1QU6A

Structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
179
Chain Sequence
GSHMEMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN KINASE PKR
publication title Structure of the double-stranded RNA-binding domain of the protein kinase PKR reveals the molecular basis of its dsRNA-mediated activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 179
sequence length 179
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A02
2NUGA 1J5EE 4DUYE 2RTXA 2B7VA 4AQYE 4X66E 1UHZA 4DR6E 4B3RE 4LF9E 2MDRA 1RC7A 2HHHE 4X8WA 4DV4E 4DR3E 4GKKE 2DMYA 1I94E 4OX9E 2UXCE 1IBKE 2UUCE 5IWAE 2VQEE 4NXNE 4WFTA 5BR8E 1HNXE 2NUFA 4K0KE 4DR1E 4B3ME 1WHNA 3ADGA 2L3CA 2RSMA 2E5LE 1XNRE 4DV1E 1HNZE 4GKJE 4DV2E 2UUAE 2UUBE 1RQ0A 1YZ9A 1N36E 4JI7E 2RS6A 3ADLA 4LF6E 2UXDE 4JI6E 4LF7E 4X62E 2KHXA 2B3TB 2JVAA 4DR7E 1O0WA 2L2MA 4M30A 2ZM6E 3ADJA 3T1YE 1IBME 1STUA 4DR4E 2LTRA 2RS7A 1QU6A 2LUPB 2F4VE 4JYAE 2L2NA 4JI5E 4B3TE 1FKAE 4LFAE 3VYXA 4X65E 4LFCE 2NUEA 2LJHA 2L33A 1T4LB 2VQFE 2NA2A 1N33E 2CPNA 1YYKA 1X49A 2YT4A 4YY3E 4JI2E 1N34E 1T4OA 4YHHE 1XNQE 1DI2A 4DR2E 4JI1E 2L3JA 3ADIA 2L2KB 5CFFE 1YYOA 4JI3E 2DIXA 1HR0E 3HTXA 2LUQA 4DV7E 3C4TA 1X47A 2IHR1 5LMNE 2LTSA 1FJGE 4DV0E 3T1HE 3VYYA 2LBSB 4DUZE 2UU9E 1HNWE 4LF5E 1EKZA 4JI8E 1J26A 1T4NA 2JY9A 4DV5E 1XMQE 3P1XA 4JV5E 4LFBE 2N3GA 4LF4E 1GQEA 3OTOE 2LRSA 4OOGC 4B3SE 4X64E 1UILA 4NXME 1N32E 4LF8E 4M2ZA 4DV3E 5LMUE 4JI0E 3C4BA 4KHPE 2EZ6A 1YYWA 1XMOE 1ZBTA 3J7Yp 4DR5E 2DB2A 3LLHA 1PKPA 1IBLE 4DKKA 4JI4E 1WHQA 2UXBE 2B7TA 4WYQB 4DV6E 2N3HA 1X48A
chains in the Genus database with same CATH superfamily
4GZNC 4DUYE 2RTXA 2B7VA 4AQYE 2EPOA 5FLXC 1UHZA 2YZTA 2GLIA 2EPCA 4R03A 2YPNA 4LF9E 5AC5A 4X9JA 2EN3A 4R2SA 4DV4E 1GZ6A 1T39A 1ZU1A 5IT9C 4GKKE 2ODRD 1Z1BA 4OX9E 2YRKA 2LV2A 2DSYA 3HXLA 2VQEE 4NXNE 2V87A 3MSWA 2R1FA 1YUJA 4DR1E 4BHCA 2DRPA 1X3CA 2RPCA 1N3GA 1WHNA 2E5LE 4DV1E 2EOYA 4GKJE 2V85A 2LJUA 1PJTA 4O24A 2HGHA 4BBYA 2EWLA 1IQOA 2EOHA 4DR7E 2Q8UA 2L2MA 3ZOQB 2YSPA 1WRJA 2EOMA 1QU6A 2BB8A 2EPRA 3J81C 1T38A 2EMZA 2EQ3A 4JYAE 4JI5E 3HQ1A 4LFAE 1FKAE 4M0VA 4X65E 2EMCA 2EM2A 1MEYC 2L33A 4R2PA 3ECRA 4N4RB 3QG5C 2E1MA 5AASA 2EM7A 2EL4A 3IWCA 4F54A 2EOXA 4NZVA 4O4KA 2L2KB 5CFFE 4JI3E 2DIXA 2ELYA 2EMBA 4F2JC 2RSIA 2LUQA 4F9AB 5LMNE 4DV0E 2G7HA 4NHRA 5IXMB 4BC9A 2EMHA 1J26A 2M1SA 2JY9A 4JV5E 4P78A 3P1XA 4BMJA 4WXDA 5KL6A 1GQEA 3OTOE 2LRSA 2RQLA 2GHFA 2YTDA 5A6BA 4X64E 2EOQA 1N32E 5LMUE 2EMAA 2EPPA 2YTPA 4F9CB 3EPLA 3HPSA 2EN1A 2FGGA 2EP3A 4JI4E 2UXBE 1AAYA 2FTXB 1TF3A 2N3HA 1A1FA 1A1IA 1L4SA 4TUIA 1G2DC 4X66E 4F9BB 2HC5A 4B3RE 3EPKA 2V86A 4MLQA 2HHHE 4X8WA 1QNTA 4I8OA 4DR3E 2DMYA 2YTOA 4F6NA 1RMDA 2K7IA 3KZZA 1X6FA 1HNXE 4K0KE 5KL5A 2EMWA 4B3ME 3ADGA 2RSMA 2WBTA 2ADRA 1XNRE 2M9AA 1KYQA 2UUAE 1A1KA 2CT1A 2UUBE 2RS6A 2EN6A 3J80C 4LF6E 4JI6E 2LO3A 1JK2A 1BBGA 2ENHA 1YFHA 1YPNA 2JYAA 2B3TB 2JVAA 2M7QA 4M30A 2ZM6E 2JR1A 3MHHC 3AV0A 2F4VE 3BGHA 2JOBA 5AE3A 3VYXA 3THOB 4WX9A 2EMKA 5KL7A 2VQFE 2CPNA 3HPZA 3AUZA 2EQ0A 4BHBA 2EMLA 2EOOA 2HJJA 1KJKA 2V83A 2ENCA 1EH7A 2EM3A 4RHBB 4WXCA 1EH8A 4ZYHA 4R2QA 1XNQE 2EMXA 2WZOA 1P47A 2DMIA 3THNA 3ADIA 4ZYEA 4BCAA 5A6JA 1HR0E 4L8NA 1YUIA 2WBUA 4DV7E 1X47A 1FJGE 2LTSA 2MKDA 5T6JA 3VYYA 2V8QB 2YRMA 2YTGA 4DUZE 2UU9E 2A25A 1EKZA 2ODRC 3RMPA 4M9VC 5IV8B 2EOSA 1SFEA 2EMIA 4LFBE 2N3GA 2EMFA 4OOGC 4L5NC 2WBSA 4ZYGA 3C4BA 4F6MA 4KHPE 2LMZA 1YYWA 1XMOE 4HEIA 2I9IA 3J7Yp 4DR5E 3F6HA 3LLHA 2EOJA 2B7TA 4DV6E 2YWQA 3EPJA 2EOEA 5DNYA 2L92A 2J7JA 2YTEA 4O5GA 1X5WA 3KWRA 4HTGA 5LL6R 1BBOA 3BIDA 2MDGA 2UXCE 4P7DA 1IQSA 2UUCE 2EM0A 5IWAE 2V88A 3JU0A 3F6GA 1A1JA 2NABA 5A6AA 2L3CA 2EORA 1HNZE 1A1LA 4DV2E 1B69A 1TN9A 1YZ9A 2JXPA 2D9HA 2EM4A 2UXDE 2ENAA 2N8XA 2EPLX 1TF6A 4LF7E 2EN2A 4X62E 3L00A 3UK3C 2YTNA 1O0WA 2I13A 3ADJA 4RH8A 1IBME 1STUA 2LTRA 1LLMC 2LUPB 2JOXA 1SR9A 4LFCE 3IWBA 2WCC3 2NUEA 1T4LB 4Q28A 2CTDA 2EM6A 2L8TA 2M4IA 2NA2A 3DF6A 1BB8A 1GTKA 4WPYA 5A6BD 2MC5A 1X6HA 1WJPA 2YT4A 4YY3E 2JWOA 1N34E 4JI2E 4R2AA 5A2QC 1T4OA 1X6EA 1NCSA 5F3WA 4Q35B 2YU8A 1YYOA 3BF2A 2EOFA 2LVHA 4MLVA 4GEQB 3HTXA 1NEIA 2EM5A 3C4TA 2IHR1 5AE2A 3T1HE 2K4VA 3K6QA 2EL5A 1ZAAC 4JI8E 4LF5E 3OMLA 1XMQE 1UBDC 2DLKA 2EPMX 2EOZA 2KOUA 4FK5C 1MGTA 4LF8E 2E72A 4M2ZA 4TUGA 4DV3E 4LU9A 5AE1A 2EE8A 4KZSA 1WXRA 2YU5A 2YTIA 3EQ1A 1IBLE 2EPNA 3BBGA 2CSHA 1DQ3A 2YTQA 2ELZA 4IJDA 2YTJA 1X48A 2F8BA 3DJWA 1J5EE 2NUGA 4DR6E 2MDRA 1PJQA 1RC7A 5KL4A 4WSGA 4J8ZA 1AH5A 2EL6A 1I94E 3J7AG 2BBGA 1IBKE 2GPIA 1PJSA 3M99B 4WFTA 5BR8E 1G2FC 2NUFA 2VE7C 3JAMC 2EMYA 2YRHA 3C6KA 3H09A 5A6KA 2JP9A 1DGCA 3VK6A 3IWDA 1RQ0A 2JPAA 1N36E 4JI7E 3ADLA 2L6MA 2KHXA 3KZYA 2LCEA 1ZBQA 2MC6A 5A69A 4BC7A 4BS9A 3T1YE 4DR4E 2EM9A 2RS7A 4R2RA 2L2NA 4WSPA 1ZR9A 4B3TE 4ZYDA 2R76A 2DGCA 1UN6B 3TQMA 2LJHA 2V89A 2EPAA 5ADZA 5AC4A 1N33E 2EPKX 1YYKA 4R8OA 1X49A 2EPZA 5LLQA 4YHHE 2EN8A 2VRDA 4R2EA 1DI2A 4DR2E 4JI1E 4DMIA 2VF1A 1YSAC 2L3JA 2LT7A 1JK1A 4R2CA 3C6MA 2EPUA 1F2IG 2B9DA 2H36X 2EPXA 1A1HA 2EN7A 2LBSB 1HNWE 2KONA 1T4NA 4DV5E 5TSEA 2EN4A 4LF4E 1PDAA 3FIGA 2DLQA 4B3SE 1UILA 2EQ1A 2LE2A 2EJ4A 4NXME 5KL3A 4O43A 4JI0E 1A1GA 1IMUA 2EZ6A 1EH6A 2YTFA 1ZBTA 2YSOA 3MHSC 3VHTB 2DB2A 2PRTA 3JTZA 1PKPA 2EMGA 4KWYA 2FV4B 4LTYA 4DKKA 1WHQA 5KL2A 4R2DA 4IS1C 2MKNA 4WYQB 3LMLA 3EPHA 2EOIA 2EM8A
chains in the Genus database with same CATH topology
2F8BA 3DJWA 1J5EE 2NUGA 4DUYE 2L92A 2RTXA 2B7VA 4TUIA 5FLXC 4AQYE 4X66E 1UHZA 2YZTA 4F9BB 4B3RE 4DR6E 4LF9E 4R03A 2MDRA 1RC7A 2V86A 2HHHE 4X8WA 1GZ6A 3KWRA 4I8OA 4J8ZA 4DV4E 5IT9C 4DR3E 5LL6R 4GKKE 2DMYA 2ODRD 1I94E 4OX9E 2UXCE 3J7AG 4P7DA 1IBKE 2UUCE 3HXLA 2DSYA 5IWAE 2VQEE 4NXNE 2V88A 4WFTA 5BR8E 1HNXE 2V87A 3MSWA 2NUFA 4K0KE 3JU0A 2VE7C 3F6GA 4DR1E 3JAMC 4B3ME 3H09A 1WHNA 3ADGA 2L3CA 2RSMA 2E5LE 1XNRE 4DV1E 1HNZE 4GKJE 4DV2E 3VK6A 3IWDA 2UUAE 2UUBE 1RQ0A 1YZ9A 1N36E 2RS6A 2V85A 4JI7E 3J80C 4LF6E 3ADLA 2UXDE 4JI6E 2L6MA 4BBYA 2EWLA 4LF7E 4X62E 2KHXA 2B3TB 2JVAA 2M7QA 4DR7E 1ZBQA 2MC6A 1O0WA 2L2MA 4M30A 3ZOQB 2ZM6E 3ADJA 4BC7A 4BS9A 3T1YE 1STUA 2JR1A 2LTRA 1IBME 4DR4E 2RS7A 1QU6A 3J81C 3AV0A 2LUPB 2F4VE 4JYAE 2L2NA 2JOXA 4WSPA 2JOBA 3HQ1A 5AE3A 1FKAE 4B3TE 4JI5E 4LFAE 4M0VA 1SR9A 4X65E 3VYXA 4LFCE 3IWBA 2NUEA 2LJHA 2L33A 2V89A 1T4LB 5ADZA 4Q28A 2VQFE 2L8TA 2NA2A 2E1MA 2M4IA 3DF6A 1N33E 2CPNA 4WPYA 4JV5E 1YYKA 3HPZA 2MC5A 4R8OA 1X49A 2YT4A 3AUZA 2JWOA 5AASA 4YY3E 3IWCA 4F54A 1N34E 4JI2E 5A2QC 1T4OA 2V83A 4YHHE 1XNQE 5F3WA 1DI2A 4DR2E 4JI1E 4DMIA 2VF1A 2L3JA 2WZOA 3ADIA 4BCAA 2L2KB 5CFFE 1YYOA 4JI3E 2DIXA 1HR0E 4L8NA 2B9DA 2H36X 2LUQA 4GEQB 3HTXA 4DV7E 4F9AB 3C4TA 1X47A 2IHR1 5LMNE 2LTSA 1FJGE 4DV0E 5T6JA 5AE2A 3VYYA 2V8QB 3T1HE 2LBSB 4DUZE 2G7HA 2K4VA 3K6QA 2UU9E 4BC9A 2KONA 1EKZA 4JI8E 4LF5E 1HNWE 1J26A 2ODRC 2M1SA 2JY9A 1T4NA 3OMLA 3P1XA 4P78A 4DV5E 3RMPA 1XMQE 4BMJA 4LFBE 2N3GA 2KOUA 4LF4E 1GQEA 3OTOE 2LRSA 4OOGC 3FIGA 4L5NC 4B3SE 4X64E 1UILA 2LE2A 4NXME 1N32E 4LF8E 4M2ZA 4TUGA 4DV3E 5LMUE 4JI0E 3C4BA 4KHPE 4LU9A 5AE1A 2EZ6A 2LMZA 1YYWA 1XMOE 1ZBTA 4KZSA 4F9CB 3J7Yp 4DR5E 1WXRA 2DB2A 3F6HA 3HPSA 3JTZA 3LLHA 1PKPA 2FGGA 1IBLE 2FV4B 4LTYA 4DKKA 1WHQA 4JI4E 2UXBE 2FTXB 1DQ3A 2B7TA 4WYQB 4DV6E 2N3HA 3LMLA 1X48A 5DNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUG A;  1J5E E;  4DUY E;  2RTX A;  2B7V A;  4AQY E;  4X66 E;  1UHZ A;  4DR6 E;  4B3R E;  4LF9 E;  2MDR A;  1RC7 A;  2HHH E;  4X8W A;  4DV4 E;  4DR3 E;  4GKK E;  2DMY A;  1I94 E;  4OX9 E;  2UXC E;  1IBK E;  2UUC E;  5IWA E;  2VQE E;  4NXN E;  4WFT A;  5BR8 E;  1HNX E;  2NUF A;  4K0K E;  4DR1 E;  4B3M E;  1WHN A;  3ADG A;  2L3C A;  2RSM A;  2E5L E;  1XNR E;  4DV1 E;  1HNZ E;  4GKJ E;  4DV2 E;  2UUA E;  2UUB E;  1RQ0 A;  1YZ9 A;  1N36 E;  4JI7 E;  2RS6 A;  3ADL A;  4LF6 E;  2UXD E;  4JI6 E;  4LF7 E;  4X62 E;  2KHX A;  2B3T B;  2JVA A;  4DR7 E;  1O0W A;  2L2M A;  4M30 A;  2ZM6 E;  3ADJ A;  3T1Y E;  1IBM E;  1STU A;  4DR4 E;  2LTR A;  2RS7 A;  1QU6 A;  2LUP B;  2F4V E;  4JYA E;  2L2N A;  4JI5 E;  4B3T E;  1FKA E;  4LFA E;  3VYX A;  4X65 E;  4LFC E;  2NUE A;  2LJH A;  2L33 A;  1T4L B;  2VQF E;  2NA2 A;  1N33 E;  2CPN A;  1YYK A;  1X49 A;  2YT4 A;  4YY3 E;  4JI2 E;  1N34 E;  1T4O A;  4YHH E;  1XNQ E;  1DI2 A;  4DR2 E;  4JI1 E;  2L3J A;  3ADI A;  2L2K B;  5CFF E;  1YYO A;  4JI3 E;  2DIX A;  1HR0 E;  3HTX A;  2LUQ A;  4DV7 E;  3C4T A;  1X47 A;  2IHR 1;  5LMN E;  2LTS A;  1FJG E;  4DV0 E;  3T1H E;  3VYY A;  2LBS B;  4DUZ E;  2UU9 E;  1HNW E;  4LF5 E;  1EKZ A;  4JI8 E;  1J26 A;  1T4N A;  2JY9 A;  4DV5 E;  1XMQ E;  3P1X A;  4JV5 E;  4LFB E;  2N3G A;  4LF4 E;  1GQE A;  3OTO E;  2LRS A;  4OOG C;  4B3S E;  4X64 E;  1UIL A;  4NXM E;  1N32 E;  4LF8 E;  4M2Z A;  4DV3 E;  5LMU E;  4JI0 E;  3C4B A;  4KHP E;  2EZ6 A;  1YYW A;  1XMO E;  1ZBT A;  3J7Y p;  4DR5 E;  2DB2 A;  3LLH A;  1PKP A;  1IBL E;  4DKK A;  4JI4 E;  1WHQ A;  2UXB E;  2B7T A;  4WYQ B;  4DV6 E;  2N3H A;  1X48 A; 
#chains in the Genus database with same CATH topology
 4GZN C;  4DUY E;  2RTX A;  2B7V A;  4AQY E;  2EPO A;  5FLX C;  1UHZ A;  2YZT A;  2GLI A;  2EPC A;  4R03 A;  2YPN A;  4LF9 E;  5AC5 A;  4X9J A;  2EN3 A;  4R2S A;  4DV4 E;  1GZ6 A;  1T39 A;  1ZU1 A;  5IT9 C;  4GKK E;  2ODR D;  1Z1B A;  4OX9 E;  2YRK A;  2LV2 A;  2DSY A;  3HXL A;  2VQE E;  4NXN E;  2V87 A;  3MSW A;  2R1F A;  1YUJ A;  4DR1 E;  4BHC A;  2DRP A;  1X3C A;  2RPC A;  1N3G A;  1WHN A;  2E5L E;  4DV1 E;  2EOY A;  4GKJ E;  2V85 A;  2LJU A;  1PJT A;  4O24 A;  2HGH A;  4BBY A;  2EWL A;  1IQO A;  2EOH A;  4DR7 E;  2Q8U A;  2L2M A;  3ZOQ B;  2YSP A;  1WRJ A;  2EOM A;  1QU6 A;  2BB8 A;  2EPR A;  3J81 C;  1T38 A;  2EMZ A;  2EQ3 A;  4JYA E;  4JI5 E;  3HQ1 A;  4LFA E;  1FKA E;  4M0V A;  4X65 E;  2EMC A;  2EM2 A;  1MEY C;  2L33 A;  4R2P A;  3ECR A;  4N4R B;  3QG5 C;  2E1M A;  5AAS A;  2EM7 A;  2EL4 A;  3IWC A;  4F54 A;  2EOX A;  4NZV A;  4O4K A;  2L2K B;  5CFF E;  4JI3 E;  2DIX A;  2ELY A;  2EMB A;  4F2J C;  2RSI A;  2LUQ A;  4F9A B;  5LMN E;  4DV0 E;  2G7H A;  4NHR A;  5IXM B;  4BC9 A;  2EMH A;  1J26 A;  2M1S A;  2JY9 A;  4JV5 E;  4P78 A;  3P1X A;  4BMJ A;  4WXD A;  5KL6 A;  1GQE A;  3OTO E;  2LRS A;  2RQL A;  2GHF A;  2YTD A;  5A6B A;  4X64 E;  2EOQ A;  1N32 E;  5LMU E;  2EMA A;  2EPP A;  2YTP A;  4F9C B;  3EPL A;  3HPS A;  2EN1 A;  2FGG A;  2EP3 A;  4JI4 E;  2UXB E;  1AAY A;  2FTX B;  1TF3 A;  2N3H A;  1A1F A;  1A1I A;  1L4S A;  4TUI A;  1G2D C;  4X66 E;  4F9B B;  2HC5 A;  4B3R E;  3EPK A;  2V86 A;  4MLQ A;  2HHH E;  4X8W A;  1QNT A;  4I8O A;  4DR3 E;  2DMY A;  2YTO A;  4F6N A;  1RMD A;  2K7I A;  3KZZ A;  1X6F A;  1HNX E;  4K0K E;  5KL5 A;  2EMW A;  4B3M E;  3ADG A;  2RSM A;  2WBT A;  2ADR A;  1XNR E;  2M9A A;  1KYQ A;  2UUA E;  1A1K A;  2CT1 A;  2UUB E;  2RS6 A;  2EN6 A;  3J80 C;  4LF6 E;  4JI6 E;  2LO3 A;  1JK2 A;  1BBG A;  2ENH A;  1YFH A;  1YPN A;  2JYA A;  2B3T B;  2JVA A;  2M7Q A;  4M30 A;  2ZM6 E;  2JR1 A;  3MHH C;  3AV0 A;  2F4V E;  3BGH A;  2JOB A;  5AE3 A;  3VYX A;  3THO B;  4WX9 A;  2EMK A;  5KL7 A;  2VQF E;  2CPN A;  3HPZ A;  3AUZ A;  2EQ0 A;  4BHB A;  2EML A;  2EOO A;  2HJJ A;  1KJK A;  2V83 A;  2ENC A;  1EH7 A;  2EM3 A;  4RHB B;  4WXC A;  1EH8 A;  4ZYH A;  4R2Q A;  1XNQ E;  2EMX A;  2WZO A;  1P47 A;  2DMI A;  3THN A;  3ADI A;  4ZYE A;  4BCA A;  5A6J A;  1HR0 E;  4L8N A;  1YUI A;  2WBU A;  4DV7 E;  1X47 A;  1FJG E;  2LTS A;  2MKD A;  5T6J A;  3VYY A;  2V8Q B;  2YRM A;  2YTG A;  4DUZ E;  2UU9 E;  2A25 A;  1EKZ A;  2ODR C;  3RMP A;  4M9V C;  5IV8 B;  2EOS A;  1SFE A;  2EMI A;  4LFB E;  2N3G A;  2EMF A;  4OOG C;  4L5N C;  2WBS A;  4ZYG A;  3C4B A;  4F6M A;  4KHP E;  2LMZ A;  1YYW A;  1XMO E;  4HEI A;  2I9I A;  3J7Y p;  4DR5 E;  3F6H A;  3LLH A;  2EOJ A;  2B7T A;  4DV6 E;  2YWQ A;  3EPJ A;  2EOE A;  5DNY A;  2L92 A;  2J7J A;  2YTE A;  4O5G A;  1X5W A;  3KWR A;  4HTG A;  5LL6 R;  1BBO A;  3BID A;  2MDG A;  2UXC E;  4P7D A;  1IQS A;  2UUC E;  2EM0 A;  5IWA E;  2V88 A;  3JU0 A;  3F6G A;  1A1J A;  2NAB A;  5A6A A;  2L3C A;  2EOR A;  1HNZ E;  1A1L A;  4DV2 E;  1B69 A;  1TN9 A;  1YZ9 A;  2JXP A;  2D9H A;  2EM4 A;  2UXD E;  2ENA A;  2N8X A;  2EPL X;  1TF6 A;  4LF7 E;  2EN2 A;  4X62 E;  3L00 A;  3UK3 C;  2YTN A;  1O0W A;  2I13 A;  3ADJ A;  4RH8 A;  1IBM E;  1STU A;  2LTR A;  1LLM C;  2LUP B;  2JOX A;  1SR9 A;  4LFC E;  3IWB A;  2WCC 3;  2NUE A;  1T4L B;  4Q28 A;  2CTD A;  2EM6 A;  2L8T A;  2M4I A;  2NA2 A;  3DF6 A;  1BB8 A;  1GTK A;  4WPY A;  5A6B D;  2MC5 A;  1X6H A;  1WJP A;  2YT4 A;  4YY3 E;  2JWO A;  1N34 E;  4JI2 E;  4R2A A;  5A2Q C;  1T4O A;  1X6E A;  1NCS A;  5F3W A;  4Q35 B;  2YU8 A;  1YYO A;  3BF2 A;  2EOF A;  2LVH A;  4MLV A;  4GEQ B;  3HTX A;  1NEI A;  2EM5 A;  3C4T A;  2IHR 1;  5AE2 A;  3T1H E;  2K4V A;  3K6Q A;  2EL5 A;  1ZAA C;  4JI8 E;  4LF5 E;  3OML A;  1XMQ E;  1UBD C;  2DLK A;  2EPM X;  2EOZ A;  2KOU A;  4FK5 C;  1MGT A;  4LF8 E;  2E72 A;  4M2Z A;  4TUG A;  4DV3 E;  4LU9 A;  5AE1 A;  2EE8 A;  4KZS A;  1WXR A;  2YU5 A;  2YTI A;  3EQ1 A;  1IBL E;  2EPN A;  3BBG A;  2CSH A;  1DQ3 A;  2YTQ A;  2ELZ A;  4IJD A;  2YTJ A;  1X48 A;  2F8B A;  3DJW A;  1J5E E;  2NUG A;  4DR6 E;  2MDR A;  1PJQ A;  1RC7 A;  5KL4 A;  4WSG A;  4J8Z A;  1AH5 A;  2EL6 A;  1I94 E;  3J7A G;  2BBG A;  1IBK E;  2GPI A;  1PJS A;  3M99 B;  4WFT A;  5BR8 E;  1G2F C;  2NUF A;  2VE7 C;  3JAM C;  2EMY A;  2YRH A;  3C6K A;  3H09 A;  5A6K A;  2JP9 A;  1DGC A;  3VK6 A;  3IWD A;  1RQ0 A;  2JPA A;  1N36 E;  4JI7 E;  3ADL A;  2L6M A;  2KHX A;  3KZY A;  2LCE A;  1ZBQ A;  2MC6 A;  5A69 A;  4BC7 A;  4BS9 A;  3T1Y E;  4DR4 E;  2EM9 A;  2RS7 A;  4R2R A;  2L2N A;  4WSP A;  1ZR9 A;  4B3T E;  4ZYD A;  2R76 A;  2DGC A;  1UN6 B;  3TQM A;  2LJH A;  2V89 A;  2EPA A;  5ADZ A;  5AC4 A;  1N33 E;  2EPK X;  1YYK A;  4R8O A;  1X49 A;  2EPZ A;  5LLQ A;  4YHH E;  2EN8 A;  2VRD A;  4R2E A;  1DI2 A;  4DR2 E;  4JI1 E;  4DMI A;  2VF1 A;  1YSA C;  2L3J A;  2LT7 A;  1JK1 A;  4R2C A;  3C6M A;  2EPU A;  1F2I G;  2B9D A;  2H36 X;  2EPX A;  1A1H A;  2EN7 A;  2LBS B;  1HNW E;  2KON A;  1T4N A;  4DV5 E;  5TSE A;  2EN4 A;  4LF4 E;  1PDA A;  3FIG A;  2DLQ A;  4B3S E;  1UIL A;  2EQ1 A;  2LE2 A;  2EJ4 A;  4NXM E;  5KL3 A;  4O43 A;  4JI0 E;  1A1G A;  1IMU A;  2EZ6 A;  1EH6 A;  2YTF A;  1ZBT A;  2YSO A;  3MHS C;  3VHT B;  2DB2 A;  2PRT A;  3JTZ A;  1PKP A;  2EMG A;  4KWY A;  2FV4 B;  4LTY A;  4DKK A;  1WHQ A;  5KL2 A;  4R2D A;  4IS1 C;  2MKN A;  4WYQ B;  3LML A;  3EPH A;  2EOI A;  2EM8 A; 
#chains in the Genus database with same CATH homology
 2F8B A;  3DJW A;  1J5E E;  2NUG A;  4DUY E;  2L92 A;  2RTX A;  2B7V A;  4TUI A;  5FLX C;  4AQY E;  4X66 E;  1UHZ A;  2YZT A;  4F9B B;  4B3R E;  4DR6 E;  4LF9 E;  4R03 A;  2MDR A;  1RC7 A;  2V86 A;  2HHH E;  4X8W A;  1GZ6 A;  3KWR A;  4I8O A;  4J8Z A;  4DV4 E;  5IT9 C;  4DR3 E;  5LL6 R;  4GKK E;  2DMY A;  2ODR D;  1I94 E;  4OX9 E;  2UXC E;  3J7A G;  4P7D A;  1IBK E;  2UUC E;  3HXL A;  2DSY A;  5IWA E;  2VQE E;  4NXN E;  2V88 A;  4WFT A;  5BR8 E;  1HNX E;  2V87 A;  3MSW A;  2NUF A;  4K0K E;  3JU0 A;  2VE7 C;  3F6G A;  4DR1 E;  3JAM C;  4B3M E;  3H09 A;  1WHN A;  3ADG A;  2L3C A;  2RSM A;  2E5L E;  1XNR E;  4DV1 E;  1HNZ E;  4GKJ E;  4DV2 E;  3VK6 A;  3IWD A;  2UUA E;  2UUB E;  1RQ0 A;  1YZ9 A;  1N36 E;  2RS6 A;  2V85 A;  4JI7 E;  3J80 C;  4LF6 E;  3ADL A;  2UXD E;  4JI6 E;  2L6M A;  4BBY A;  2EWL A;  4LF7 E;  4X62 E;  2KHX A;  2B3T B;  2JVA A;  2M7Q A;  4DR7 E;  1ZBQ A;  2MC6 A;  1O0W A;  2L2M A;  4M30 A;  3ZOQ B;  2ZM6 E;  3ADJ A;  4BC7 A;  4BS9 A;  3T1Y E;  1STU A;  2JR1 A;  2LTR A;  1IBM E;  4DR4 E;  2RS7 A;  1QU6 A;  3J81 C;  3AV0 A;  2LUP B;  2F4V E;  4JYA E;  2L2N A;  2JOX A;  4WSP A;  2JOB A;  3HQ1 A;  5AE3 A;  1FKA E;  4B3T E;  4JI5 E;  4LFA E;  4M0V A;  1SR9 A;  4X65 E;  3VYX A;  4LFC E;  3IWB A;  2NUE A;  2LJH A;  2L33 A;  2V89 A;  1T4L B;  5ADZ A;  4Q28 A;  2VQF E;  2L8T A;  2NA2 A;  2E1M A;  2M4I A;  3DF6 A;  1N33 E;  2CPN A;  4WPY A;  4JV5 E;  1YYK A;  3HPZ A;  2MC5 A;  4R8O A;  1X49 A;  2YT4 A;  3AUZ A;  2JWO A;  5AAS A;  4YY3 E;  3IWC A;  4F54 A;  1N34 E;  4JI2 E;  5A2Q C;  1T4O A;  2V83 A;  4YHH E;  1XNQ E;  5F3W A;  1DI2 A;  4DR2 E;  4JI1 E;  4DMI A;  2VF1 A;  2L3J A;  2WZO A;  3ADI A;  4BCA A;  2L2K B;  5CFF E;  1YYO A;  4JI3 E;  2DIX A;  1HR0 E;  4L8N A;  2B9D A;  2H36 X;  2LUQ A;  4GEQ B;  3HTX A;  4DV7 E;  4F9A B;  3C4T A;  1X47 A;  2IHR 1;  5LMN E;  2LTS A;  1FJG E;  4DV0 E;  5T6J A;  5AE2 A;  3VYY A;  2V8Q B;  3T1H E;  2LBS B;  4DUZ E;  2G7H A;  2K4V A;  3K6Q A;  2UU9 E;  4BC9 A;  2KON A;  1EKZ A;  4JI8 E;  4LF5 E;  1HNW E;  1J26 A;  2ODR C;  2M1S A;  2JY9 A;  1T4N A;  3OML A;  3P1X A;  4P78 A;  4DV5 E;  3RMP A;  1XMQ E;  4BMJ A;  4LFB E;  2N3G A;  2KOU A;  4LF4 E;  1GQE A;  3OTO E;  2LRS A;  4OOG C;  3FIG A;  4L5N C;  4B3S E;  4X64 E;  1UIL A;  2LE2 A;  4NXM E;  1N32 E;  4LF8 E;  4M2Z A;  4TUG A;  4DV3 E;  5LMU E;  4JI0 E;  3C4B A;  4KHP E;  4LU9 A;  5AE1 A;  2EZ6 A;  2LMZ A;  1YYW A;  1XMO E;  1ZBT A;  4KZS A;  4F9C B;  3J7Y p;  4DR5 E;  1WXR A;  2DB2 A;  3F6H A;  3HPS A;  3JTZ A;  3LLH A;  1PKP A;  2FGG A;  1IBL E;  2FV4 B;  4LTY A;  4DKK A;  1WHQ A;  4JI4 E;  2UXB E;  2FTX B;  1DQ3 A;  2B7T A;  4WYQ B;  4DV6 E;  2N3H A;  3LML A;  1X48 A;  5DNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...