB 1PJTA 1QNTA 2B7VA 2RSIA 3ADGA 1GTKA 2EPLX 3H09A 4DKKA 2EQ1A 4NHRA 4ZYHA 3JU0A 1I94E 4BS9A 5AC4A 2ELYA 1XMOE 1X6HA 1A1GA 1X6FA 3FIGA 1HNWE 1A1IA 2EMBA 2EOFA 1UN6B 2WBUA 3HQ1A 3ZOQB 2RS6A 4LF6E 4JI4E 3HPSA 2B7TA 3AUZA 2KHXA 3T1YE 4B3SE 2ODRD 1GZ6A 4P7DA 1J5EE 5AASA 2KONA 2VQFE 2UUAE 4KWYA 4IS1C 4WFTA 1RMDA 2EMHA 4DV1E 2EPPA 5A2QC 3K6QA 4F9CB 1EH7A 2L2NA 3L00A 1SFEA 4R2AA 4DR3E 2L6MA 3EQ1A 2YWQA 2MDRA 2VE7C 1UBDC 1IBKE 2EN3A 4M30A 2CTDA 2EP3A 2DRPA 4B3TE 5KL5A 4BC9A 2MDGA 1FJGE 1PJQA 1TF6A 1AH5A 2EJ4A 2NA2A 2YSOA 4GEQB 5A6BA 3BGHA 3C6MA 1IBLE 1IMUA 1G2FC 2DMIA 2EN1A 4JI6E 2EOXA 2DGCA 1YUJA 3J7AG 4LFBE 1WHQA 4LU9A 2YTNA 3LMLA 2MKDA 5IWAE 2EM8A 2EOSA 4NZVA 2M7QA 5LMNE 4DR7E 4BHBA 4JV5E 1AAYA 4TUIA 3J81C 2YTGA 3ECRA 3J80C 1G2DC 2YTQA 4RHBB 2EOZA 5IV8B 4DR2E 2EPMX 2LVHA 3HPZA 2MC5A 2EPUA 4LTYA 2EOJA 2YTEA 1XMQE 2L2MA 3THOB 1IQOA 2EOEA 2LRSA 1Z1BA 5TSEA 3VYYA 3F6GA 2DMYA 2EN8A 2ENAA 2J7JA
chains in the Genus database with same CATH topology
4DV5E 4LFAE 5AE3A 2MC6A 4DR6E 3FIGA 2NUEA 4DUZE 1HNWE 3VYXA 1WXRA 4YY3E 4DUYE 3P1XA 1N32E 2V87A 5DNYA 4X64E 4JI7E 2K4VA 4KZSA 4KHPE 2ZM6E 3HQ1A 3ZOQB 2RS6A 2DB2A 2HHHE 4LF6E 1XNQE 2JOXA 2UXBE 1GQEA 3HPSA 4JI4E 2B7TA 3AUZA 1RQ0A 2N3GA 4JI3E 2KHXA 1DI2A 3T1YE 5LL6R 1T4LB 4B3SE 2ODRD 1GZ6A 2FV4B 4P7DA 4F9BB 3JTZA 1J5EE 3VK6A 2EZ6A 1T4NA 5AASA 2KONA 2VQFE 2E1MA 4LF9E 2L33A 2UUAE 3ADIA 2LTSA 1HNXE 4WFTA 3OTOE 1FKAE 5IT9C 4DV1E 3ADLA 1O0WA 2JR1A 2B3TB 2F4VE 5A2QC 4K0KE 4LF4E 2DIXA 1UHZA 1STUA 3K6QA 4F9CB 2UXCE 2YZTA 2DSYA 4BC7A 2L2NA 2FTXB 3DF6A 4BCAA 4F54A 2ODRC 3AV0A 3IWCA 4M0VA 1X47A 4DR3E 3T1HE 5LMUE 3ADJA 2L6MA 1HR0E 4WSPA 2NUGA 2IHR1 2MDRA 3JAMC 3MSWA 1YYOA 4X8WA 2VE7C 2VQEE 1ZBQA 2KOUA 1ZBTA 2CPNA 1IBKE 2NUFA 2YT4A 2UXDE 3HXLA 4M30A 2LJHA 4L8NA 5CFFE 4B3RE 4GKJE 4B3TE 2LUQA 2RTXA 3C4TA 4R8OA 4BC9A 4JI2E 2JOBA 5ADZA 4X65E 1HNZE 2EWLA 1FJGE 1XNRE 2JVAA 2LBSB 1N34E 2VF1A 4DV3E 5FLXC 4DV4E 4B3ME 2NA2A 4GEQB 4R03A 4LF5E 3C4BA 1X49A 4F9AB 1IBLE 1QU6A 4M2ZA 3OMLA 1YZ9A 4JI6E 3KWRA 4OX9E 2V88A 3LLHA 4P78A 2V89A 5AE1A 4JI1E 1T4OA 2LUPB 4DV0E 2L8TA 3F6HA 4Q28A 1SR9A 4DV6E 2UUCE 3J7AG 4DR4E 4LFBE 1WHQA 4LU9A 1EKZA 1RC7A 4NXME 3LMLA 1N36E 2V83A 5IWAE 4I8OA 4LFCE 2V8QB 2M7QA 3J7Yp 2N3HA 5LMNE 4DV2E 4LF7E 1YYKA 4DR7E 4JV5E 2L92A 4WPYA 3HTXA 1WHNA 1PKPA 2L2KB 4TUIA 2UU9E 2FGGA 2JWOA 2RSMA 2E5LE 3J81C 4NXNE 1UILA 4L5NC 2L3CA 2F8BA 4J8ZA 3DJWA 4JI0E 2WZOA 1N33E 2V86A 2LTRA 3J80C 4DV7E 4BMJA 3RMPA 2LMZA 2RS7A 5AE2A 5F3WA 2UUBE 5T6JA 1IBME 2JY9A 4JI5E 4TUGA 1X48A 4DR2E 4AQYE 4LF8E 2M4IA 4BBYA 1J26A 3HPZA 4GKKE 4JYAE 2MC5A 1YYWA 4LTYA 1XMQE 4OOGC 2L2MA 2L3JA 4DR5E 4WYQB 2V85A 2LE2A 2B7VA 3ADGA 5BR8E 4YHHE 3H09A 4DKKA 2LRSA 3IWBA 1DQ3A 4DMIA 4DR1E 2H36X 2B9DA 4X62E 3IWDA 3VYYA 2G7HA 2M1SA 3F6GA 3JU0A 2DMYA 1I94E 4BS9A 4X66E 4JI8E 1XMOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 E;  4LFA E;  4DR6 E;  2NUE A;  4DUZ E;  1HNW E;  3VYX A;  4YY3 E;  4DUY E;  3P1X A;  1N32 E;  4X64 E;  4JI7 E;  4KHP E;  2ZM6 E;  2RS6 A;  2DB2 A;  2HHH E;  4LF6 E;  1XNQ E;  2UXB E;  1GQE A;  4JI4 E;  2B7T A;  4JI3 E;  1RQ0 A;  2N3G A;  1DI2 A;  2KHX A;  3T1Y E;  1T4L B;  4B3S E;  1J5E E;  2EZ6 A;  1T4N A;  2VQF E;  4LF9 E;  2L33 A;  2UUA E;  3ADI A;  2LTS A;  1HNX E;  4WFT A;  3OTO E;  1FKA E;  4DV1 E;  3ADL A;  1O0W A;  2F4V E;  2B3T B;  4K0K E;  4LF4 E;  2DIX A;  1UHZ A;  1STU A;  2UXC E;  2L2N A;  3T1H E;  1X47 A;  4DR3 E;  5LMU E;  3ADJ A;  1HR0 E;  2NUG A;  2IHR 1;  2MDR A;  1YYO A;  4X8W A;  2VQE E;  1ZBT A;  2CPN A;  1IBK E;  2NUF A;  2YT4 A;  2UXD E;  4M30 A;  2LJH A;  4GKJ E;  5CFF E;  4B3R E;  4B3T E;  2LUQ A;  2RTX A;  3C4T A;  4JI2 E;  4X65 E;  1XNR E;  1HNZ E;  1FJG E;  2JVA A;  2LBS B;  1N34 E;  4B3M E;  4DV3 E;  4DV4 E;  2NA2 A;  4LF5 E;  3C4B A;  1X49 A;  1IBL E;  1QU6 A;  4M2Z A;  1YZ9 A;  4JI6 E;  4OX9 E;  3LLH A;  4JI1 E;  1T4O A;  2LUP B;  4DV0 E;  4DV6 E;  2UUC E;  4DR4 E;  4LFB E;  1WHQ A;  1EKZ A;  1RC7 A;  4NXM E;  1N36 E;  5IWA E;  4LFC E;  1YYK A;  3J7Y p;  5LMN E;  2N3H A;  4DV2 E;  4LF7 E;  4DR7 E;  4JV5 E;  3HTX A;  1WHN A;  1PKP A;  2L2K B;  2UU9 E;  2RSM A;  2E5L E;  4NXN E;  1UIL A;  2L3C A;  4JI0 E;  1N33 E;  2LTR A;  4DV7 E;  2RS7 A;  2UUB E;  1IBM E;  2JY9 A;  4JI5 E;  1X48 A;  4DR2 E;  4AQY E;  4LF8 E;  1J26 A;  4GKK E;  4JYA E;  1YYW A;  1XMQ E;  4OOG C;  2L2M A;  2L3J A;  4DR5 E;  4WYQ B;  2B7V A;  3ADG A;  5BR8 E;  4YHH E;  4DKK A;  2LRS A;  4DR1 E;  4X62 E;  3VYY A;  2DMY A;  1I94 E;  4X66 E;  4JI8 E;  1XMO E; 
#chains in the Genus database with same CATH topology
 4R2E A;  2JPA A;  4LFA E;  2MC6 A;  4R2C A;  2EM3 A;  2YRK A;  1WXR A;  4M9V C;  1F2I G;  3P1X A;  4ZYG A;  1N32 E;  3THN A;  1X3C A;  5DNY A;  3EPL A;  2EOQ A;  3EPJ A;  2CT1 A;  1XNQ E;  1DI2 A;  2LO3 A;  5LL6 R;  1T4L B;  4F9B B;  2YU8 A;  4WSG A;  3UK3 C;  4Q35 B;  2EZ6 A;  3C6K A;  4R2Q A;  2E1M A;  2LTS A;  2F4V E;  4LF4 E;  1STU A;  1N3G A;  4R2P A;  2YZT A;  3TQM A;  2UXC E;  2CSH A;  1KYQ A;  2EOR A;  4F54 A;  3IWC A;  4M0V A;  1X47 A;  3T1H E;  5LMU E;  1MGT A;  2EL4 A;  4R2R A;  4WSP A;  2NUG A;  1ZR9 A;  2EOO A;  1YYO A;  1MEY C;  1A1F A;  2KOU A;  1PDA A;  2UXD E;  2NUF A;  2YT4 A;  3HXL A;  2EMF A;  4GKJ E;  4B3R E;  1WJP A;  2YTI A;  4X65 E;  1N34 E;  5FLX C;  4DV4 E;  4LF5 E;  1X49 A;  2EN6 A;  2EPC A;  2EOH A;  4X9J A;  1ZU1 A;  3KWR A;  4OX9 E;  2E72 A;  2EQ3 A;  4P78 A;  2EM7 A;  4JI1 E;  1T4O A;  4DV0 E;  1JK1 A;  2L8T A;  2YTD A;  1YUI A;  2EMX A;  2EOI A;  2EPN A;  1RC7 A;  1EKZ A;  1L4S A;  3EPH A;  2V83 A;  4LFC E;  4LF7 E;  2N3H A;  2R1F A;  2L92 A;  2EM0 A;  2YTJ A;  2L2K B;  2RSM A;  2E5L E;  4HEI A;  2YRM A;  2F8B A;  2EN4 A;  4J8Z A;  3DJW A;  4BHC A;  2WZO A;  2LT7 A;  2V86 A;  2GPI A;  2EQ0 A;  2YSP A;  5T6J A;  3MHS C;  2JY9 A;  1KJK A;  1BB8 A;  4LF8 E;  2M4I A;  1J26 A;  4JYA E;  1YYW A;  2L3J A;  2EMW A;  4MLQ A;  4YHH E;  3IWB A;  1DQ3 A;  4DR1 E;  2H36 X;  4X62 E;  4F2J C;  3IWD A;  1TN9 A;  2M1S A;  2WBS A;  4R2D A;  3M99 B;  4X66 E;  4DV5 E;  2LCE A;  2EMG A;  3VHT B;  4YY3 E;  2ADR A;  1IQS A;  2V87 A;  2ZM6 E;  2DLK A;  4ZYE A;  2VRD A;  2BB8 A;  2DB2 A;  1T38 A;  2HHH E;  2UXB E;  2JOX A;  1GQE A;  4JI3 E;  2EPO A;  2FV4 B;  4MLV A;  3VK6 A;  1LLM C;  2WCC 3;  1A1L A;  4LF9 E;  2L33 A;  1HNX E;  3OTO E;  4R2S A;  1FKA E;  3ADL A;  1O0W A;  2JR1 A;  2B3T B;  2EMA A;  4F6N A;  4K0K E;  2EN7 A;  2EM9 A;  1UHZ A;  3BID A;  4BCA A;  3ADJ A;  2EOM A;  2IHR 1;  3MSW A;  4X8W A;  2CPN A;  1X6E A;  2LJH A;  4L8N A;  2RTX A;  4R8O A;  2ELZ A;  4JI2 E;  1DGC A;  1XNR E;  1HNZ E;  2K7I A;  2JVA A;  1YFH A;  2LBS B;  2EE8 A;  4R03 A;  3C4B A;  2JXP A;  4F9A B;  1QU6 A;  4M2Z A;  3OML A;  2YTO A;  2V88 A;  5LLQ A;  2GHF A;  3F6H A;  4Q28 A;  1SR9 A;  2Q8U A;  2YRH A;  2UUC E;  2NAB A;  1BBO A;  2D9H A;  5A6J A;  2V8Q B;  1A1H A;  1YYK A;  2ENC A;  4WXC A;  4WPY A;  1WHN A;  1PKP A;  3MHH C;  4N4R B;  2JWO A;  4NXN E;  4L5N C;  2HC5 A;  2L3C A;  2JYA A;  5AC5 A;  2YU5 A;  4JI0 E;  1EH6 A;  4DV7 E;  3RMP A;  2EPZ A;  2RS7 A;  5F3W A;  2UUB E;  1WRJ A;  4JI5 E;  4TUG A;  1X48 A;  2EMY A;  2DLQ A;  4GKK E;  4WX9 A;  4OOG C;  5KL4 A;  4DR5 E;  2EM2 A;  2V85 A;  2LE2 A;  5BR8 E;  3KZY A;  4DMI A;  2B9D A;  1NEI A;  4FK5 C;  5KL3 A;  2G7H A;  1JK2 A;  1A1J A;  2I13 A;  4JI8 E;  5A6B D;  4DR6 E;  5AE3 A;  2PRT A;  2NUE A;  4DUZ E;  3VYX A;  4O43 A;  2LV2 A;  4DUY E;  2WBT A;  2EPR A;  2ENH A;  5KL7 A;  4X64 E;  4JI7 E;  2K4V A;  4KZS A;  4KHP E;  2HJJ A;  2YTF A;  1YSA C;  2MKN A;  2EPA A;  1RQ0 A;  2N3G A;  1P47 A;  5KL6 A;  3QG5 C;  2EN2 A;  2EPK X;  2EL5 A;  3JTZ A;  1T4N A;  1T39 A;  3ADI A;  5IT9 C;  2I9I A;  4GZN C;  2DIX A;  2YPN A;  5IXM B;  4O5G A;  2DSY A;  2EML A;  4BC7 A;  1ZAA C;  2FTX B;  2RPC A;  3DF6 A;  4RH8 A;  2ODR C;  1BBG A;  2A25 A;  3AV0 A;  4O24 A;  2GLI A;  1HR0 E;  3JAM C;  2VQE E;  2EM4 A;  1ZBQ A;  1ZBT A;  5A6K A;  2N8X A;  1B69 A;  4IJD A;  5CFF E;  2EOY A;  2LUQ A;  3C4T A;  2JOB A;  5ADZ A;  2EWL A;  3BF2 A;  2VF1 A;  4DV3 E;  4WXD A;  4B3M E;  2EMZ A;  1YZ9 A;  2YTP A;  4F6M A;  3LLH A;  2V89 A;  5AE1 A;  2BBG A;  2LUP B;  2HGH A;  4DV6 E;  4DR4 E;  2EM5 A;  4NXM E;  3KZZ A;  1N36 E;  1TF3 A;  2M9A A;  1PJS A;  4I8O A;  5A6A A;  3J7Y p;  4DV2 E;  2EMK A;  1NCS A;  2EMC A;  2EL6 A;  3HTX A;  4ZYD A;  2UU9 E;  2FGG A;  1UIL A;  2EPX A;  4HTG A;  1N33 E;  1YPN A;  2LTR A;  1X5W A;  4BMJ A;  5KL2 A;  2LMZ A;  2RQL A;  5AE2 A;  2R76 A;  5A69 A;  1IBM E;  4AQY E;  2JP9 A;  4BBY A;  1EH8 A;  3EPK A;  2EM6 A;  2LJU A;  4O4K A;  1A1K A;  3BBG A;  2EMI A;  4WYQ B;  1PJT A;  1QNT A;  2B7V A;  2RSI A;  3ADG A;  1GTK A;  2EPL X;  3H09 A;  4DKK A;  2EQ1 A;  4NHR A;  4ZYH A;  3JU0 A;  1I94 E;  4BS9 A;  5AC4 A;  2ELY A;  1XMO E;  1X6H A;  1A1G A;  1X6F A;  3FIG A;  1HNW E;  1A1I A;  2EMB A;  2EOF A;  1UN6 B;  2WBU A;  3HQ1 A;  3ZOQ B;  2RS6 A;  4LF6 E;  4JI4 E;  3HPS A;  2B7T A;  3AUZ A;  2KHX A;  3T1Y E;  4B3S E;  2ODR D;  1GZ6 A;  4P7D A;  1J5E E;  5AAS A;  2KON A;  2VQF E;  2UUA E;  4KWY A;  4IS1 C;  4WFT A;  1RMD A;  2EMH A;  4DV1 E;  2EPP A;  5A2Q C;  3K6Q A;  4F9C B;  1EH7 A;  2L2N A;  3L00 A;  1SFE A;  4R2A A;  4DR3 E;  2L6M A;  3EQ1 A;  2YWQ A;  2MDR A;  2VE7 C;  1UBD C;  1IBK E;  2EN3 A;  4M30 A;  2CTD A;  2EP3 A;  2DRP A;  4B3T E;  5KL5 A;  4BC9 A;  2MDG A;  1FJG E;  1PJQ A;  1TF6 A;  1AH5 A;  2EJ4 A;  2NA2 A;  2YSO A;  4GEQ B;  5A6B A;  3BGH A;  3C6M A;  1IBL E;  1IMU A;  1G2F C;  2DMI A;  2EN1 A;  4JI6 E;  2EOX A;  2DGC A;  1YUJ A;  3J7A G;  4LFB E;  1WHQ A;  4LU9 A;  2YTN A;  3LML A;  2MKD A;  5IWA E;  2EM8 A;  2EOS A;  4NZV A;  2M7Q A;  5LMN E;  4DR7 E;  4BHB A;  4JV5 E;  1AAY A;  4TUI A;  3J81 C;  2YTG A;  3ECR A;  3J80 C;  1G2D C;  2YTQ A;  4RHB B;  2EOZ A;  5IV8 B;  4DR2 E;  2EPM X;  2LVH A;  3HPZ A;  2MC5 A;  2EPU A;  4LTY A;  2EOJ A;  2YTE A;  1XMQ E;  2L2M A;  3THO B;  1IQO A;  2EOE A;  2LRS A;  1Z1B A;  5TSE A;  3VYY A;  3F6G A;  2DMY A;  2EN8 A;  2ENA A;  2J7J A; 
#chains in the Genus database with same CATH homology
 4DV5 E;  4LFA E;  5AE3 A;  2MC6 A;  4DR6 E;  3FIG A;  2NUE A;  4DUZ E;  1HNW E;  3VYX A;  1WXR A;  4YY3 E;  4DUY E;  3P1X A;  1N32 E;  2V87 A;  5DNY A;  4X64 E;  4JI7 E;  2K4V A;  4KZS A;  4KHP E;  2ZM6 E;  3HQ1 A;  3ZOQ B;  2RS6 A;  2DB2 A;  2HHH E;  4LF6 E;  1XNQ E;  2JOX A;  2UXB E;  1GQE A;  3HPS A;  4JI4 E;  2B7T A;  3AUZ A;  1RQ0 A;  2N3G A;  4JI3 E;  2KHX A;  1DI2 A;  3T1Y E;  5LL6 R;  1T4L B;  4B3S E;  2ODR D;  1GZ6 A;  2FV4 B;  4P7D A;  4F9B B;  3JTZ A;  1J5E E;  3VK6 A;  2EZ6 A;  1T4N A;  5AAS A;  2KON A;  2VQF E;  2E1M A;  4LF9 E;  2L33 A;  2UUA E;  3ADI A;  2LTS A;  1HNX E;  4WFT A;  3OTO E;  1FKA E;  5IT9 C;  4DV1 E;  3ADL A;  1O0W A;  2JR1 A;  2B3T B;  2F4V E;  5A2Q C;  4K0K E;  4LF4 E;  2DIX A;  1UHZ A;  1STU A;  3K6Q A;  4F9C B;  2UXC E;  2YZT A;  2DSY A;  4BC7 A;  2L2N A;  2FTX B;  3DF6 A;  4BCA A;  4F54 A;  2ODR C;  3AV0 A;  3IWC A;  4M0V A;  1X47 A;  4DR3 E;  3T1H E;  5LMU E;  3ADJ A;  2L6M A;  1HR0 E;  4WSP A;  2NUG A;  2IHR 1;  2MDR A;  3JAM C;  3MSW A;  1YYO A;  4X8W A;  2VE7 C;  2VQE E;  1ZBQ A;  2KOU A;  1ZBT A;  2CPN A;  1IBK E;  2NUF A;  2YT4 A;  2UXD E;  3HXL A;  4M30 A;  2LJH A;  4L8N A;  5CFF E;  4B3R E;  4GKJ E;  4B3T E;  2LUQ A;  2RTX A;  3C4T A;  4R8O A;  4BC9 A;  4JI2 E;  2JOB A;  5ADZ A;  4X65 E;  1HNZ E;  2EWL A;  1FJG E;  1XNR E;  2JVA A;  2LBS B;  1N34 E;  2VF1 A;  4DV3 E;  5FLX C;  4DV4 E;  4B3M E;  2NA2 A;  4GEQ B;  4R03 A;  4LF5 E;  3C4B A;  1X49 A;  4F9A B;  1IBL E;  1QU6 A;  4M2Z A;  3OML A;  1YZ9 A;  4JI6 E;  3KWR A;  4OX9 E;  2V88 A;  3LLH A;  4P78 A;  2V89 A;  5AE1 A;  4JI1 E;  1T4O A;  2LUP B;  4DV0 E;  2L8T A;  3F6H A;  4Q28 A;  1SR9 A;  4DV6 E;  2UUC E;  3J7A G;  4DR4 E;  4LFB E;  1WHQ A;  4LU9 A;  1EKZ A;  1RC7 A;  4NXM E;  3LML A;  1N36 E;  2V83 A;  5IWA E;  4I8O A;  4LFC E;  2V8Q B;  2M7Q A;  3J7Y p;  2N3H A;  5LMN E;  4DV2 E;  4LF7 E;  1YYK A;  4DR7 E;  4JV5 E;  2L92 A;  4WPY A;  3HTX A;  1WHN A;  1PKP A;  2L2K B;  4TUI A;  2UU9 E;  2FGG A;  2JWO A;  2RSM A;  2E5L E;  3J81 C;  4NXN E;  1UIL A;  4L5N C;  2L3C A;  2F8B A;  4J8Z A;  3DJW A;  4JI0 E;  2WZO A;  1N33 E;  2V86 A;  2LTR A;  3J80 C;  4DV7 E;  4BMJ A;  3RMP A;  2LMZ A;  2RS7 A;  5AE2 A;  5F3W A;  2UUB E;  5T6J A;  1IBM E;  2JY9 A;  4JI5 E;  4TUG A;  1X48 A;  4DR2 E;  4AQY E;  4LF8 E;  2M4I A;  4BBY A;  1J26 A;  3HPZ A;  4GKK E;  4JYA E;  2MC5 A;  1YYW A;  4LTY A;  1XMQ E;  4OOG C;  2L2M A;  2L3J A;  4DR5 E;  4WYQ B;  2V85 A;  2LE2 A;  2B7V A;  3ADG A;  5BR8 E;  4YHH E;  3H09 A;  4DKK A;  2LRS A;  3IWB A;  1DQ3 A;  4DMI A;  4DR1 E;  2H36 X;  2B9D A;  4X62 E;  3IWD A;  3VYY A;  2G7H A;  2M1S A;  3F6G A;  3JU0 A;  2DMY A;  1I94 E;  4BS9 A;  4X66 E;  4JI8 E;  1XMO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...