1QU6A

Structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
179
Chain Sequence
GSHMEMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the double-stranded RNA-binding domain of the protein kinase PKR reveals the molecular basis of its dsRNA-mediated activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTEIN KINASE PKR
total genus 28
structure length 179
sequence length 179
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1999-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1qu6A02
2LRSA 1QU6A 2L33A 4DV5E 4DV2E 4JI3E 1HNWE 1PKPA 1EKZA 2N3GA 2VQFE 2IHR1 3VYYA 4B3SE 2ZM6E 2LBSB 2UXBE 4NXME 4DKKA 4LFBE 2RS6A 2LUPB 4DV1E 1N36E 1RQ0A 4DR3E 3T1YE 4B3RE 3ADLA 1GQEA 1STUA 4X8WA 1HNZE 4DV4E 2NUEA 4DR4E 4X66E 3C4TA 1T4OA 1IBKE 4LF7E 2NA2A 2MDRA 1WHNA 2L2NA 2RSMA 2LTSA 4X65E 2HHHE 2UUCE 1UILA 4YHHE 1FKAE 1DI2A 4JI5E 4DUZE 3ADIA 4JV5E 4JYAE 1O0WA 4M2ZA 4OOGC 1J5EE 4LFAE 4AQYE 4OX9E 2RTXA 4M30A 4X62E 4DV0E 1XMOE 4JI2E 4JI0E 4WFTA 2DB2A 2RS7A 2UXCE 2DIXA 1T4LB 1UHZA 2NUFA 2UXDE 1T4NA 1X47A 1YYWA 2JY9A 3LLHA 4DR2E 3ADJA 4X64E 1YYKA 2KHXA 4DV7E 5LMNE 4LF4E 1XNQE 2F4VE 2LJHA 2B3TB 3C4BA 4NXNE 1FJGE 4GKJE 5LMUE 3P1XA 2N3HA 1HNXE 3HTXA 4LF5E 1WHQA 2UUAE 2EZ6A 2B7TA 1HR0E 4GKKE 3J7Yp 2B7VA 4JI8E 5BR8E 2JVAA 2YT4A 4DV3E 3T1HE 1IBLE 4JI6E 1ZBTA 1X48A 4DR7E 2L3CA 4LFCE 4JI1E 5IWAE 2E5LE 4LF8E 1N33E 2VQEE 2UUBE 1YYOA 4DR6E 4DR5E 4JI4E 1XMQE 1RC7A 2NUGA 3ADGA 1XNRE 3VYXA 4B3ME 2CPNA 2LTRA 1IBME 2UU9E 5CFFE 2LUQA 1J26A 4YY3E 3OTOE 4DR1E 4LF9E 2L3JA 4LF6E 4WYQB 4DUYE 2L2KB 4B3TE 4JI7E 1I94E 2L2MA 1YZ9A 2DMYA 4DV6E 1N34E 1N32E 1X49A 4K0KE 4KHPE
chains in the Genus database with same CATH superfamily
2YTQA 2L6MA 2L33A 3JTZA 4JI3E 1ZU1A 4Q35B 1EKZA 2YRMA 5A2QC 2RQLA 2F8BA 2VQFE 4WPYA 1PJTA 2EM6A 3IWDA 2WZOA 2N8XA 3JAMC 2LBSB 4HTGA 4NHRA 4DKKA 2RS6A 2YTGA 2ENAA 4BCAA 2EL4A 1NEIA 4Q28A 1MEYC 4LU9A 4DR3E 4B3RE 2EORA 3ADLA 4DV4E 1SFEA 2YRKA 1IBKE 2JP9A 3IWCA 2MDRA 2L2NA 1P47A 4F9BB 5KL3A 2EMFA 1UILA 4RHBB 1ZAAC 4DUZE 3EPKA 2EPRA 3J7AG 4M2ZA 3QG5C 4OOGC 5IXMB 2GHFA 3HXLA 2RTXA 1YUJA 2I9IA 2DLKA 2EN3A 2EOZA 4R2QA 1TF6A 1YUIA 4JI0E 2NABA 2DB2A 4J8ZA 2DIXA 4I8OA 1T4LB 1X6EA 1YYWA 2EMGA 2EN2A 2JY9A 2V85A 3KZYA 2CT1A 3MSWA 4BHBA 5LMNE 5KL5A 4IS1C 4F6NA 2EQ0A 3HTXA 4TUIA 1PJQA 2ENHA 2EPMX 4GKKE 3J7Yp 4KZSA 4JI8E 3DF6A 4FK5C 4WSPA 4DV3E 1IBLE 4JI6E 4ZYEA 3MHHC 5ADZA 4DR7E 2L3CA 4P78A 2EMYA 3EPHA 1NCSA 2VQEE 2ELZA 2RSIA 2EL6A 2M7QA 4TUGA 1AAYA 2LCEA 3VYXA 2EOYA 2CPNA 2ELYA 2LUQA 2B9DA 3OMLA 2EOFA 1LLMC 4B3TE 3AV0A 4BC7A 2M9AA 1YZ9A 1EH6A 2LRSA 2EPNA 2FTXB 2EPKX 4O5GA 2N3GA 1EH7A 1Z1BA 1GTKA 2CSHA 1X6FA 2JXPA 2FGGA 2MKDA 2EN4A 1KJKA 4DMIA 4DV1E 2EMWA 1WRJA 2JR1A 2KONA 2JYAA 3J81C 3VK6A 4X66E 2V89A 2NA2A 2LTSA 4X65E 2UUCE 4YHHE 1DI2A 4ZYHA 2YTEA 3LMLA 1YSAC 5TSEA 3HPSA 1WJPA 2I13A 4AQYE 5A6AA 1UBDC 4DV0E 1XMOE 3C6MA 4JI2E 3HPZA 2YPNA 2UXCE 2EN8A 2EM0A 3J80C 2WCC3 4F6MA 4DR2E 2YU5A 3ADJA 3FIGA 4X64E 1YYKA 2KHXA 1L4SA 4LF4E 2F4VE 2LJHA 2B3TB 3C4BA 1FJGE 4GKJE 5LMUE 2V86A 2N3HA 3P1XA 2VF1A 1TN9A 2G7HA 2EZ6A 2CTDA 1A1LA 5BR8E 2H36X 2YT4A 1IQOA 1GZ6A 2EE8A 4LFCE 4JI1E 4LF8E 2YTOA 2YTNA 5A6JA 1YYOA 2R1FA 4DR6E 4DR5E 2BB8A 2DGCA 1XNRE 2JWOA 2DSYA 1MGTA 3ECRA 4B3ME 2EPAA 4ZYGA 4NZVA 1RMDA 4YY3E 2MC6A 4DR1E 4LF9E 4HEIA 2V88A 1KYQA 2EOHA 4WYQB 4F9AB 2VRDA 2L2KB 1EH8A 2JOXA 4DV6E 2EM9A 4R8OA 1N32E 2EMLA 3UK3C 2WBUA 5LLQA 5AC5A 1QU6A 2BBGA 2LO3A 4L5NC 3IWBA 5A6BA 2YTIA 4F9CB 1PDAA 2J7JA 1X3CA 4B3SE 5LL6R 2ZM6E 4KWYA 2EPUA 2EM7A 2EL5A 2A25A 2EPCA 1IQSA 2YZTA 2EMZA 2EMAA 1BB8A 4O43A 2LUPB 2JOBA 1YFHA 1N36E 3T1YE 2E1MA 4GEQB 1GQEA 1STUA 1HNZE 2NUEA 3BIDA 3TQMA 1A1JA 1T4OA 3C4TA 2EMKA 5KL6A 2MKNA 1WHNA 2HC5A 4P7DA 2RPCA 4R2DA 2HHHE 2EPPA 2HJJA 1JK2A 3F6GA 2GLIA 3ADIA 2EM8A 1G2DC 4JYAE 3HQ1A 1O0WA 4R2PA 2EOIA 2D9HA 5KL7A 4X9JA 5KL4A 1J5EE 2YRHA 3EPJA 4LFAE 4OX9E 4X62E 2V8QB 4M0VA 4O4KA 2EOEA 2FV4B 4WFTA 2EWLA 5F3WA 3M99B 2RS7A 1WXRA 1UHZA 4O24A 1TF3A 1T4NA 2UXDE 2EOOA 2EP3A 1X5WA 2V87A 3LLHA 2YSOA 3F6HA 3KZZA 2LT7A 3ZOQB 1JK1A 5AE1A 4NXNE 2YTFA 2WBTA 1HNXE 2R76A 4LF5E 1WHQA 2M4IA 2B7TA 1YPNA 2LE2A 2EOJA 2B7VA 1AH5A 3EQ1A 2EMCA 1A1KA 1QNTA 3RMPA 5AE3A 5IT9C 2ADRA 1X48A 2WBSA 1DGCA 5IWAE 2E5LE 1N33E 2EM5A 2LJUA 2HGHA 4JI4E 4MLVA 4BBYA 1RC7A 1A1HA 3ADGA 2LV2A 1G2FC 1IBME 2UU9E 4R2CA 4R2SA 2PRTA 4R2AA 1J26A 1UN6B 4R2RA 4R03A 5FLXC 2L3JA 4ZYDA 4JI7E 2MC5A 4MLQA 2L2MA 3MHSC 3JU0A 1N34E 1BBGA 4K0KE 4KHPE 4DV5E 5T6JA 4DV2E 1A1GA 1HNWE 1PKPA 2EN6A 2EPOA 2YTDA 1X49A 2IHR1 4BMJA 3VYYA 2EPLX 2YSPA 4RH8A 4WX9A 2EOMA 1IMUA 2UXBE 4NXME 4LFBE 2DLQA 1T38A 3VHTB 2GPIA 3KWRA 4M9VC 2ODRC 5KL2A 1RQ0A 4F54A 1ZBQA 1A1IA 2EOQA 4X8WA 3THOB 5IV8B 1F2IG 4DR4E 2VE7C 2EN7A 5AASA 4LF7E 2EM2A 2RSMA 2L8TA 4LTYA 1ZR9A 2EMXA 3BBGA 1FKAE 2KOUA 4JI5E 4JV5E 1BBOA 2YTJA 2EMBA 2ODRD 1T39A 4GZNC 2EM4A 2EPZA 2EM3A 2EOXA 4M30A 2EN1A 2DRPA 5AC4A 4L8NA 4WXCA 2NUFA 1A1FA 2L92A 3BGHA 1X47A 2V83A 2YTPA 5A6BD 3EPLA 1N3GA 2E72A 4WSGA 4DV7E 1XNQE 4BHCA 5AE2A 3THNA 2EPXA 3K6QA 2UUAE 2YU8A 4BC9A 3AUZA 1HR0E 4IJDA 2JVAA 1PJSA 2EQ1A 3T1HE 2MDGA 5A69A 1ZBTA 2EJ4A 4WXDA 1B69A 2EOSA 3H09A 3L00A 2ENCA 2K4VA 4R2EA 4BS9A 2UUBE 1DQ3A 2DMIA 1SR9A 2LMZA 2Q8UA 1XMQE 2NUGA 5A6KA 2K7IA 2M1SA 2LTRA 3BF2A 5CFFE 2LVHA 2EMHA 2YWQA 3C6KA 3OTOE 3DJWA 4LF6E 2JPAA 4DUYE 5DNYA 1I94E 4N4RB 2DMYA 4F2JC 2EMIA 2EQ3A 1X6HA
chains in the Genus database with same CATH topology
2L6MA 2LRSA 1QU6A 2L33A 3JTZA 5T6JA 4DV2E 4DV5E 4JI3E 1HNWE 1PKPA 4L5NC 2FTXB 3IWBA 1EKZA 5A2QC 2F8BA 2N3GA 4WPYA 2VQFE 2IHR1 4BMJA 4F9CB 3VYYA 3IWDA 4B3SE 2WZOA 5LL6R 3JAMC 2ZM6E 2LBSB 2UXBE 4NXME 4DKKA 4LFBE 2RS6A 2FGGA 4BCAA 2YZTA 3KWRA 2ODRC 4DMIA 2LUPB 2JOBA 4Q28A 4DV1E 4LU9A 1N36E 1RQ0A 4DR3E 3T1YE 2E1MA 4GEQB 4F54A 4B3RE 1ZBQA 3ADLA 1GQEA 1STUA 2JR1A 4X8WA 1HNZE 2KONA 3J81C 4DV4E 2NUEA 2VE7C 1T4OA 2V89A 3C4TA 3VK6A 5AASA 4X66E 1IBKE 3IWCA 4LF7E 2NA2A 2MDRA 1WHNA 4P7DA 2L2NA 2RSMA 2LTSA 2L8TA 4LTYA 4F9BB 4X65E 2HHHE 2UUCE 4DR4E 1UILA 4YHHE 1FKAE 1DI2A 2KOUA 4JI5E 3F6GA 4DUZE 3ADIA 4JV5E 3LMLA 4JYAE 3HQ1A 1O0WA 3J7AG 4M2ZA 2ODRD 4OOGC 3HPSA 1J5EE 4LFAE 4AQYE 4OX9E 3HXLA 2RTXA 4M30A 4X62E 2V8QB 4DV0E 1XMOE 4M0VA 2FV4B 4JI2E 4JI0E 4WFTA 2EWLA 3HPZA 5F3WA 2DB2A 2RS7A 4J8ZA 2UXCE 1WXRA 2DIXA 4I8OA 1T4LB 1UHZA 4L8NA 2NUFA 2UXDE 1T4NA 2L92A 1X47A 3J80C 2V83A 1YYWA 2JY9A 2V85A 2V87A 3LLHA 4DR2E 3F6HA 3ADJA 3FIGA 4X64E 1YYKA 2KHXA 3MSWA 3ZOQB 4DV7E 5LMNE 4LF4E 1XNQE 2F4VE 5AE1A 2LJHA 2B3TB 3C4BA 4NXNE 1FJGE 4GKJE 5LMUE 2V86A 2N3HA 3P1XA 5AE2A 2VF1A 1HNXE 3HTXA 4TUIA 4LF5E 1WHQA 2G7HA 3K6QA 2UUAE 2EZ6A 2M4IA 2B7TA 2LE2A 4BC9A 3AUZA 1HR0E 4GKKE 3J7Yp 2B7VA 4KZSA 4JI8E 5BR8E 2JVAA 3DF6A 2H36X 2YT4A 4WSPA 4DV3E 3T1HE 1IBLE 4JI6E 3RMPA 5AE3A 1ZBTA 5IT9C 1X48A 5ADZA 4DR7E 1GZ6A 2L3CA 4LFCE 3H09A 4P78A 4JI1E 5IWAE 2E5LE 4LF8E 2K4VA 1N33E 2VQEE 4BS9A 2UUBE 1DQ3A 1YYOA 4DR6E 4DR5E 2M7QA 1SR9A 2LMZA 4TUGA 4BBYA 1XMQE 1RC7A 4JI4E 2NUGA 3ADGA 1XNRE 2JWOA 2DSYA 3VYXA 2M1SA 4B3ME 2CPNA 2LTRA 1IBME 2UU9E 5CFFE 2LUQA 1J26A 4YY3E 2MC6A 3OTOE 2B9DA 4DR1E 4LF9E 3OMLA 4R03A 2V88A 3DJWA 5FLXC 2L3JA 4LF6E 4WYQB 4DUYE 2L2KB 5DNYA 4B3TE 4JI7E 2MC5A 3AV0A 2L2MA 4BC7A 1I94E 3JU0A 2JOXA 1YZ9A 2DMYA 4R8OA 4DV6E 1N34E 1X49A 4F9AB 1N32E 4K0KE 4KHPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRS A;  1QU6 A;  2L33 A;  4DV5 E;  4DV2 E;  4JI3 E;  1HNW E;  1PKP A;  1EKZ A;  2N3G A;  2VQF E;  2IHR 1;  3VYY A;  4B3S E;  2ZM6 E;  2LBS B;  2UXB E;  4NXM E;  4DKK A;  4LFB E;  2RS6 A;  2LUP B;  4DV1 E;  1N36 E;  1RQ0 A;  4DR3 E;  3T1Y E;  4B3R E;  3ADL A;  1GQE A;  1STU A;  4X8W A;  1HNZ E;  4DV4 E;  2NUE A;  4DR4 E;  4X66 E;  3C4T A;  1T4O A;  1IBK E;  4LF7 E;  2NA2 A;  2MDR A;  1WHN A;  2L2N A;  2RSM A;  2LTS A;  4X65 E;  2HHH E;  2UUC E;  1UIL A;  4YHH E;  1FKA E;  1DI2 A;  4JI5 E;  4DUZ E;  3ADI A;  4JV5 E;  4JYA E;  1O0W A;  4M2Z A;  4OOG C;  1J5E E;  4LFA E;  4AQY E;  4OX9 E;  2RTX A;  4M30 A;  4X62 E;  4DV0 E;  1XMO E;  4JI2 E;  4JI0 E;  4WFT A;  2DB2 A;  2RS7 A;  2UXC E;  2DIX A;  1T4L B;  1UHZ A;  2NUF A;  2UXD E;  1T4N A;  1X47 A;  1YYW A;  2JY9 A;  3LLH A;  4DR2 E;  3ADJ A;  4X64 E;  1YYK A;  2KHX A;  4DV7 E;  5LMN E;  4LF4 E;  1XNQ E;  2F4V E;  2LJH A;  2B3T B;  3C4B A;  4NXN E;  1FJG E;  4GKJ E;  5LMU E;  3P1X A;  2N3H A;  1HNX E;  3HTX A;  4LF5 E;  1WHQ A;  2UUA E;  2EZ6 A;  2B7T A;  1HR0 E;  4GKK E;  3J7Y p;  2B7V A;  4JI8 E;  5BR8 E;  2JVA A;  2YT4 A;  4DV3 E;  3T1H E;  1IBL E;  4JI6 E;  1ZBT A;  1X48 A;  4DR7 E;  2L3C A;  4LFC E;  4JI1 E;  5IWA E;  2E5L E;  4LF8 E;  1N33 E;  2VQE E;  2UUB E;  1YYO A;  4DR6 E;  4DR5 E;  4JI4 E;  1XMQ E;  1RC7 A;  2NUG A;  3ADG A;  1XNR E;  3VYX A;  4B3M E;  2CPN A;  2LTR A;  1IBM E;  2UU9 E;  5CFF E;  2LUQ A;  1J26 A;  4YY3 E;  3OTO E;  4DR1 E;  4LF9 E;  2L3J A;  4LF6 E;  4WYQ B;  4DUY E;  2L2K B;  4B3T E;  4JI7 E;  1I94 E;  2L2M A;  1YZ9 A;  2DMY A;  4DV6 E;  1N34 E;  1N32 E;  1X49 A;  4K0K E;  4KHP E; 
#chains in the Genus database with same CATH topology
 2YTQ A;  2L6M A;  2L33 A;  3JTZ A;  4JI3 E;  1ZU1 A;  4Q35 B;  1EKZ A;  2YRM A;  5A2Q C;  2RQL A;  2F8B A;  2VQF E;  4WPY A;  1PJT A;  2EM6 A;  3IWD A;  2WZO A;  2N8X A;  3JAM C;  2LBS B;  4HTG A;  4NHR A;  4DKK A;  2RS6 A;  2YTG A;  2ENA A;  4BCA A;  2EL4 A;  1NEI A;  4Q28 A;  1MEY C;  4LU9 A;  4DR3 E;  4B3R E;  2EOR A;  3ADL A;  4DV4 E;  1SFE A;  2YRK A;  1IBK E;  2JP9 A;  3IWC A;  2MDR A;  2L2N A;  1P47 A;  4F9B B;  5KL3 A;  2EMF A;  1UIL A;  4RHB B;  1ZAA C;  4DUZ E;  3EPK A;  2EPR A;  3J7A G;  4M2Z A;  3QG5 C;  4OOG C;  5IXM B;  2GHF A;  3HXL A;  2RTX A;  1YUJ A;  2I9I A;  2DLK A;  2EN3 A;  2EOZ A;  4R2Q A;  1TF6 A;  1YUI A;  4JI0 E;  2NAB A;  2DB2 A;  4J8Z A;  2DIX A;  4I8O A;  1T4L B;  1X6E A;  1YYW A;  2EMG A;  2EN2 A;  2JY9 A;  2V85 A;  3KZY A;  2CT1 A;  3MSW A;  4BHB A;  5LMN E;  5KL5 A;  4IS1 C;  4F6N A;  2EQ0 A;  3HTX A;  4TUI A;  1PJQ A;  2ENH A;  2EPM X;  4GKK E;  3J7Y p;  4KZS A;  4JI8 E;  3DF6 A;  4FK5 C;  4WSP A;  4DV3 E;  1IBL E;  4JI6 E;  4ZYE A;  3MHH C;  5ADZ A;  4DR7 E;  2L3C A;  4P78 A;  2EMY A;  3EPH A;  1NCS A;  2VQE E;  2ELZ A;  2RSI A;  2EL6 A;  2M7Q A;  4TUG A;  1AAY A;  2LCE A;  3VYX A;  2EOY A;  2CPN A;  2ELY A;  2LUQ A;  2B9D A;  3OML A;  2EOF A;  1LLM C;  4B3T E;  3AV0 A;  4BC7 A;  2M9A A;  1YZ9 A;  1EH6 A;  2LRS A;  2EPN A;  2FTX B;  2EPK X;  4O5G A;  2N3G A;  1EH7 A;  1Z1B A;  1GTK A;  2CSH A;  1X6F A;  2JXP A;  2FGG A;  2MKD A;  2EN4 A;  1KJK A;  4DMI A;  4DV1 E;  2EMW A;  1WRJ A;  2JR1 A;  2KON A;  2JYA A;  3J81 C;  3VK6 A;  4X66 E;  2V89 A;  2NA2 A;  2LTS A;  4X65 E;  2UUC E;  4YHH E;  1DI2 A;  4ZYH A;  2YTE A;  3LML A;  1YSA C;  5TSE A;  3HPS A;  1WJP A;  2I13 A;  4AQY E;  5A6A A;  1UBD C;  4DV0 E;  1XMO E;  3C6M A;  4JI2 E;  3HPZ A;  2YPN A;  2UXC E;  2EN8 A;  2EM0 A;  3J80 C;  2WCC 3;  4F6M A;  4DR2 E;  2YU5 A;  3ADJ A;  3FIG A;  4X64 E;  1YYK A;  2KHX A;  1L4S A;  4LF4 E;  2F4V E;  2LJH A;  2B3T B;  3C4B A;  1FJG E;  4GKJ E;  5LMU E;  2V86 A;  2N3H A;  3P1X A;  2VF1 A;  1TN9 A;  2G7H A;  2EZ6 A;  2CTD A;  1A1L A;  5BR8 E;  2H36 X;  2YT4 A;  1IQO A;  1GZ6 A;  2EE8 A;  4LFC E;  4JI1 E;  4LF8 E;  2YTO A;  2YTN A;  5A6J A;  1YYO A;  2R1F A;  4DR6 E;  4DR5 E;  2BB8 A;  2DGC A;  1XNR E;  2JWO A;  2DSY A;  1MGT A;  3ECR A;  4B3M E;  2EPA A;  4ZYG A;  4NZV A;  1RMD A;  4YY3 E;  2MC6 A;  4DR1 E;  4LF9 E;  4HEI A;  2V88 A;  1KYQ A;  2EOH A;  4WYQ B;  4F9A B;  2VRD A;  2L2K B;  1EH8 A;  2JOX A;  4DV6 E;  2EM9 A;  4R8O A;  1N32 E;  2EML A;  3UK3 C;  2WBU A;  5LLQ A;  5AC5 A;  1QU6 A;  2BBG A;  2LO3 A;  4L5N C;  3IWB A;  5A6B A;  2YTI A;  4F9C B;  1PDA A;  2J7J A;  1X3C A;  4B3S E;  5LL6 R;  2ZM6 E;  4KWY A;  2EPU A;  2EM7 A;  2EL5 A;  2A25 A;  2EPC A;  1IQS A;  2YZT A;  2EMZ A;  2EMA A;  1BB8 A;  4O43 A;  2LUP B;  2JOB A;  1YFH A;  1N36 E;  3T1Y E;  2E1M A;  4GEQ B;  1GQE A;  1STU A;  1HNZ E;  2NUE A;  3BID A;  3TQM A;  1A1J A;  1T4O A;  3C4T A;  2EMK A;  5KL6 A;  2MKN A;  1WHN A;  2HC5 A;  4P7D A;  2RPC A;  4R2D A;  2HHH E;  2EPP A;  2HJJ A;  1JK2 A;  3F6G A;  2GLI A;  3ADI A;  2EM8 A;  1G2D C;  4JYA E;  3HQ1 A;  1O0W A;  4R2P A;  2EOI A;  2D9H A;  5KL7 A;  4X9J A;  5KL4 A;  1J5E E;  2YRH A;  3EPJ A;  4LFA E;  4OX9 E;  4X62 E;  2V8Q B;  4M0V A;  4O4K A;  2EOE A;  2FV4 B;  4WFT A;  2EWL A;  5F3W A;  3M99 B;  2RS7 A;  1WXR A;  1UHZ A;  4O24 A;  1TF3 A;  1T4N A;  2UXD E;  2EOO A;  2EP3 A;  1X5W A;  2V87 A;  3LLH A;  2YSO A;  3F6H A;  3KZZ A;  2LT7 A;  3ZOQ B;  1JK1 A;  5AE1 A;  4NXN E;  2YTF A;  2WBT A;  1HNX E;  2R76 A;  4LF5 E;  1WHQ A;  2M4I A;  2B7T A;  1YPN A;  2LE2 A;  2EOJ A;  2B7V A;  1AH5 A;  3EQ1 A;  2EMC A;  1A1K A;  1QNT A;  3RMP A;  5AE3 A;  5IT9 C;  2ADR A;  1X48 A;  2WBS A;  1DGC A;  5IWA E;  2E5L E;  1N33 E;  2EM5 A;  2LJU A;  2HGH A;  4JI4 E;  4MLV A;  4BBY A;  1RC7 A;  1A1H A;  3ADG A;  2LV2 A;  1G2F C;  1IBM E;  2UU9 E;  4R2C A;  4R2S A;  2PRT A;  4R2A A;  1J26 A;  1UN6 B;  4R2R A;  4R03 A;  5FLX C;  2L3J A;  4ZYD A;  4JI7 E;  2MC5 A;  4MLQ A;  2L2M A;  3MHS C;  3JU0 A;  1N34 E;  1BBG A;  4K0K E;  4KHP E;  4DV5 E;  5T6J A;  4DV2 E;  1A1G A;  1HNW E;  1PKP A;  2EN6 A;  2EPO A;  2YTD A;  1X49 A;  2IHR 1;  4BMJ A;  3VYY A;  2EPL X;  2YSP A;  4RH8 A;  4WX9 A;  2EOM A;  1IMU A;  2UXB E;  4NXM E;  4LFB E;  2DLQ A;  1T38 A;  3VHT B;  2GPI A;  3KWR A;  4M9V C;  2ODR C;  5KL2 A;  1RQ0 A;  4F54 A;  1ZBQ A;  1A1I A;  2EOQ A;  4X8W A;  3THO B;  5IV8 B;  1F2I G;  4DR4 E;  2VE7 C;  2EN7 A;  5AAS A;  4LF7 E;  2EM2 A;  2RSM A;  2L8T A;  4LTY A;  1ZR9 A;  2EMX A;  3BBG A;  1FKA E;  2KOU A;  4JI5 E;  4JV5 E;  1BBO A;  2YTJ A;  2EMB A;  2ODR D;  1T39 A;  4GZN C;  2EM4 A;  2EPZ A;  2EM3 A;  2EOX A;  4M30 A;  2EN1 A;  2DRP A;  5AC4 A;  4L8N A;  4WXC A;  2NUF A;  1A1F A;  2L92 A;  3BGH A;  1X47 A;  2V83 A;  2YTP A;  5A6B D;  3EPL A;  1N3G A;  2E72 A;  4WSG A;  4DV7 E;  1XNQ E;  4BHC A;  5AE2 A;  3THN A;  2EPX A;  3K6Q A;  2UUA E;  2YU8 A;  4BC9 A;  3AUZ A;  1HR0 E;  4IJD A;  2JVA A;  1PJS A;  2EQ1 A;  3T1H E;  2MDG A;  5A69 A;  1ZBT A;  2EJ4 A;  4WXD A;  1B69 A;  2EOS A;  3H09 A;  3L00 A;  2ENC A;  2K4V A;  4R2E A;  4BS9 A;  2UUB E;  1DQ3 A;  2DMI A;  1SR9 A;  2LMZ A;  2Q8U A;  1XMQ E;  2NUG A;  5A6K A;  2K7I A;  2M1S A;  2LTR A;  3BF2 A;  5CFF E;  2LVH A;  2EMH A;  2YWQ A;  3C6K A;  3OTO E;  3DJW A;  4LF6 E;  2JPA A;  4DUY E;  5DNY A;  1I94 E;  4N4R B;  2DMY A;  4F2J C;  2EMI A;  2EQ3 A;  1X6H A; 
#chains in the Genus database with same CATH homology
 2L6M A;  2LRS A;  1QU6 A;  2L33 A;  3JTZ A;  5T6J A;  4DV2 E;  4DV5 E;  4JI3 E;  1HNW E;  1PKP A;  4L5N C;  2FTX B;  3IWB A;  1EKZ A;  5A2Q C;  2F8B A;  2N3G A;  4WPY A;  2VQF E;  2IHR 1;  4BMJ A;  4F9C B;  3VYY A;  3IWD A;  4B3S E;  2WZO A;  5LL6 R;  3JAM C;  2ZM6 E;  2LBS B;  2UXB E;  4NXM E;  4DKK A;  4LFB E;  2RS6 A;  2FGG A;  4BCA A;  2YZT A;  3KWR A;  2ODR C;  4DMI A;  2LUP B;  2JOB A;  4Q28 A;  4DV1 E;  4LU9 A;  1N36 E;  1RQ0 A;  4DR3 E;  3T1Y E;  2E1M A;  4GEQ B;  4F54 A;  4B3R E;  1ZBQ A;  3ADL A;  1GQE A;  1STU A;  2JR1 A;  4X8W A;  1HNZ E;  2KON A;  3J81 C;  4DV4 E;  2NUE A;  2VE7 C;  1T4O A;  2V89 A;  3C4T A;  3VK6 A;  5AAS A;  4X66 E;  1IBK E;  3IWC A;  4LF7 E;  2NA2 A;  2MDR A;  1WHN A;  4P7D A;  2L2N A;  2RSM A;  2LTS A;  2L8T A;  4LTY A;  4F9B B;  4X65 E;  2HHH E;  2UUC E;  4DR4 E;  1UIL A;  4YHH E;  1FKA E;  1DI2 A;  2KOU A;  4JI5 E;  3F6G A;  4DUZ E;  3ADI A;  4JV5 E;  3LML A;  4JYA E;  3HQ1 A;  1O0W A;  3J7A G;  4M2Z A;  2ODR D;  4OOG C;  3HPS A;  1J5E E;  4LFA E;  4AQY E;  4OX9 E;  3HXL A;  2RTX A;  4M30 A;  4X62 E;  2V8Q B;  4DV0 E;  1XMO E;  4M0V A;  2FV4 B;  4JI2 E;  4JI0 E;  4WFT A;  2EWL A;  3HPZ A;  5F3W A;  2DB2 A;  2RS7 A;  4J8Z A;  2UXC E;  1WXR A;  2DIX A;  4I8O A;  1T4L B;  1UHZ A;  4L8N A;  2NUF A;  2UXD E;  1T4N A;  2L92 A;  1X47 A;  3J80 C;  2V83 A;  1YYW A;  2JY9 A;  2V85 A;  2V87 A;  3LLH A;  4DR2 E;  3F6H A;  3ADJ A;  3FIG A;  4X64 E;  1YYK A;  2KHX A;  3MSW A;  3ZOQ B;  4DV7 E;  5LMN E;  4LF4 E;  1XNQ E;  2F4V E;  5AE1 A;  2LJH A;  2B3T B;  3C4B A;  4NXN E;  1FJG E;  4GKJ E;  5LMU E;  2V86 A;  2N3H A;  3P1X A;  5AE2 A;  2VF1 A;  1HNX E;  3HTX A;  4TUI A;  4LF5 E;  1WHQ A;  2G7H A;  3K6Q A;  2UUA E;  2EZ6 A;  2M4I A;  2B7T A;  2LE2 A;  4BC9 A;  3AUZ A;  1HR0 E;  4GKK E;  3J7Y p;  2B7V A;  4KZS A;  4JI8 E;  5BR8 E;  2JVA A;  3DF6 A;  2H36 X;  2YT4 A;  4WSP A;  4DV3 E;  3T1H E;  1IBL E;  4JI6 E;  3RMP A;  5AE3 A;  1ZBT A;  5IT9 C;  1X48 A;  5ADZ A;  4DR7 E;  1GZ6 A;  2L3C A;  4LFC E;  3H09 A;  4P78 A;  4JI1 E;  5IWA E;  2E5L E;  4LF8 E;  2K4V A;  1N33 E;  2VQE E;  4BS9 A;  2UUB E;  1DQ3 A;  1YYO A;  4DR6 E;  4DR5 E;  2M7Q A;  1SR9 A;  2LMZ A;  4TUG A;  4BBY A;  1XMQ E;  1RC7 A;  4JI4 E;  2NUG A;  3ADG A;  1XNR E;  2JWO A;  2DSY A;  3VYX A;  2M1S A;  4B3M E;  2CPN A;  2LTR A;  1IBM E;  2UU9 E;  5CFF E;  2LUQ A;  1J26 A;  4YY3 E;  2MC6 A;  3OTO E;  2B9D A;  4DR1 E;  4LF9 E;  3OML A;  4R03 A;  2V88 A;  3DJW A;  5FLX C;  2L3J A;  4LF6 E;  4WYQ B;  4DUY E;  2L2K B;  5DNY A;  4B3T E;  4JI7 E;  2MC5 A;  3AV0 A;  2L2M A;  4BC7 A;  1I94 E;  3JU0 A;  2JOX A;  1YZ9 A;  2DMY A;  4R8O A;  4DV6 E;  1N34 E;  1X49 A;  4F9A B;  1N32 E;  4K0K E;  4KHP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...