2LUQA

Solution structure of double-stranded rna binding domain of s.cerevisiae rnase iii (rnt1p)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease 3
publication title Intrinsic Dynamics of an Extended Hydrophobic Core in the S. cerevisiae RNase III dsRBD Contributes to Recognition of Specific RNA Binding Sites.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2luqA00
2DIXA 2RTXA 4DR2E 4JI3E 4GKJE 2UUAE 4WYQB 2RS7A 4X66E 2UUCE 1IBLE 1UILA 1J5EE 4JV5E 4DR4E 2LTRA 2NA2A 4JI5E 2E5LE 2UXCE 2VQFE 4LF8E 2NUGA 4LFBE 1GQEA 2VQEE 1DI2A 1EKZA 2N3HA 2KHXA 4X65E 2L2NA 4JYAE 1I94E 1X47A 1XNRE 4LF4E 2UU9E 1T4LB 1HNZE 2EZ6A 1WHQA 3T1YE 5IWAE 4LF5E 1X49A 4LFCE 1STUA 2B3TB 1N34E 2UXDE 4DKKA 4X8WA 1RQ0A 2JY9A 1YYWA 3ADIA 1YYOA 4DV5E 1PKPA 4DV6E 1N36E 3LLHA 4JI1E 4B3ME 4JI2E 4JI6E 1T4NA 2LUQA 5LMUE 3C4BA 1YZ9A 1ZBTA 1YYKA 2L3CA 1RC7A 2L3JA 1IBME 3J7Yp 1J26A 4LF6E 4KHPE 1X48A 4WFTA 1N32E 4YY3E 4JI4E 4DV0E 2B7TA 3ADGA 1T4OA 4NXME 3C4TA 1XMOE 2UUBE 3ADLA 4B3TE 1XNQE 2RSMA 4YHHE 3HTXA 2F4VE 4DR3E 2NUFA 2CPNA 3VYXA 4X64E 4X62E 2NUEA 2LBSB 4JI8E 3VYYA 4GKKE 4JI7E 2UXBE 2LTSA 1WHNA 4DUYE 1HNXE 1N33E 1HR0E 1HNWE 2MDRA 4JI0E 2N3GA 4DR7E 2B7VA 3ADJA 1O0WA 4DUZE 4DV2E 4B3RE 4DV1E 4DR6E 1XMQE 2DB2A 4OOGC 5LMNE 4DV7E 4LF7E 4LFAE 2ZM6E 1FJGE 3T1HE 4M30A 4NXNE 1QU6A 2DMYA 4DR5E 4M2ZA 4LF9E 1FKAE 3OTOE 2LRSA 4DV4E 2JVAA 2L33A 2LJHA 4DV3E 4DR1E 5BR8E 1IBKE 4B3SE 2HHHE 2IHR1 2L2KB 5CFFE 1UHZA 2L2MA 2YT4A 2LUPB 4AQYE 3P1XA 2RS6A 4OX9E 4K0KE
chains in the Genus database with same CATH superfamily
2EMXA 5LL6R 2EN4A 4X66E 2J7JA 1J5EE 4DR4E 4JI5E 2E5LE 3ZOQB 2UXCE 5AC5A 5ADZA 4WXCA 2VQFE 3EQ1A 2EE8A 2EL4A 2EJ4A 3BIDA 2YTEA 2V88A 1EKZA 4HTGA 4WSGA 4LU9A 4Q28A 4F6NA 2UU9E 5IWAE 1X6FA 3HPZA 1EH8A 1X49A 2JXPA 5A6JA 2B3TB 1TF6A 2LVHA 4KWYA 1MEYC 3TQMA 2YRKA 4FK5C 2GHFA 1ZR9A 1LLMC 4DV5E 2ELYA 3IWBA 2EPLX 4JI1E 4BBYA 4B3ME 4JI2E 2DLKA 1UBDC 5LMUE 3C4BA 1ZBTA 4BC9A 5AASA 4BHCA 2L3CA 3AUZA 1IBME 2RQLA 3J7Yp 1RMDA 4LF6E 4TUIA 1J26A 1X48A 1N32E 2EN6A 3BF2A 1T4OA 1GTKA 1MGTA 2YTDA 2L6MA 2EOZA 2YSPA 4YHHE 4R8OA 2K4VA 2CPNA 1NEIA 4GKKE 4JI7E 2UXBE 2LTSA 3KWRA 4DUYE 5AE2A 2JP9A 2E72A 2N3GA 2B7VA 3ADJA 4DUZE 3FIGA 4DR6E 5KL6A 4O4KA 2CT1A 2DRPA 4LFAE 4NXNE 1QU6A 2D9HA 2EPPA 4R03A 4LF9E 3OTOE 4DV4E 2EOQA 5TSEA 5FLXC 4DR1E 2EMKA 2HHHE 3C6KA 2MKNA 2EQ1A 1UHZA 5A69A 2A25A 2RS6A 4OX9E 2EM9A 1YYKA 5IT9C 2RTXA 2EN7A 1EH6A 1EH7A 2RS7A 5A6BD 4RHBB 4JV5E 2EL5A 4ZYGA 2ADRA 2MDGA 5KL3A 1A1KA 4BC7A 2L92A 2LJUA 4O24A 2NUGA 3MHHC 3F6HA 4WXDA 4HEIA 4M9VC 3M99B 3ECRA 2N3HA 1A1FA 1BBGA 4JYAE 2KONA 2BBGA 1XNRE 2WBUA 2B9DA 3KZYA 4DMIA 4F54A 1N34E 4F6MA 2L8TA 4X8WA 2EOEA 1IMUA 4GZNC 1PJSA 2EPZA 2EPCA 1YYWA 2EM3A 1DGCA 2I13A 3VK6A 2EOYA 5F3WA 1KJKA 1G2FC 1YUJA 2EPMX 4F2JC 3LLHA 1YPNA 2EMAA 1T38A 2EOJA 5A6AA 5T6JA 2JYAA 1YZ9A 3JAMC 1DQ3A 4R2CA 3MHSC 5LLQA 2EQ0A 4WX9A 5A6KA 3K6QA 3UK3C 4KHPE 4R2AA 3ADGA 2LO3A 2HC5A 5KL5A 4O43A 5A6BA 4R2SA 4IJDA 4R2EA 3AV0A 4BHBA 2EMIA 2RSMA 2EN8A 3BGHA 3RMPA 3HTXA 2F4VE 2V86A 4DR3E 1TF3A 3VYXA 2Q8UA 4X62E 4X9JA 3VYYA 2YTOA 2LE2A 5AE1A 1T39A 2YSOA 2EN1A 4L5NC 4BCAA 1HNWE 2I9IA 2JWOA 1O0WA 2EPXA 2FV4B 2EOSA 1KYQA 1A1JA 4J8ZA 1PJTA 4LF7E 1A1LA 4N4RB 2EM2A 2YRHA 4KZSA 1WJPA 1JK1A 3IWDA 1IBKE 1BB8A 2H36X 2EPRA 2EPAA 2MKDA 2L2MA 2LUPB 2EOHA 2DIXA 4MLQA 4GKJE 2EM4A 2UUAE 2YTGA 2UUCE 2F8BA 3C6MA 1Z1BA 4GEQB 3BBGA 2ODRD 2YTJA 1BBOA 4IS1C 2YU5A 4Q35B 1GQEA 2VQEE 2KHXA 4LF4E 2YPNA 1HNZE 1WHQA 3T1YE 2EN3A 2EMWA 4LFCE 1STUA 2N8XA 1X3CA 5AC4A 4WPYA 2UXDE 2YTPA 4DKKA 1X5WA 2JY9A 3JTZA 3THOB 3LMLA 3JU0A 1YYOA 2EL6A 3J81C 4DV6E 1N36E 1ZAAC 2R76A 3J7AG 1T4NA 2KOUA 1A1GA 3HXLA 1F2IG 5A2QC 2L3JA 4M0VA 2EPUA 4YY3E 5KL7A 1X6HA 4JI4E 2EP3A 2B7TA 2DSYA 1X6EA 2EOFA 2M1SA 2DGCA 2CTDA 4NXME 1NCSA 2EMFA 2ENAA 4P7DA 2V83A 2EN2A 2ELZA 2NUFA 1ZBQA 4ZYEA 2NUEA 1YSAC 2WBSA 2G7HA 2JR1A 1WHNA 2LV2A 2DMIA 2JOXA 2R1FA 2YTNA 3KZZA 2MC6A 3L00A 2EMHA 2EM6A 3HQ1A 2EMGA 1A1HA 4DV2E 4DV1E 2EMLA 2ODRC 1XMQE 2DB2A 4OOGC 5LMNE 4DV7E 2VE7C 2ZM6E 1FJGE 4L8NA 1WRJA 2WBTA 2E1MA 2DMYA 4DR5E 2MC5A 4NHRA 2GPIA 3DJWA 2LRSA 2JVAA 2L33A 5BR8E 2NABA 2V85A 2EM5A 2ENHA 2DLQA 2YT4A 4AQYE 4F9BB 3P1XA 2EPKX 4LTYA 1GZ6A 2YWQA 4K0KE 4DR2E 4JI3E 3EPKA 4WYQB 4R2PA 1IBLE 2PRTA 1UILA 3OMLA 3IWCA 3MSWA 2LTRA 2EOMA 2NA2A 2YTFA 2V87A 1P47A 2EPOA 4F9CB 2JOBA 2VRDA 1ZU1A 4LF8E 4LFBE 3F6GA 1WXRA 1DI2A 2EM8A 2LCEA 4X65E 4P78A 2M9AA 2L2NA 2YTQA 2HGHA 1I94E 1X47A 1B69A 1G2DC 1T4LB 2BB8A 2EZ6A 4LF5E 2YU8A 2FTXB 4R2QA 3EPHA 1RQ0A 3ADIA 2RSIA 2EORA 3VHTB 1PKPA 1YFHA 1QNTA 1IQSA 5KL4A 4JI6E 1SR9A 2LUQA 2RPCA 4O5GA 2WZOA 2EMZA 4ZYHA 1AH5A 2WCC3 3H09A 1RC7A 2YRMA 4WFTA 2EM0A 2EOOA 4DV0E 1TN9A 4BS9A 2FGGA 4BMJA 1IQOA 1JK2A 2JPAA 5DNYA 3C4TA 1XMOE 3EPLA 2UUBE 3ADLA 4B3TE 4WSPA 2LMZA 1XNQE 4I8OA 1SFEA 2EMCA 5IV8B 2V8QB 4X64E 2EOIA 2LBSB 4JI8E 2EOXA 2M4IA 2LT7A 3THNA 4MLVA 3J80C 1HNXE 2EM7A 1HR0E 1N33E 2MDRA 4RH8A 3QG5C 3DF6A 4JI0E 4DR7E 2EWLA 4B3RE 1UN6B 2YZTA 1N3GA 1YUIA 2EQ3A 1L4SA 2EMYA 5AE3A 2V89A 4R2RA 3T1HE 4M30A 1PDAA 5IXMB 1A1IA 2HJJA 4R2DA 3EPJA 4ZYDA 1PJQA 3HPSA 2CSHA 4M2ZA 1FKAE 5KL2A 2M7QA 4B3SE 2LJHA 2EPNA 4DV3E 2GLIA 1AAYA 2EMBA 2IHR1 2YTIA 5CFFE 2VF1A 2L2KB 2ENCA 2K7IA 4NZVA 4TUGA 4F9AB
chains in the Genus database with same CATH topology
5IT9C 2DIXA 2RTXA 4DR2E 4JI3E 5LL6R 4GKJE 2UUAE 4WYQB 2RS7A 4X66E 2UUCE 2F8BA 1IBLE 1UILA 3OMLA 1J5EE 4JV5E 3IWCA 3MSWA 4DR4E 2LTRA 2NA2A 4JI5E 2E5LE 3ZOQB 4GEQB 2UXCE 2V87A 2ODRD 4BC7A 4F9CB 2L92A 2JOBA 5ADZA 2VQFE 4LF8E 2NUGA 4LFBE 1GQEA 3F6GA 1WXRA 3F6HA 2VQEE 1DI2A 2V88A 1EKZA 2N3HA 2KHXA 4X65E 4P78A 2L2NA 4JYAE 4LU9A 2KONA 1I94E 1X47A 1XNRE 4Q28A 4LF4E 2UU9E 1T4LB 1HNZE 2EZ6A 1WHQA 3T1YE 2B9DA 5IWAE 4LF5E 3HPZA 1X49A 4B3SE 2FTXB 1STUA 4DMIA 2B3TB 4F54A 1N34E 4LFCE 2UXDE 4WPYA 2L8TA 4DKKA 4X8WA 1RQ0A 2JY9A 3JTZA 1YYWA 3LMLA 3ADIA 3JU0A 1YYOA 4DV5E 1PKPA 3VK6A 3J81C 4DV6E 1N36E 5F3WA 1GZ6A 3IWBA 3LLHA 4JI1E 4BBYA 4B3ME 4JI2E 3J7AG 4JI6E 1SR9A 1T4NA 2KOUA 2LUQA 5LMUE 5T6JA 2WZOA 3C4BA 1YZ9A 1ZBTA 4BC9A 3JAMC 5AASA 1DQ3A 1YYKA 2L3CA 3HXLA 3AUZA 3H09A 5A2QC 1RC7A 2L3JA 1IBME 4M0VA 3J7Yp 1J26A 4LF6E 4TUIA 3K6QA 4KHPE 1X48A 4WFTA 1N32E 4YY3E 4DR7E 4JI4E 4DV0E 4BS9A 2B7TA 2DSYA 2FGGA 1T4OA 3ADGA 2M1SA 4BMJA 4NXME 2L6MA 3C4TA 5DNYA 1XMOE 2UUBE 4P7DA 3ADLA 3AV0A 2V83A 4B3TE 4WSPA 2LMZA 1XNQE 4I8OA 2RSMA 4YHHE 3RMPA 3HTXA 4R8OA 2F4VE 2V86A 4DR3E 2K4VA 2NUFA 2CPNA 2V8QB 4X64E 3VYXA 1ZBQA 4X62E 2NUEA 2LBSB 4JI8E 3VYYA 2M4IA 4GKKE 4JI7E 2G7HA 2JR1A 2UXBE 2LTSA 1WHNA 2LE2A 5AE1A 2JOXA 3KWRA 4DUYE 3J80C 1HNXE 1N33E 1HR0E 4L5NC 2MC6A 4BCAA 1HNWE 2MDRA 5AE2A 2JWOA 3DF6A 2N3GA 3HQ1A 4JI0E 2B7VA 3ADJA 1O0WA 2EWLA 2FV4B 4DUZE 4DV2E 4DV1E 3FIGA 4B3RE 4DR6E 2ODRC 1XMQE 4J8ZA 2DB2A 2YZTA 4OOGC 5LMNE 4DV7E 4LF7E 2VE7C 5AE3A 2V89A 2ZM6E 4LFAE 3T1HE 4L8NA 4M30A 4NXNE 1FJGE 4K0KE 2E1MA 1QU6A 2DMYA 4DR5E 2MC5A 3HPSA 4KZSA 4R03A 4M2ZA 4LF9E 3DJWA 3OTOE 1FKAE 2LRSA 2M7QA 2JVAA 2L33A 2LJHA 3IWDA 5FLXC 5BR8E 4DV3E 4DV4E 4DR1E 1IBKE 2HHHE 2H36X 2IHR1 2V85A 2L2KB 5CFFE 2VF1A 1UHZA 2L2MA 2YT4A 4F9BB 2LUPB 4AQYE 3P1XA 4LTYA 4TUGA 2RS6A 4OX9E 4F9AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIX A;  2RTX A;  4DR2 E;  4JI3 E;  4GKJ E;  2UUA E;  4WYQ B;  2RS7 A;  4X66 E;  2UUC E;  1IBL E;  1UIL A;  1J5E E;  4JV5 E;  4DR4 E;  2LTR A;  2NA2 A;  4JI5 E;  2E5L E;  2UXC E;  2VQF E;  4LF8 E;  2NUG A;  4LFB E;  1GQE A;  2VQE E;  1DI2 A;  1EKZ A;  2N3H A;  2KHX A;  4X65 E;  2L2N A;  4JYA E;  1I94 E;  1X47 A;  1XNR E;  4LF4 E;  2UU9 E;  1T4L B;  1HNZ E;  2EZ6 A;  1WHQ A;  3T1Y E;  5IWA E;  4LF5 E;  1X49 A;  4LFC E;  1STU A;  2B3T B;  1N34 E;  2UXD E;  4DKK A;  4X8W A;  1RQ0 A;  2JY9 A;  1YYW A;  3ADI A;  1YYO A;  4DV5 E;  1PKP A;  4DV6 E;  1N36 E;  3LLH A;  4JI1 E;  4B3M E;  4JI2 E;  4JI6 E;  1T4N A;  2LUQ A;  5LMU E;  3C4B A;  1YZ9 A;  1ZBT A;  1YYK A;  2L3C A;  1RC7 A;  2L3J A;  1IBM E;  3J7Y p;  1J26 A;  4LF6 E;  4KHP E;  1X48 A;  4WFT A;  1N32 E;  4YY3 E;  4JI4 E;  4DV0 E;  2B7T A;  3ADG A;  1T4O A;  4NXM E;  3C4T A;  1XMO E;  2UUB E;  3ADL A;  4B3T E;  1XNQ E;  2RSM A;  4YHH E;  3HTX A;  2F4V E;  4DR3 E;  2NUF A;  2CPN A;  3VYX A;  4X64 E;  4X62 E;  2NUE A;  2LBS B;  4JI8 E;  3VYY A;  4GKK E;  4JI7 E;  2UXB E;  2LTS A;  1WHN A;  4DUY E;  1HNX E;  1N33 E;  1HR0 E;  1HNW E;  2MDR A;  4JI0 E;  2N3G A;  4DR7 E;  2B7V A;  3ADJ A;  1O0W A;  4DUZ E;  4DV2 E;  4B3R E;  4DV1 E;  4DR6 E;  1XMQ E;  2DB2 A;  4OOG C;  5LMN E;  4DV7 E;  4LF7 E;  4LFA E;  2ZM6 E;  1FJG E;  3T1H E;  4M30 A;  4NXN E;  1QU6 A;  2DMY A;  4DR5 E;  4M2Z A;  4LF9 E;  1FKA E;  3OTO E;  2LRS A;  4DV4 E;  2JVA A;  2L33 A;  2LJH A;  4DV3 E;  4DR1 E;  5BR8 E;  1IBK E;  4B3S E;  2HHH E;  2IHR 1;  2L2K B;  5CFF E;  1UHZ A;  2L2M A;  2YT4 A;  2LUP B;  4AQY E;  3P1X A;  2RS6 A;  4OX9 E;  4K0K E; 
#chains in the Genus database with same CATH topology
 2EMX A;  5LL6 R;  2EN4 A;  4X66 E;  2J7J A;  1J5E E;  4DR4 E;  4JI5 E;  2E5L E;  3ZOQ B;  2UXC E;  5AC5 A;  5ADZ A;  4WXC A;  2VQF E;  3EQ1 A;  2EE8 A;  2EL4 A;  2EJ4 A;  3BID A;  2YTE A;  2V88 A;  1EKZ A;  4HTG A;  4WSG A;  4LU9 A;  4Q28 A;  4F6N A;  2UU9 E;  5IWA E;  1X6F A;  3HPZ A;  1EH8 A;  1X49 A;  2JXP A;  5A6J A;  2B3T B;  1TF6 A;  2LVH A;  4KWY A;  1MEY C;  3TQM A;  2YRK A;  4FK5 C;  2GHF A;  1ZR9 A;  1LLM C;  4DV5 E;  2ELY A;  3IWB A;  2EPL X;  4JI1 E;  4BBY A;  4B3M E;  4JI2 E;  2DLK A;  1UBD C;  5LMU E;  3C4B A;  1ZBT A;  4BC9 A;  5AAS A;  4BHC A;  2L3C A;  3AUZ A;  1IBM E;  2RQL A;  3J7Y p;  1RMD A;  4LF6 E;  4TUI A;  1J26 A;  1X48 A;  1N32 E;  2EN6 A;  3BF2 A;  1T4O A;  1GTK A;  1MGT A;  2YTD A;  2L6M A;  2EOZ A;  2YSP A;  4YHH E;  4R8O A;  2K4V A;  2CPN A;  1NEI A;  4GKK E;  4JI7 E;  2UXB E;  2LTS A;  3KWR A;  4DUY E;  5AE2 A;  2JP9 A;  2E72 A;  2N3G A;  2B7V A;  3ADJ A;  4DUZ E;  3FIG A;  4DR6 E;  5KL6 A;  4O4K A;  2CT1 A;  2DRP A;  4LFA E;  4NXN E;  1QU6 A;  2D9H A;  2EPP A;  4R03 A;  4LF9 E;  3OTO E;  4DV4 E;  2EOQ A;  5TSE A;  5FLX C;  4DR1 E;  2EMK A;  2HHH E;  3C6K A;  2MKN A;  2EQ1 A;  1UHZ A;  5A69 A;  2A25 A;  2RS6 A;  4OX9 E;  2EM9 A;  1YYK A;  5IT9 C;  2RTX A;  2EN7 A;  1EH6 A;  1EH7 A;  2RS7 A;  5A6B D;  4RHB B;  4JV5 E;  2EL5 A;  4ZYG A;  2ADR A;  2MDG A;  5KL3 A;  1A1K A;  4BC7 A;  2L92 A;  2LJU A;  4O24 A;  2NUG A;  3MHH C;  3F6H A;  4WXD A;  4HEI A;  4M9V C;  3M99 B;  3ECR A;  2N3H A;  1A1F A;  1BBG A;  4JYA E;  2KON A;  2BBG A;  1XNR E;  2WBU A;  2B9D A;  3KZY A;  4DMI A;  4F54 A;  1N34 E;  4F6M A;  2L8T A;  4X8W A;  2EOE A;  1IMU A;  4GZN C;  1PJS A;  2EPZ A;  2EPC A;  1YYW A;  2EM3 A;  1DGC A;  2I13 A;  3VK6 A;  2EOY A;  5F3W A;  1KJK A;  1G2F C;  1YUJ A;  2EPM X;  4F2J C;  3LLH A;  1YPN A;  2EMA A;  1T38 A;  2EOJ A;  5A6A A;  5T6J A;  2JYA A;  1YZ9 A;  3JAM C;  1DQ3 A;  4R2C A;  3MHS C;  5LLQ A;  2EQ0 A;  4WX9 A;  5A6K A;  3K6Q A;  3UK3 C;  4KHP E;  4R2A A;  3ADG A;  2LO3 A;  2HC5 A;  5KL5 A;  4O43 A;  5A6B A;  4R2S A;  4IJD A;  4R2E A;  3AV0 A;  4BHB A;  2EMI A;  2RSM A;  2EN8 A;  3BGH A;  3RMP A;  3HTX A;  2F4V E;  2V86 A;  4DR3 E;  1TF3 A;  3VYX A;  2Q8U A;  4X62 E;  4X9J A;  3VYY A;  2YTO A;  2LE2 A;  5AE1 A;  1T39 A;  2YSO A;  2EN1 A;  4L5N C;  4BCA A;  1HNW E;  2I9I A;  2JWO A;  1O0W A;  2EPX A;  2FV4 B;  2EOS A;  1KYQ A;  1A1J A;  4J8Z A;  1PJT A;  4LF7 E;  1A1L A;  4N4R B;  2EM2 A;  2YRH A;  4KZS A;  1WJP A;  1JK1 A;  3IWD A;  1IBK E;  1BB8 A;  2H36 X;  2EPR A;  2EPA A;  2MKD A;  2L2M A;  2LUP B;  2EOH A;  2DIX A;  4MLQ A;  4GKJ E;  2EM4 A;  2UUA E;  2YTG A;  2UUC E;  2F8B A;  3C6M A;  1Z1B A;  4GEQ B;  3BBG A;  2ODR D;  2YTJ A;  1BBO A;  4IS1 C;  2YU5 A;  4Q35 B;  1GQE A;  2VQE E;  2KHX A;  4LF4 E;  2YPN A;  1HNZ E;  1WHQ A;  3T1Y E;  2EN3 A;  2EMW A;  4LFC E;  1STU A;  2N8X A;  1X3C A;  5AC4 A;  4WPY A;  2UXD E;  2YTP A;  4DKK A;  1X5W A;  2JY9 A;  3JTZ A;  3THO B;  3LML A;  3JU0 A;  1YYO A;  2EL6 A;  3J81 C;  4DV6 E;  1N36 E;  1ZAA C;  2R76 A;  3J7A G;  1T4N A;  2KOU A;  1A1G A;  3HXL A;  1F2I G;  5A2Q C;  2L3J A;  4M0V A;  2EPU A;  4YY3 E;  5KL7 A;  1X6H A;  4JI4 E;  2EP3 A;  2B7T A;  2DSY A;  1X6E A;  2EOF A;  2M1S A;  2DGC A;  2CTD A;  4NXM E;  1NCS A;  2EMF A;  2ENA A;  4P7D A;  2V83 A;  2EN2 A;  2ELZ A;  2NUF A;  1ZBQ A;  4ZYE A;  2NUE A;  1YSA C;  2WBS A;  2G7H A;  2JR1 A;  1WHN A;  2LV2 A;  2DMI A;  2JOX A;  2R1F A;  2YTN A;  3KZZ A;  2MC6 A;  3L00 A;  2EMH A;  2EM6 A;  3HQ1 A;  2EMG A;  1A1H A;  4DV2 E;  4DV1 E;  2EML A;  2ODR C;  1XMQ E;  2DB2 A;  4OOG C;  5LMN E;  4DV7 E;  2VE7 C;  2ZM6 E;  1FJG E;  4L8N A;  1WRJ A;  2WBT A;  2E1M A;  2DMY A;  4DR5 E;  2MC5 A;  4NHR A;  2GPI A;  3DJW A;  2LRS A;  2JVA A;  2L33 A;  5BR8 E;  2NAB A;  2V85 A;  2EM5 A;  2ENH A;  2DLQ A;  2YT4 A;  4AQY E;  4F9B B;  3P1X A;  2EPK X;  4LTY A;  1GZ6 A;  2YWQ A;  4K0K E;  4DR2 E;  4JI3 E;  3EPK A;  4WYQ B;  4R2P A;  1IBL E;  2PRT A;  1UIL A;  3OML A;  3IWC A;  3MSW A;  2LTR A;  2EOM A;  2NA2 A;  2YTF A;  2V87 A;  1P47 A;  2EPO A;  4F9C B;  2JOB A;  2VRD A;  1ZU1 A;  4LF8 E;  4LFB E;  3F6G A;  1WXR A;  1DI2 A;  2EM8 A;  2LCE A;  4X65 E;  4P78 A;  2M9A A;  2L2N A;  2YTQ A;  2HGH A;  1I94 E;  1X47 A;  1B69 A;  1G2D C;  1T4L B;  2BB8 A;  2EZ6 A;  4LF5 E;  2YU8 A;  2FTX B;  4R2Q A;  3EPH A;  1RQ0 A;  3ADI A;  2RSI A;  2EOR A;  3VHT B;  1PKP A;  1YFH A;  1QNT A;  1IQS A;  5KL4 A;  4JI6 E;  1SR9 A;  2LUQ A;  2RPC A;  4O5G A;  2WZO A;  2EMZ A;  4ZYH A;  1AH5 A;  2WCC 3;  3H09 A;  1RC7 A;  2YRM A;  4WFT A;  2EM0 A;  2EOO A;  4DV0 E;  1TN9 A;  4BS9 A;  2FGG A;  4BMJ A;  1IQO A;  1JK2 A;  2JPA A;  5DNY A;  3C4T A;  1XMO E;  3EPL A;  2UUB E;  3ADL A;  4B3T E;  4WSP A;  2LMZ A;  1XNQ E;  4I8O A;  1SFE A;  2EMC A;  5IV8 B;  2V8Q B;  4X64 E;  2EOI A;  2LBS B;  4JI8 E;  2EOX A;  2M4I A;  2LT7 A;  3THN A;  4MLV A;  3J80 C;  1HNX E;  2EM7 A;  1HR0 E;  1N33 E;  2MDR A;  4RH8 A;  3QG5 C;  3DF6 A;  4JI0 E;  4DR7 E;  2EWL A;  4B3R E;  1UN6 B;  2YZT A;  1N3G A;  1YUI A;  2EQ3 A;  1L4S A;  2EMY A;  5AE3 A;  2V89 A;  4R2R A;  3T1H E;  4M30 A;  1PDA A;  5IXM B;  1A1I A;  2HJJ A;  4R2D A;  3EPJ A;  4ZYD A;  1PJQ A;  3HPS A;  2CSH A;  4M2Z A;  1FKA E;  5KL2 A;  2M7Q A;  4B3S E;  2LJH A;  2EPN A;  4DV3 E;  2GLI A;  1AAY A;  2EMB A;  2IHR 1;  2YTI A;  5CFF E;  2VF1 A;  2L2K B;  2ENC A;  2K7I A;  4NZV A;  4TUG A;  4F9A B; 
#chains in the Genus database with same CATH homology
 5IT9 C;  2DIX A;  2RTX A;  4DR2 E;  4JI3 E;  5LL6 R;  4GKJ E;  2UUA E;  4WYQ B;  2RS7 A;  4X66 E;  2UUC E;  2F8B A;  1IBL E;  1UIL A;  3OML A;  1J5E E;  4JV5 E;  3IWC A;  3MSW A;  4DR4 E;  2LTR A;  2NA2 A;  4JI5 E;  2E5L E;  3ZOQ B;  4GEQ B;  2UXC E;  2V87 A;  2ODR D;  4BC7 A;  4F9C B;  2L92 A;  2JOB A;  5ADZ A;  2VQF E;  4LF8 E;  2NUG A;  4LFB E;  1GQE A;  3F6G A;  1WXR A;  3F6H A;  2VQE E;  1DI2 A;  2V88 A;  1EKZ A;  2N3H A;  2KHX A;  4X65 E;  4P78 A;  2L2N A;  4JYA E;  4LU9 A;  2KON A;  1I94 E;  1X47 A;  1XNR E;  4Q28 A;  4LF4 E;  2UU9 E;  1T4L B;  1HNZ E;  2EZ6 A;  1WHQ A;  3T1Y E;  2B9D A;  5IWA E;  4LF5 E;  3HPZ A;  1X49 A;  4B3S E;  2FTX B;  1STU A;  4DMI A;  2B3T B;  4F54 A;  1N34 E;  4LFC E;  2UXD E;  4WPY A;  2L8T A;  4DKK A;  4X8W A;  1RQ0 A;  2JY9 A;  3JTZ A;  1YYW A;  3LML A;  3ADI A;  3JU0 A;  1YYO A;  4DV5 E;  1PKP A;  3VK6 A;  3J81 C;  4DV6 E;  1N36 E;  5F3W A;  1GZ6 A;  3IWB A;  3LLH A;  4JI1 E;  4BBY A;  4B3M E;  4JI2 E;  3J7A G;  4JI6 E;  1SR9 A;  1T4N A;  2KOU A;  2LUQ A;  5LMU E;  5T6J A;  2WZO A;  3C4B A;  1YZ9 A;  1ZBT A;  4BC9 A;  3JAM C;  5AAS A;  1DQ3 A;  1YYK A;  2L3C A;  3HXL A;  3AUZ A;  3H09 A;  5A2Q C;  1RC7 A;  2L3J A;  1IBM E;  4M0V A;  3J7Y p;  1J26 A;  4LF6 E;  4TUI A;  3K6Q A;  4KHP E;  1X48 A;  4WFT A;  1N32 E;  4YY3 E;  4DR7 E;  4JI4 E;  4DV0 E;  4BS9 A;  2B7T A;  2DSY A;  2FGG A;  1T4O A;  3ADG A;  2M1S A;  4BMJ A;  4NXM E;  2L6M A;  3C4T A;  5DNY A;  1XMO E;  2UUB E;  4P7D A;  3ADL A;  3AV0 A;  2V83 A;  4B3T E;  4WSP A;  2LMZ A;  1XNQ E;  4I8O A;  2RSM A;  4YHH E;  3RMP A;  3HTX A;  4R8O A;  2F4V E;  2V86 A;  4DR3 E;  2K4V A;  2NUF A;  2CPN A;  2V8Q B;  4X64 E;  3VYX A;  1ZBQ A;  4X62 E;  2NUE A;  2LBS B;  4JI8 E;  3VYY A;  2M4I A;  4GKK E;  4JI7 E;  2G7H A;  2JR1 A;  2UXB E;  2LTS A;  1WHN A;  2LE2 A;  5AE1 A;  2JOX A;  3KWR A;  4DUY E;  3J80 C;  1HNX E;  1N33 E;  1HR0 E;  4L5N C;  2MC6 A;  4BCA A;  1HNW E;  2MDR A;  5AE2 A;  2JWO A;  3DF6 A;  2N3G A;  3HQ1 A;  4JI0 E;  2B7V A;  3ADJ A;  1O0W A;  2EWL A;  2FV4 B;  4DUZ E;  4DV2 E;  4DV1 E;  3FIG A;  4B3R E;  4DR6 E;  2ODR C;  1XMQ E;  4J8Z A;  2DB2 A;  2YZT A;  4OOG C;  5LMN E;  4DV7 E;  4LF7 E;  2VE7 C;  5AE3 A;  2V89 A;  2ZM6 E;  4LFA E;  3T1H E;  4L8N A;  4M30 A;  4NXN E;  1FJG E;  4K0K E;  2E1M A;  1QU6 A;  2DMY A;  4DR5 E;  2MC5 A;  3HPS A;  4KZS A;  4R03 A;  4M2Z A;  4LF9 E;  3DJW A;  3OTO E;  1FKA E;  2LRS A;  2M7Q A;  2JVA A;  2L33 A;  2LJH A;  3IWD A;  5FLX C;  5BR8 E;  4DV3 E;  4DV4 E;  4DR1 E;  1IBK E;  2HHH E;  2H36 X;  2IHR 1;  2V85 A;  2L2K B;  5CFF E;  2VF1 A;  1UHZ A;  2L2M A;  2YT4 A;  4F9B B;  2LUP B;  4AQY E;  3P1X A;  4LTY A;  4TUG A;  2RS6 A;  4OX9 E;  4F9A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...