2LUQA

Solution structure of double-stranded rna binding domain of s.cerevisiae rnase iii (rnt1p)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease 3
publication title Intrinsic Dynamics of an Extended Hydrophobic Core in the S. cerevisiae RNase III dsRBD Contributes to Recognition of Specific RNA Binding Sites.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2luqA00
4JI3E 4B3TE 2UXCE 2B7VA 4LFBE 3J7Yp 2KHXA 4DV2E 5BR8E 4DKKA 2L2NA 4GKKE 1RQ0A 1HNXE 5LMUE 2LBSB 1J5EE 2JVAA 4DR1E 2NUEA 4DV7E 4DR2E 1N32E 4WYQB 2JY9A 4LF7E 3T1YE 4JI6E 1WHNA 1QU6A 2RTXA 4OOGC 1HNZE 2LUQA 1T4LB 2L2KB 1HNWE 4AQYE 2UUBE 4DUYE 4JI2E 4DR6E 1YYWA 4WFTA 2F4VE 1T4NA 3LLHA 5CFFE 4JYAE 3ADJA 1IBKE 2L3JA 3VYXA 2MDRA 1WHQA 2NA2A 1UILA 1EKZA 1I94E 4LF8E 2N3HA 3ADIA 4M2ZA 1IBME 2RSMA 3OTOE 4LF4E 2RS7A 2L33A 4LFAE 1HR0E 2LJHA 1UHZA 1N34E 3C4BA 4LF5E 4LFCE 3VYYA 4DV5E 4X8WA 3ADLA 1T4OA 4KHPE 4B3ME 2DB2A 2UUCE 2NUGA 2N3GA 2HHHE 1XMQE 1X47A 2DMYA 2RS6A 1J26A 4X66E 2CPNA 2UXBE 1YYOA 3C4TA 1STUA 4OX9E 2E5LE 1YZ9A 4X65E 2LTSA 4LF9E 3ADGA 2LRSA 1X49A 4DV6E 1N33E 1RC7A 4DR3E 1N36E 4NXME 1X48A 4JI0E 4YY3E 2B7TA 4YHHE 4DR7E 1GQEA 2VQEE 4DV4E 2UXDE 1XNRE 4B3RE 4JI8E 2UUAE 1PKPA 4X64E 5IWAE 2B3TB 2LUPB 1IBLE 4JV5E 4GKJE 1FKAE 4JI1E 4DV1E 4NXNE 4M30A 4DUZE 4JI4E 1YYKA 1FJGE 1ZBTA 2DIXA 2LTRA 4X62E 2ZM6E 2L2MA 2L3CA 4B3SE 1O0WA 2EZ6A 1DI2A 4DR5E 4DV3E 4K0KE 3P1XA 4DV0E 3HTXA 1XNQE 1XMOE 4DR4E 2YT4A 4LF6E 2VQFE 4JI5E 2NUFA 2UU9E 4JI7E 5LMNE 3T1HE 2IHR1
chains in the Genus database with same CATH superfamily
2B7VA 2V83A 2JYAA 1F2IG 4J8ZA 1X6EA 4DKKA 4FK5C 2EMLA 1RQ0A 1HNXE 1KYQA 3MHHC 3DJWA 3K6QA 2EN6A 2EQ1A 3EPKA 2I13A 1N32E 4R2CA 4LF7E 2DLQA 5A2QC 2EL6A 1QU6A 1PDAA 3IWCA 1T4LB 5KL7A 2ELZA 4AQYE 2EM0A 1N3GA 1L4SA 4JI2E 4DR6E 4WSGA 1IBKE 4TUIA 3IWBA 1WHQA 2MC6A 1UILA 5LL6R 4BHCA 2EL4A 4HTGA 1X6FA 5KL5A 1LLMC 1Z1BA 2WBUA 4P7DA 4LF4E 2EN4A 2BBGA 2EOEA 4HEIA 3EPJA 1G2FC 3J80C 4R8OA 1EH7A 3H09A 2JR1A 4LFCE 3KZZA 2EOXA 3ADLA 4BCAA 4BBYA 5IT9C 2L8TA 2JOBA 2EM7A 2CTDA 2EMAA 2RS6A 4X66E 4O43A 4I8OA 1X3CA 1STUA 4R2EA 1A1GA 4X65E 1NCSA 5A6BA 3ZOQB 4WXDA 2YTFA 4DV6E 1N33E 5IV8B 2MC5A 2EMFA 4JI0E 3VK6A 2Q8UA 4P78A 2UXDE 1XNRE 3EQ1A 1SR9A 2RQLA 3IWDA 3M99B 1PKPA 5AASA 3J81C 1A1HA 1T39A 4X64E 5KL3A 5IWAE 1ZBQA 1IMUA 4JV5E 4O4KA 4JI1E 2JP9A 3HPZA 1ZU1A 4ZYGA 1TF6A 2EMWA 1TN9A 2JOXA 4B3SE 2EN3A 4NHRA 3C6MA 3HPSA 2YTJA 2EZ6A 2YTGA 5DNYA 2EOZA 3DF6A 4DR5E 4K0KE 3HTXA 4RH8A 4GZNC 1NEIA 1BBOA 2UU9E 3T1HE 5A6KA 4BC7A 4KWYA 4B3TE 2LV2A 2UXCE 3EPLA 2L2NA 2B9DA 2EL5A 5LMUE 4DR1E 2GPIA 4DV7E 4WX9A 4DR2E 4GEQB 4WYQB 3J7AG 2YU8A 2K4VA 4JI6E 1WHNA 2RTXA 1MEYC 1BBGA 2DGCA 2LUQA 3HQ1A 4L5NC 2EM9A 1ZAAC 2EM2A 3UK3C 3F6HA 1YYWA 2F4VE 4JYAE 4WXCA 2F8BA 4BS9A 2EPZA 2MKDA 5A69A 1I94E 4LF8E 2EWLA 5IXMB 2YPNA 1IBME 4Q35B 3OMLA 2L33A 4LFAE 4ZYDA 2EM4A 2YTOA 1N34E 1YSAC 2EQ0A 3C4BA 2EPXA 2EN1A 4DV5E 4X8WA 1T4OA 2M4IA 1WRJA 1JK2A 2KOUA 2EM3A 2HHHE 1XMQE 1J26A 2DMYA 3BBGA 2UXBE 3MSWA 1YYOA 2ADRA 5AC4A 2EMKA 4BC9A 2EPPA 4LF9E 2EORA 1X49A 4LU9A 2A25A 3VHTB 2EN7A 1DQ3A 2B7TA 2PRTA 1AAYA 4DR7E 2JWOA 2LVHA 1A1LA 2CSHA 2LJUA 4JI8E 2YTDA 1TF3A 2ENHA 2DMIA 1IBLE 2EMGA 4F2JC 1FKAE 2EPOA 2DRPA 4NXNE 2EM8A 1IQSA 1ZBTA 2V87A 2KONA 2WBSA 1EH8A 2WZOA 2L2MA 1O0WA 4F9BB 3JU0A 2EPUA 4F9AB 2D9HA 4O5GA 3P1XA 2EN8A 3L00A 5KL2A 1XNQE 1XMOE 4JI5E 3THOB 4TUGA 2NUFA 5T6JA 5ADZA 5LLQA 2DLKA 4N4RB 5AE2A 1WXRA 3THNA 3J7Yp 5BR8E 1EH6A 2E1MA 4GKKE 2ODRD 2LCEA 2LBSB 1J5EE 2NUEA 2EPRA 2YSPA 1A1KA 4MLQA 2JY9A 4KZSA 2NABA 2ENAA 1YUIA 1GTKA 4OOGC 4Q28A 1HNZE 1IQOA 3LMLA 4BMJA 2EOFA 4WPYA 2EM5A 3LLHA 2EPLX 5CFFE 4R2PA 2L3JA 3VYXA 1EKZA 2N8XA 3C6KA 2DSYA 4M2ZA 2ODRC 2YTIA 2EMZA 2YZTA 2L6MA 2LJHA 2EP3A 5KL4A 2V86A 1P47A 4LF5E 4MLVA 2LMZA 1BB8A 1YFHA 2FV4B 2FTXB 4R2QA 2JPAA 4RHBB 2EMYA 4KHPE 3BIDA 4IS1C 4B3ME 2V85A 2DB2A 2CT1A 2FGGA 2UUCE 2YTEA 2VE7C 2N3GA 2NUGA 2YRKA 2EQ3A 1X47A 2VRDA 4R2SA 4DMIA 4OX9E 1SFEA 1YZ9A 3AUZA 2EMBA 2EPAA 2RSIA 1G2DC 1RC7A 2LO3A 4DR3E 4NXME 1X48A 3BF2A 4YY3E 4YHHE 2WCC3 2WBTA 5KL6A 2ENCA 4DV4E 1JK1A 1PJTA 1KJKA 2EJ4A 1X5WA 2L92A 3EPHA 4LTYA 2LUPB 2EN2A 4F6MA 2YSOA 2M9AA 4ZYEA 4M9VC 2YWQA 3TQMA 4DV1E 4M30A 4DUZE 4JI4E 1FJGE 2ZM6E 2K7IA 1T38A 2YTQA 4R2RA 5TSEA 3KWRA 5A6BD 4DV3E 1PJQA 2I9IA 1PJSA 4DR4E 2YT4A 1GZ6A 2VQFE 2LE2A 5LMNE 2MDGA 1DGCA 2IHR1 2G7HA 4JI3E 2EOMA 2EOJA 2RPCA 4DV2E 2KHXA 4LFBE 2YTNA 1UN6B 1ZR9A 1UBDC 2EMCA 2JVAA 1A1JA 3T1YE 2E72A 2YTPA 2M7QA 5F3WA 2L2KB 4NZVA 1HNWE 1RMDA 2UUBE 4DUYE 2EOSA 4WSPA 1AH5A 5AC5A 4M0VA 4WFTA 1T4NA 2EPCA 3ADJA 2MDRA 4ZYHA 2ELYA 2EM6A 2NA2A 2H36X 2YRHA 2R76A 5A6JA 2N3HA 2EPNA 3ADIA 2R1FA 5FLXC 4R2AA 2RSMA 3OTOE 2RS7A 5AE1A 3FIGA 1HR0E 4F6NA 2EOOA 1UHZA 4F54A 2MKNA 4X9JA 3VYYA 2J7JA 4R03A 2EPKX 3BGHA 2BB8A 1A1IA 2LT7A 2GHFA 2V88A 2GLIA 2CPNA 2EOYA 3KZYA 4O24A 1MGTA 3C4TA 2E5LE 1WJPA 3JAMC 3AV0A 2YU5A 5AE3A 2LTSA 3ADGA 2LRSA 4L8NA 3MHSC 2VF1A 2EE8A 4IJDA 1N36E 2HGHA 2V89A 2EOHA 1GQEA 2VQEE 1YPNA 2HC5A 4B3RE 2V8QB 2UUAE 1B69A 4BHBA 1QNTA 2EOQA 4F9CB 2B3TB 1YUJA 2EOIA 4GKJE 3HXLA 2JXPA 2M1SA 2YRMA 5A6AA 2EMXA 1YYKA 2DIXA 2LTRA 3JTZA 4X62E 1X6HA 2EMHA 2L3CA 2EMIA 4R2DA 1DI2A 4DV0E 3ECRA 4LF6E 3QG5C 1A1FA 2HJJA 4JI7E 3F6GA 3RMPA 2EPMX
chains in the Genus database with same CATH topology
4JI3E 4B3TE 2UXCE 2B7VA 2V83A 4LFBE 5AE2A 2KHXA 4J8ZA 1WXRA 3J7Yp 5BR8E 4DKKA 4DV2E 2E1MA 2L2NA 2B9DA 1RQ0A 4GKKE 1HNXE 2ODRD 5LMUE 2LBSB 1J5EE 2JVAA 4DR1E 4M2ZA 3DJWA 3K6QA 2NUEA 4DV7E 4DR2E 1N32E 4GEQB 2JY9A 4WYQB 4KZSA 3T1YE 4LF7E 3J7AG 2K4VA 5A2QC 5ADZA 4JI6E 1WHNA 1QU6A 2RTXA 3IWCA 4OOGC 4Q28A 2M7QA 2LUQA 3HQ1A 4L5NC 2L2KB 5F3WA 3LMLA 4BMJA 1T4LB 1HNWE 4AQYE 2UUBE 4DUYE 4JI2E 4WSPA 4DR6E 3F6HA 4M0VA 4WPYA 4WFTA 1YYWA 2F4VE 1T4NA 3LLHA 5CFFE 4JYAE 3ADJA 1IBKE 2F8BA 4BS9A 3IWBA 4TUIA 2L3JA 2MDRA 3VYXA 1WHQA 2NA2A 2MC6A 1UILA 5LL6R 2H36X 1EKZA 1I94E 4LF8E 2N3HA 3ADIA 2EWLA 5FLXC 2DSYA 4P7DA 2RSMA 2ODRC 3OMLA 2RS7A 2L33A 5AE1A 3OTOE 3FIGA 2YZTA 1HR0E 2L6MA 2LJHA 4LFAE 2V86A 4R8OA 3J80C 1UHZA 3H09A 4F54A 2JR1A 3C4BA 1N34E 4LF5E 3VYYA 4LFCE 2LMZA 4R03A 2FV4B 4DV5E 2FTXB 4X8WA 3ADLA 1T4OA 2M4IA 4KHPE 4B3ME 4BCAA 2V85A 2KOUA 4BBYA 5IT9C 2L8TA 2DB2A 2FGGA 2UUCE 2NUGA 2VE7C 2JOBA 2N3GA 2HHHE 1XMQE 1X47A 2DMYA 2RS6A 1J26A 4DMIA 2V88A 4X66E 1HNZE 2CPNA 2UXBE 3MSWA 4I8OA 1YYOA 3C4TA 1STUA 4OX9E 4BC9A 2E5LE 1YZ9A 3JAMC 3AUZA 4X65E 3AV0A 5AE3A 1IBME 2LTSA 4LF9E 3ADGA 3ZOQB 2LRSA 4L8NA 1X49A 2VF1A 4DV6E 1N33E 1RC7A 4DR3E 1N36E 2MC5A 4LU9A 2V89A 4NXME 1X48A 4JI0E 2G7HA 4YY3E 1DQ3A 2B7TA 3VK6A 4YHHE 4DR7E 2JWOA 1GQEA 2VQEE 4P78A 4DV4E 2UXDE 1XNRE 4B3RE 1SR9A 2V8QB 3IWDA 4JI8E 2UUAE 1PKPA 5AASA 2L92A 3J81C 4X64E 4LTYA 4F9CB 1ZBQA 5IWAE 2B3TB 2LUPB 1IBLE 4JV5E 4GKJE 1FKAE 4JI1E 3HXLA 3RMPA 2M1SA 4DV1E 3HPZA 4NXNE 4M30A 4DUZE 4JI4E 1YYKA 1FJGE 1ZBTA 2DIXA 2V87A 2KONA 2LTRA 3JTZA 4X62E 2WZOA 2ZM6E 2L2MA 2JOXA 2L3CA 4B3SE 1O0WA 3HPSA 4F9BB 3JU0A 4LF4E 2EZ6A 4F9AB 1DI2A 5DNYA 3KWRA 3DF6A 4DV3E 4DR5E 4K0KE 3P1XA 4DV0E 3HTXA 1XNQE 1XMOE 4DR4E 2YT4A 4LF6E 1GZ6A 2VQFE 4JI5E 4TUGA 2LE2A 2NUFA 2UU9E 4JI7E 5LMNE 5T6JA 3T1HE 3F6GA 2IHR1 4BC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 E;  4B3T E;  2UXC E;  2B7V A;  4LFB E;  3J7Y p;  2KHX A;  4DV2 E;  5BR8 E;  4DKK A;  2L2N A;  4GKK E;  1RQ0 A;  1HNX E;  5LMU E;  2LBS B;  1J5E E;  2JVA A;  4DR1 E;  2NUE A;  4DV7 E;  4DR2 E;  1N32 E;  4WYQ B;  2JY9 A;  4LF7 E;  3T1Y E;  4JI6 E;  1WHN A;  1QU6 A;  2RTX A;  4OOG C;  1HNZ E;  2LUQ A;  1T4L B;  2L2K B;  1HNW E;  4AQY E;  2UUB E;  4DUY E;  4JI2 E;  4DR6 E;  1YYW A;  4WFT A;  2F4V E;  1T4N A;  3LLH A;  5CFF E;  4JYA E;  3ADJ A;  1IBK E;  2L3J A;  3VYX A;  2MDR A;  1WHQ A;  2NA2 A;  1UIL A;  1EKZ A;  1I94 E;  4LF8 E;  2N3H A;  3ADI A;  4M2Z A;  1IBM E;  2RSM A;  3OTO E;  4LF4 E;  2RS7 A;  2L33 A;  4LFA E;  1HR0 E;  2LJH A;  1UHZ A;  1N34 E;  3C4B A;  4LF5 E;  4LFC E;  3VYY A;  4DV5 E;  4X8W A;  3ADL A;  1T4O A;  4KHP E;  4B3M E;  2DB2 A;  2UUC E;  2NUG A;  2N3G A;  2HHH E;  1XMQ E;  1X47 A;  2DMY A;  2RS6 A;  1J26 A;  4X66 E;  2CPN A;  2UXB E;  1YYO A;  3C4T A;  1STU A;  4OX9 E;  2E5L E;  1YZ9 A;  4X65 E;  2LTS A;  4LF9 E;  3ADG A;  2LRS A;  1X49 A;  4DV6 E;  1N33 E;  1RC7 A;  4DR3 E;  1N36 E;  4NXM E;  1X48 A;  4JI0 E;  4YY3 E;  2B7T A;  4YHH E;  4DR7 E;  1GQE A;  2VQE E;  4DV4 E;  2UXD E;  1XNR E;  4B3R E;  4JI8 E;  2UUA E;  1PKP A;  4X64 E;  5IWA E;  2B3T B;  2LUP B;  1IBL E;  4JV5 E;  4GKJ E;  1FKA E;  4JI1 E;  4DV1 E;  4NXN E;  4M30 A;  4DUZ E;  4JI4 E;  1YYK A;  1FJG E;  1ZBT A;  2DIX A;  2LTR A;  4X62 E;  2ZM6 E;  2L2M A;  2L3C A;  4B3S E;  1O0W A;  2EZ6 A;  1DI2 A;  4DR5 E;  4DV3 E;  4K0K E;  3P1X A;  4DV0 E;  3HTX A;  1XNQ E;  1XMO E;  4DR4 E;  2YT4 A;  4LF6 E;  2VQF E;  4JI5 E;  2NUF A;  2UU9 E;  4JI7 E;  5LMN E;  3T1H E;  2IHR 1; 
#chains in the Genus database with same CATH topology
 2B7V A;  2V83 A;  2JYA A;  1F2I G;  4J8Z A;  1X6E A;  4DKK A;  4FK5 C;  2EML A;  1RQ0 A;  1HNX E;  1KYQ A;  3MHH C;  3DJW A;  3K6Q A;  2EN6 A;  2EQ1 A;  3EPK A;  2I13 A;  1N32 E;  4R2C A;  4LF7 E;  2DLQ A;  5A2Q C;  2EL6 A;  1QU6 A;  1PDA A;  3IWC A;  1T4L B;  5KL7 A;  2ELZ A;  4AQY E;  2EM0 A;  1N3G A;  1L4S A;  4JI2 E;  4DR6 E;  4WSG A;  1IBK E;  4TUI A;  3IWB A;  1WHQ A;  2MC6 A;  1UIL A;  5LL6 R;  4BHC A;  2EL4 A;  4HTG A;  1X6F A;  5KL5 A;  1LLM C;  1Z1B A;  2WBU A;  4P7D A;  4LF4 E;  2EN4 A;  2BBG A;  2EOE A;  4HEI A;  3EPJ A;  1G2F C;  3J80 C;  4R8O A;  1EH7 A;  3H09 A;  2JR1 A;  4LFC E;  3KZZ A;  2EOX A;  3ADL A;  4BCA A;  4BBY A;  5IT9 C;  2L8T A;  2JOB A;  2EM7 A;  2CTD A;  2EMA A;  2RS6 A;  4X66 E;  4O43 A;  4I8O A;  1X3C A;  1STU A;  4R2E A;  1A1G A;  4X65 E;  1NCS A;  5A6B A;  3ZOQ B;  4WXD A;  2YTF A;  4DV6 E;  1N33 E;  5IV8 B;  2MC5 A;  2EMF A;  4JI0 E;  3VK6 A;  2Q8U A;  4P78 A;  2UXD E;  1XNR E;  3EQ1 A;  1SR9 A;  2RQL A;  3IWD A;  3M99 B;  1PKP A;  5AAS A;  3J81 C;  1A1H A;  1T39 A;  4X64 E;  5KL3 A;  5IWA E;  1ZBQ A;  1IMU A;  4JV5 E;  4O4K A;  4JI1 E;  2JP9 A;  3HPZ A;  1ZU1 A;  4ZYG A;  1TF6 A;  2EMW A;  1TN9 A;  2JOX A;  4B3S E;  2EN3 A;  4NHR A;  3C6M A;  3HPS A;  2YTJ A;  2EZ6 A;  2YTG A;  5DNY A;  2EOZ A;  3DF6 A;  4DR5 E;  4K0K E;  3HTX A;  4RH8 A;  4GZN C;  1NEI A;  1BBO A;  2UU9 E;  3T1H E;  5A6K A;  4BC7 A;  4KWY A;  4B3T E;  2LV2 A;  2UXC E;  3EPL A;  2L2N A;  2B9D A;  2EL5 A;  5LMU E;  4DR1 E;  2GPI A;  4DV7 E;  4WX9 A;  4DR2 E;  4GEQ B;  4WYQ B;  3J7A G;  2YU8 A;  2K4V A;  4JI6 E;  1WHN A;  2RTX A;  1MEY C;  1BBG A;  2DGC A;  2LUQ A;  3HQ1 A;  4L5N C;  2EM9 A;  1ZAA C;  2EM2 A;  3UK3 C;  3F6H A;  1YYW A;  2F4V E;  4JYA E;  4WXC A;  2F8B A;  4BS9 A;  2EPZ A;  2MKD A;  5A69 A;  1I94 E;  4LF8 E;  2EWL A;  5IXM B;  2YPN A;  1IBM E;  4Q35 B;  3OML A;  2L33 A;  4LFA E;  4ZYD A;  2EM4 A;  2YTO A;  1N34 E;  1YSA C;  2EQ0 A;  3C4B A;  2EPX A;  2EN1 A;  4DV5 E;  4X8W A;  1T4O A;  2M4I A;  1WRJ A;  1JK2 A;  2KOU A;  2EM3 A;  2HHH E;  1XMQ E;  1J26 A;  2DMY A;  3BBG A;  2UXB E;  3MSW A;  1YYO A;  2ADR A;  5AC4 A;  2EMK A;  4BC9 A;  2EPP A;  4LF9 E;  2EOR A;  1X49 A;  4LU9 A;  2A25 A;  3VHT B;  2EN7 A;  1DQ3 A;  2B7T A;  2PRT A;  1AAY A;  4DR7 E;  2JWO A;  2LVH A;  1A1L A;  2CSH A;  2LJU A;  4JI8 E;  2YTD A;  1TF3 A;  2ENH A;  2DMI A;  1IBL E;  2EMG A;  4F2J C;  1FKA E;  2EPO A;  2DRP A;  4NXN E;  2EM8 A;  1IQS A;  1ZBT A;  2V87 A;  2KON A;  2WBS A;  1EH8 A;  2WZO A;  2L2M A;  1O0W A;  4F9B B;  3JU0 A;  2EPU A;  4F9A B;  2D9H A;  4O5G A;  3P1X A;  2EN8 A;  3L00 A;  5KL2 A;  1XNQ E;  1XMO E;  4JI5 E;  3THO B;  4TUG A;  2NUF A;  5T6J A;  5ADZ A;  5LLQ A;  2DLK A;  4N4R B;  5AE2 A;  1WXR A;  3THN A;  3J7Y p;  5BR8 E;  1EH6 A;  2E1M A;  4GKK E;  2ODR D;  2LCE A;  2LBS B;  1J5E E;  2NUE A;  2EPR A;  2YSP A;  1A1K A;  4MLQ A;  2JY9 A;  4KZS A;  2NAB A;  2ENA A;  1YUI A;  1GTK A;  4OOG C;  4Q28 A;  1HNZ E;  1IQO A;  3LML A;  4BMJ A;  2EOF A;  4WPY A;  2EM5 A;  3LLH A;  2EPL X;  5CFF E;  4R2P A;  2L3J A;  3VYX A;  1EKZ A;  2N8X A;  3C6K A;  2DSY A;  4M2Z A;  2ODR C;  2YTI A;  2EMZ A;  2YZT A;  2L6M A;  2LJH A;  2EP3 A;  5KL4 A;  2V86 A;  1P47 A;  4LF5 E;  4MLV A;  2LMZ A;  1BB8 A;  1YFH A;  2FV4 B;  2FTX B;  4R2Q A;  2JPA A;  4RHB B;  2EMY A;  4KHP E;  3BID A;  4IS1 C;  4B3M E;  2V85 A;  2DB2 A;  2CT1 A;  2FGG A;  2UUC E;  2YTE A;  2VE7 C;  2N3G A;  2NUG A;  2YRK A;  2EQ3 A;  1X47 A;  2VRD A;  4R2S A;  4DMI A;  4OX9 E;  1SFE A;  1YZ9 A;  3AUZ A;  2EMB A;  2EPA A;  2RSI A;  1G2D C;  1RC7 A;  2LO3 A;  4DR3 E;  4NXM E;  1X48 A;  3BF2 A;  4YY3 E;  4YHH E;  2WCC 3;  2WBT A;  5KL6 A;  2ENC A;  4DV4 E;  1JK1 A;  1PJT A;  1KJK A;  2EJ4 A;  1X5W A;  2L92 A;  3EPH A;  4LTY A;  2LUP B;  2EN2 A;  4F6M A;  2YSO A;  2M9A A;  4ZYE A;  4M9V C;  2YWQ A;  3TQM A;  4DV1 E;  4M30 A;  4DUZ E;  4JI4 E;  1FJG E;  2ZM6 E;  2K7I A;  1T38 A;  2YTQ A;  4R2R A;  5TSE A;  3KWR A;  5A6B D;  4DV3 E;  1PJQ A;  2I9I A;  1PJS A;  4DR4 E;  2YT4 A;  1GZ6 A;  2VQF E;  2LE2 A;  5LMN E;  2MDG A;  1DGC A;  2IHR 1;  2G7H A;  4JI3 E;  2EOM A;  2EOJ A;  2RPC A;  4DV2 E;  2KHX A;  4LFB E;  2YTN A;  1UN6 B;  1ZR9 A;  1UBD C;  2EMC A;  2JVA A;  1A1J A;  3T1Y E;  2E72 A;  2YTP A;  2M7Q A;  5F3W A;  2L2K B;  4NZV A;  1HNW E;  1RMD A;  2UUB E;  4DUY E;  2EOS A;  4WSP A;  1AH5 A;  5AC5 A;  4M0V A;  4WFT A;  1T4N A;  2EPC A;  3ADJ A;  2MDR A;  4ZYH A;  2ELY A;  2EM6 A;  2NA2 A;  2H36 X;  2YRH A;  2R76 A;  5A6J A;  2N3H A;  2EPN A;  3ADI A;  2R1F A;  5FLX C;  4R2A A;  2RSM A;  3OTO E;  2RS7 A;  5AE1 A;  3FIG A;  1HR0 E;  4F6N A;  2EOO A;  1UHZ A;  4F54 A;  2MKN A;  4X9J A;  3VYY A;  2J7J A;  4R03 A;  2EPK X;  3BGH A;  2BB8 A;  1A1I A;  2LT7 A;  2GHF A;  2V88 A;  2GLI A;  2CPN A;  2EOY A;  3KZY A;  4O24 A;  1MGT A;  3C4T A;  2E5L E;  1WJP A;  3JAM C;  3AV0 A;  2YU5 A;  5AE3 A;  2LTS A;  3ADG A;  2LRS A;  4L8N A;  3MHS C;  2VF1 A;  2EE8 A;  4IJD A;  1N36 E;  2HGH A;  2V89 A;  2EOH A;  1GQE A;  2VQE E;  1YPN A;  2HC5 A;  4B3R E;  2V8Q B;  2UUA E;  1B69 A;  4BHB A;  1QNT A;  2EOQ A;  4F9C B;  2B3T B;  1YUJ A;  2EOI A;  4GKJ E;  3HXL A;  2JXP A;  2M1S A;  2YRM A;  5A6A A;  2EMX A;  1YYK A;  2DIX A;  2LTR A;  3JTZ A;  4X62 E;  1X6H A;  2EMH A;  2L3C A;  2EMI A;  4R2D A;  1DI2 A;  4DV0 E;  3ECR A;  4LF6 E;  3QG5 C;  1A1F A;  2HJJ A;  4JI7 E;  3F6G A;  3RMP A;  2EPM X; 
#chains in the Genus database with same CATH homology
 4JI3 E;  4B3T E;  2UXC E;  2B7V A;  2V83 A;  4LFB E;  5AE2 A;  2KHX A;  4J8Z A;  1WXR A;  3J7Y p;  5BR8 E;  4DKK A;  4DV2 E;  2E1M A;  2L2N A;  2B9D A;  1RQ0 A;  4GKK E;  1HNX E;  2ODR D;  5LMU E;  2LBS B;  1J5E E;  2JVA A;  4DR1 E;  4M2Z A;  3DJW A;  3K6Q A;  2NUE A;  4DV7 E;  4DR2 E;  1N32 E;  4GEQ B;  2JY9 A;  4WYQ B;  4KZS A;  3T1Y E;  4LF7 E;  3J7A G;  2K4V A;  5A2Q C;  5ADZ A;  4JI6 E;  1WHN A;  1QU6 A;  2RTX A;  3IWC A;  4OOG C;  4Q28 A;  2M7Q A;  2LUQ A;  3HQ1 A;  4L5N C;  2L2K B;  5F3W A;  3LML A;  4BMJ A;  1T4L B;  1HNW E;  4AQY E;  2UUB E;  4DUY E;  4JI2 E;  4WSP A;  4DR6 E;  3F6H A;  4M0V A;  4WPY A;  4WFT A;  1YYW A;  2F4V E;  1T4N A;  3LLH A;  5CFF E;  4JYA E;  3ADJ A;  1IBK E;  2F8B A;  4BS9 A;  3IWB A;  4TUI A;  2L3J A;  2MDR A;  3VYX A;  1WHQ A;  2NA2 A;  2MC6 A;  1UIL A;  5LL6 R;  2H36 X;  1EKZ A;  1I94 E;  4LF8 E;  2N3H A;  3ADI A;  2EWL A;  5FLX C;  2DSY A;  4P7D A;  2RSM A;  2ODR C;  3OML A;  2RS7 A;  2L33 A;  5AE1 A;  3OTO E;  3FIG A;  2YZT A;  1HR0 E;  2L6M A;  2LJH A;  4LFA E;  2V86 A;  4R8O A;  3J80 C;  1UHZ A;  3H09 A;  4F54 A;  2JR1 A;  3C4B A;  1N34 E;  4LF5 E;  3VYY A;  4LFC E;  2LMZ A;  4R03 A;  2FV4 B;  4DV5 E;  2FTX B;  4X8W A;  3ADL A;  1T4O A;  2M4I A;  4KHP E;  4B3M E;  4BCA A;  2V85 A;  2KOU A;  4BBY A;  5IT9 C;  2L8T A;  2DB2 A;  2FGG A;  2UUC E;  2NUG A;  2VE7 C;  2JOB A;  2N3G A;  2HHH E;  1XMQ E;  1X47 A;  2DMY A;  2RS6 A;  1J26 A;  4DMI A;  2V88 A;  4X66 E;  1HNZ E;  2CPN A;  2UXB E;  3MSW A;  4I8O A;  1YYO A;  3C4T A;  1STU A;  4OX9 E;  4BC9 A;  2E5L E;  1YZ9 A;  3JAM C;  3AUZ A;  4X65 E;  3AV0 A;  5AE3 A;  1IBM E;  2LTS A;  4LF9 E;  3ADG A;  3ZOQ B;  2LRS A;  4L8N A;  1X49 A;  2VF1 A;  4DV6 E;  1N33 E;  1RC7 A;  4DR3 E;  1N36 E;  2MC5 A;  4LU9 A;  2V89 A;  4NXM E;  1X48 A;  4JI0 E;  2G7H A;  4YY3 E;  1DQ3 A;  2B7T A;  3VK6 A;  4YHH E;  4DR7 E;  2JWO A;  1GQE A;  2VQE E;  4P78 A;  4DV4 E;  2UXD E;  1XNR E;  4B3R E;  1SR9 A;  2V8Q B;  3IWD A;  4JI8 E;  2UUA E;  1PKP A;  5AAS A;  2L92 A;  3J81 C;  4X64 E;  4LTY A;  4F9C B;  1ZBQ A;  5IWA E;  2B3T B;  2LUP B;  1IBL E;  4JV5 E;  4GKJ E;  1FKA E;  4JI1 E;  3HXL A;  3RMP A;  2M1S A;  4DV1 E;  3HPZ A;  4NXN E;  4M30 A;  4DUZ E;  4JI4 E;  1YYK A;  1FJG E;  1ZBT A;  2DIX A;  2V87 A;  2KON A;  2LTR A;  3JTZ A;  4X62 E;  2WZO A;  2ZM6 E;  2L2M A;  2JOX A;  2L3C A;  4B3S E;  1O0W A;  3HPS A;  4F9B B;  3JU0 A;  4LF4 E;  2EZ6 A;  4F9A B;  1DI2 A;  5DNY A;  3KWR A;  3DF6 A;  4DV3 E;  4DR5 E;  4K0K E;  3P1X A;  4DV0 E;  3HTX A;  1XNQ E;  1XMO E;  4DR4 E;  2YT4 A;  4LF6 E;  1GZ6 A;  2VQF E;  4JI5 E;  4TUG A;  2LE2 A;  2NUF A;  2UU9 E;  4JI7 E;  5LMN E;  5T6J A;  3T1H E;  3F6G A;  2IHR 1;  4BC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...