2LUQA

Solution structure of double-stranded rna binding domain of s.cerevisiae rnase iii (rnt1p)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Ribonuclease 3
publication title Intrinsic Dynamics of an Extended Hydrophobic Core in the S. cerevisiae RNase III dsRBD Contributes to Recognition of Specific RNA Binding Sites.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2luqA00
2RS7A 1XNRE 1FJGE 1J26A 4JI4E 1HNWE 1I94E 3VYXA 1YZ9A 4LF7E 4KHPE 1DI2A 2RSMA 4DV0E 4DV3E 3ADGA 4DR6E 2UU9E 2UUBE 1STUA 1T4LB 4AQYE 2KHXA 2L2KB 2F4VE 4YY3E 1PKPA 4X64E 5CFFE 1T4NA 1EKZA 4JI1E 4GKJE 3ADIA 4B3SE 4LF6E 3C4TA 4LF8E 4X65E 1IBME 2L2MA 2LRSA 1N36E 4WYQB 4LFBE 4JV5E 4DV2E 3ADLA 2VQEE 4M2ZA 4LF4E 2NUEA 1WHQA 2N3HA 1FKAE 4DR4E 2DB2A 1N34E 4DV4E 4JI5E 2UXBE 4JI8E 3OTOE 4JI7E 2DMYA 5LMUE 4NXNE 2IHR1 4X66E 1XMOE 1UHZA 2L3JA 4DUYE 3T1HE 4DR7E 2LTRA 4OX9E 2DIXA 1N32E 1UILA 2LBSB 4DR3E 3P1XA 1YYWA 4B3RE 4JYAE 3LLHA 1QU6A 1X49A 2NA2A 2RS6A 4YHHE 1J5EE 4WFTA 1WHNA 1YYOA 2LUPB 4X62E 4NXME 1ZBTA 2B7VA 4DV5E 1N33E 2MDRA 2UXCE 1O0WA 3T1YE 4DV7E 1GQEA 4LF5E 1HR0E 4DR5E 4B3TE 4M30A 2YT4A 2N3GA 2CPNA 2JVAA 4DR2E 4LFAE 2LJHA 1RQ0A 4K0KE 1T4OA 4DV6E 5LMNE 1X48A 4DV1E 1HNZE 5BR8E 1YYKA 2LUQA 2UXDE 2NUGA 4LF9E 2JY9A 5IWAE 1RC7A 2UUAE 2EZ6A 1XNQE 2HHHE 4DUZE 4GKKE 2VQFE 2ZM6E 4LFCE 4OOGC 1HNXE 2UUCE 2B7TA 4X8WA 2NUFA 4JI3E 2LTSA 3VYYA 1IBLE 1IBKE 2B3TB 2L33A 4JI6E 4DR1E 1XMQE 4JI0E 4JI2E 2L3CA 3HTXA 2L2NA 2RTXA 1X47A 2E5LE 3C4BA 4DKKA 3ADJA 3J7Yp 4B3ME
chains in the Genus database with same CATH superfamily
3ECRA 4JI4E 2GHFA 1JK1A 4GEQB 3VYXA 2YTGA 4LF7E 4DV0E 4L5NC 2UU9E 2JYAA 2FV4B 4DMIA 2F4VE 3THNA 4YY3E 2EOEA 2R76A 2WBUA 1T4NA 2ENHA 5T6JA 2EWLA 2L2MA 3BGHA 2EMLA 2YTPA 1TF3A 3EQ1A 4BCAA 2EMIA 3TQMA 4F9BB 2ELYA 2N3HA 2EOSA 3BF2A 2JXPA 4O24A 1N34E 2UXBE 2DMYA 2D9HA 2YTOA 2IHR1 2EOOA 1XMOE 4GZNC 2EPRA 1MEYC 4DUYE 3T1HE 4DR7E 1ZAAC 3K6QA 2LTRA 2JWOA 5AE2A 1N32E 1YYWA 4JYAE 4TUIA 3LLHA 2RS6A 2YZTA 3EPJA 1ZR9A 5A6BA 2EL4A 2YPNA 4LTYA 2EMKA 2K7IA 1O0WA 3T1YE 2EN3A 4R2DA 1GQEA 1F2IG 3FIGA 2B9DA 3VHTB 4B3TE 4DR2E 2YSOA 2ELZA 2M9AA 3JTZA 2RSIA 2LJHA 2EPZA 1A1HA 4P7DA 1T38A 2EORA 2EMZA 1HNZE 2LUQA 3H09A 3QG5C 2UUAE 2EZ6A 5KL2A 1PJQA 2VRDA 1KJKA 2EOYA 2UUCE 2EOIA 2B7TA 4JI3E 1QNTA 3VYYA 2B3TB 4JI6E 2EM7A 1YSAC 4JI2E 4TUGA 2JOXA 5ADZA 1X6FA 2CSHA 2V88A 2RTXA 2E5LE 1X6EA 4DKKA 2LCEA 1XNRE 3HPZA 2V85A 3DJWA 1UBDC 1J26A 1GZ6A 2YTQA 2J7JA 1I94E 1YPNA 4NHRA 4KHPE 2ODRC 2EM0A 5A6KA 1A1FA 2UUBE 2KHXA 4BBYA 3KZYA 2MKNA 2EPUA 1G2FC 3UK3C 5CFFE 2ADRA 2LO3A 3ADIA 1X6HA 2V8QB 4LF8E 3AV0A 2LT7A 4RH8A 4X65E 1N36E 3F6HA 2I13A 1JK2A 3HXLA 4DV2E 2VQEE 4F9AB 2FTXB 4ZYHA 3C6MA 4DR4E 2RPCA 3KZZA 2EN7A 4BC9A 5LMUE 4NXNE 5A69A 2EN1A 2LMZA 1UHZA 2EP3A 2YU8A 4BMJA 4BHCA 2DMIA 3M99B 2EN2A 2EPNA 1NEIA 3IWCA 5IXMB 2YU5A 2EMFA 5AC4A 5KL6A 4R2QA 2VF1A 1A1JA 1ZBTA 4Q28A 1PJTA 2YRHA 1Z1BA 2EMCA 2JPAA 4ZYEA 2LJUA 2CPNA 2L8TA 5KL4A 2MDGA 4LFAE 4BC7A 1YUIA 4DV6E 5LMNE 5LL6R 2F8BA 4DV1E 2NABA 2EMGA 3AUZA 4LU9A 2NUGA 2JOBA 4BHBA 2K4VA 4BS9A 5AASA 2YRMA 2VQFE 5AE1A 4WXCA 4OOGC 4KZSA 1IBKE 2L33A 4WSPA 2FGGA 4DR1E 1DQ3A 5LLQA 2EPKX 2DRPA 1YUJA 2YTNA 2GLIA 3ADJA 1IQSA 2EL6A 2VE7C 1A1GA 2DLQA 4O5GA 2EPCA 4HTGA 4N4RB 4R2RA 1HNWE 1G2DC 2CTDA 1A1KA 2EPXA 1YZ9A 2YSPA 5A6JA 3OMLA 4DR6E 2EOFA 1STUA 4AQYE 5AC5A 2EOMA 4ZYGA 2L2KB 1A1IA 5TSEA 5A2QC 3HQ1A 2EE8A 1PKPA 2LV2A 4X64E 2GPIA 4WX9A 4JI1E 3HPSA 3C4TA 1IBME 2LRSA 1RMDA 2EOZA 2EM4A 4M0VA 4LFBE 3ADLA 4I8OA 1T39A 4RHBB 4R2CA 4M2ZA 1WHQA 1GTKA 3BIDA 4R2AA 4X9JA 2LE2A 2LVHA 4JI8E 2EOHA 4NZVA 4JI7E 1ZBQA 2L3JA 1IMUA 3EPLA 4IJDA 2ENAA 4OX9E 2DIXA 1UILA 2LBSB 2EJ4A 1PDAA 3P1XA 4B3RE 1X49A 2NA2A 2JP9A 3THOB 2M4IA 1J5EE 4WFTA 4X62E 2HGHA 3KWRA 2WBTA 4DV5E 1N33E 2MDRA 1AH5A 2EPOA 2V89A 4R8OA 3RMPA 1IQOA 5AE3A 4LF5E 2EQ3A 2YT4A 2N3GA 3BBGA 2YRKA 3IWDA 3MSWA 2EMAA 2EMXA 5KL5A 1RQ0A 5KL7A 4K0KE 1MGTA 2RQLA 2EN4A 4J8ZA 2M1SA 2V87A 4O4KA 5BR8E 1YYKA 4FK5C 2UXDE 4R03A 2JY9A 5IWAE 3EPKA 1RC7A 3C6KA 2HHHE 2BB8A 1XNQE 4GKKE 2YTDA 2ZM6E 2EM3A 3MHSC 2ODRD 2WCC3 4F2JC 4F6MA 2YTJA 4WSGA 4X8WA 2NUFA 2LTSA 1IBLE 5IV8B 1EH6A 2EMBA 1XMQE 4WPYA 4JI0E 2L3CA 3HTXA 2L2NA 1X47A 2HJJA 3C4BA 2MC6A 3DF6A 4R2SA 2M7QA 4B3ME 2RS7A 2EQ0A 1N3GA 1UN6B 1FJGE 3EPHA 1LLMC 4M9VC 5F3WA 2EN8A 4MLVA 2WZOA 1DI2A 2RSMA 4KWYA 4DV3E 3F6GA 3ADGA 1SFEA 1T4LB 2EPMX 1A1LA 2EL5A 2EPLX 1WXRA 2KONA 2EQ1A 2EN6A 2V83A 1EKZA 2E1MA 4GKJE 2EPPA 2WBSA 4B3SE 4LF6E 2DSYA 2EPAA 1P47A 2E72A 2EM2A 4WYQB 3JU0A 4JV5E 2KOUA 4F6NA 4F54A 2EOJA 2I9IA 5DNYA 4LF4E 2NUEA 2EMYA 2L92A 1FKAE 4O43A 5A6BD 2H36X 4HEIA 2DB2A 1B69A 1KYQA 3LMLA 3VK6A 4DV4E 4JI5E 3J80C 3OTOE 1EH7A 4X66E 1TF6A 5A6AA 2L6MA 3JAMC 2YTEA 4R2EA 1X3CA 2JR1A 2V86A 2BBGA 4Q35B 2EM9A 4DR3E 2EM6A 1QU6A 4YHHE 4IS1C 2N8XA 2DGCA 1WHNA 1YYOA 2DLKA 2LUPB 1DGCA 4NXME 2CT1A 2B7VA 2ENCA 2UXCE 2EMHA 2HC5A 1ZU1A 2PRTA 2YTFA 4DV7E 2YWQA 1BB8A 2EMWA 2EOQA 1HR0E 4DR5E 4M30A 1WRJA 2JVAA 5FLXC 4P78A 1BBGA 2MKDA 2EM5A 4L8NA 1T4OA 2EOXA 1PJSA 5KL3A 1X48A 1EH8A 2YTIA 2A25A 2G7HA 3IWBA 4LF9E 1TN9A 2EM8A 3J7AG 1BBOA 4DUZE 4R2PA 3L00A 4LFCE 4ZYDA 2R1FA 3MHHC 5IT9C 1YFHA 1HNXE 1WJPA 1SR9A 4MLQA 1L4SA 1X5WA 1NCSA 2Q8UA 3ZOQB 2MC5A 4F9CB 3J81C 1AAYA 4WXDA 3J7Yp
chains in the Genus database with same CATH topology
2RS7A 1XNRE 3HPZA 2V85A 3DJWA 1FJGE 1J26A 1GZ6A 4JI4E 1HNWE 5F3WA 4GEQB 1I94E 1YZ9A 3VYXA 2WZOA 2ODRC 4LF7E 2RSMA 4DV0E 3OMLA 4DV3E 3F6GA 3ADGA 2E5LE 4DR6E 1DI2A 4L5NC 2UU9E 1YYWA 2UUBE 1STUA 1T4LB 4AQYE 2KHXA 2FV4B 4DMIA 4BBYA 2L2KB 2F4VE 5A2QC 3HQ1A 4YY3E 1WXRA 1PKPA 4X64E 2KONA 5CFFE 1T4NA 2V83A 1EKZA 2E1MA 5T6JA 4JI1E 3ADIA 4GKJE 2V8QB 3HPSA 4B3SE 4LF6E 3C4TA 2EWLA 2DSYA 4LF8E 3AV0A 4X65E 1IBME 2L2MA 2LRSA 1N36E 3F6HA 4M0VA 4WYQB 3JU0A 4LFBE 4BCAA 2KOUA 4JV5E 3HXLA 4DV2E 4F54A 3ADLA 4I8OA 4F9BB 2VQEE 5DNYA 4F9AB 4M2ZA 4LF4E 2NUEA 1WHQA 2L92A 2N3HA 1FKAE 2FTXB 2H36X 4DR4E 2DB2A 1N34E 3LMLA 2LE2A 3VK6A 4DV4E 4JI5E 2UXBE 4JI8E 3J80C 3OTOE 4JI7E 2DMYA 4BC9A 5LMUE 4NXNE 2IHR1 1ZBQA 4X66E 1XMOE 2LMZA 1UHZA 2L3JA 2L6MA 4BMJA 3JAMC 4DUYE 2JR1A 3T1HE 4KHPE 4DR7E 2LTRA 2V86A 2DIXA 2JWOA 1UILA 3IWCA 3K6QA 3P1XA 5AE2A 4DR3E 4TUIA 2LBSB 1N32E 4B3RE 1QU6A 1X49A 3LLHA 2NA2A 2RS6A 2YZTA 4YHHE 1J5EE 2M4IA 4WFTA 2VF1A 1WHNA 1YYOA 2LUPB 4X62E 4NXME 4LTYA 3KWRA 1ZBTA 2B7VA 4Q28A 4DV5E 1N33E 2MDRA 2UXCE 1O0WA 3T1YE 4R8OA 2V89A 1GQEA 4DV7E 3RMPA 3FIGA 5AE3A 4LF5E 1HR0E 2B9DA 4DR5E 4B3TE 4M30A 2YT4A 2N3GA 2CPNA 2JVAA 2L8TA 4DR2E 3IWDA 3MSWA 3JTZA 5FLXC 4P78A 4LFAE 4BC7A 2LJHA 4OX9E 1RQ0A 4L8NA 4K0KE 1T4OA 3J7Yp 4DV6E 5LMNE 4P7DA 5LL6R 4J8ZA 1X48A 2F8BA 4DV1E 2M1SA 2V87A 1HNZE 5BR8E 1YYKA 2LUQA 3AUZA 4LU9A 3H09A 2G7HA 2UXDE 3IWBA 4R03A 4LF9E 2JY9A 5IWAE 2JOBA 1RC7A 2NUGA 2UUAE 2EZ6A 4JYAE 1XNQE 2HHHE 2K4VA 4BS9A 5AASA 3J7AG 4DUZE 4GKKE 2VQFE 5AE1A 2ZM6E 4LFCE 2ODRD 4OOGC 5IT9C 1HNXE 2UUCE 2B7TA 4KZSA 4X8WA 2NUFA 2LTSA 3VYYA 1IBLE 4JI3E 1IBKE 2B3TB 2L33A 4JI6E 1SR9A 4WSPA 2FGGA 4DR1E 1XMQE 1DQ3A 4WPYA 3ZOQB 4JI0E 4JI2E 4TUGA 2JOXA 5ADZA 2MC5A 2L3CA 2V88A 3HTXA 2L2NA 2RTXA 1X47A 4F9CB 3C4BA 2MC6A 3DF6A 4DKKA 2M7QA 3J81C 3ADJA 2VE7C 4B3ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS7 A;  1XNR E;  1FJG E;  1J26 A;  4JI4 E;  1HNW E;  1I94 E;  3VYX A;  1YZ9 A;  4LF7 E;  4KHP E;  1DI2 A;  2RSM A;  4DV0 E;  4DV3 E;  3ADG A;  4DR6 E;  2UU9 E;  2UUB E;  1STU A;  1T4L B;  4AQY E;  2KHX A;  2L2K B;  2F4V E;  4YY3 E;  1PKP A;  4X64 E;  5CFF E;  1T4N A;  1EKZ A;  4JI1 E;  4GKJ E;  3ADI A;  4B3S E;  4LF6 E;  3C4T A;  4LF8 E;  4X65 E;  1IBM E;  2L2M A;  2LRS A;  1N36 E;  4WYQ B;  4LFB E;  4JV5 E;  4DV2 E;  3ADL A;  2VQE E;  4M2Z A;  4LF4 E;  2NUE A;  1WHQ A;  2N3H A;  1FKA E;  4DR4 E;  2DB2 A;  1N34 E;  4DV4 E;  4JI5 E;  2UXB E;  4JI8 E;  3OTO E;  4JI7 E;  2DMY A;  5LMU E;  4NXN E;  2IHR 1;  4X66 E;  1XMO E;  1UHZ A;  2L3J A;  4DUY E;  3T1H E;  4DR7 E;  2LTR A;  4OX9 E;  2DIX A;  1N32 E;  1UIL A;  2LBS B;  4DR3 E;  3P1X A;  1YYW A;  4B3R E;  4JYA E;  3LLH A;  1QU6 A;  1X49 A;  2NA2 A;  2RS6 A;  4YHH E;  1J5E E;  4WFT A;  1WHN A;  1YYO A;  2LUP B;  4X62 E;  4NXM E;  1ZBT A;  2B7V A;  4DV5 E;  1N33 E;  2MDR A;  2UXC E;  1O0W A;  3T1Y E;  4DV7 E;  1GQE A;  4LF5 E;  1HR0 E;  4DR5 E;  4B3T E;  4M30 A;  2YT4 A;  2N3G A;  2CPN A;  2JVA A;  4DR2 E;  4LFA E;  2LJH A;  1RQ0 A;  4K0K E;  1T4O A;  4DV6 E;  5LMN E;  1X48 A;  4DV1 E;  1HNZ E;  5BR8 E;  1YYK A;  2LUQ A;  2UXD E;  2NUG A;  4LF9 E;  2JY9 A;  5IWA E;  1RC7 A;  2UUA E;  2EZ6 A;  1XNQ E;  2HHH E;  4DUZ E;  4GKK E;  2VQF E;  2ZM6 E;  4LFC E;  4OOG C;  1HNX E;  2UUC E;  2B7T A;  4X8W A;  2NUF A;  4JI3 E;  2LTS A;  3VYY A;  1IBL E;  1IBK E;  2B3T B;  2L33 A;  4JI6 E;  4DR1 E;  1XMQ E;  4JI0 E;  4JI2 E;  2L3C A;  3HTX A;  2L2N A;  2RTX A;  1X47 A;  2E5L E;  3C4B A;  4DKK A;  3ADJ A;  3J7Y p;  4B3M E; 
#chains in the Genus database with same CATH topology
 3ECR A;  4JI4 E;  2GHF A;  1JK1 A;  4GEQ B;  3VYX A;  2YTG A;  4LF7 E;  4DV0 E;  4L5N C;  2UU9 E;  2JYA A;  2FV4 B;  4DMI A;  2F4V E;  3THN A;  4YY3 E;  2EOE A;  2R76 A;  2WBU A;  1T4N A;  2ENH A;  5T6J A;  2EWL A;  2L2M A;  3BGH A;  2EML A;  2YTP A;  1TF3 A;  3EQ1 A;  4BCA A;  2EMI A;  3TQM A;  4F9B B;  2ELY A;  2N3H A;  2EOS A;  3BF2 A;  2JXP A;  4O24 A;  1N34 E;  2UXB E;  2DMY A;  2D9H A;  2YTO A;  2IHR 1;  2EOO A;  1XMO E;  4GZN C;  2EPR A;  1MEY C;  4DUY E;  3T1H E;  4DR7 E;  1ZAA C;  3K6Q A;  2LTR A;  2JWO A;  5AE2 A;  1N32 E;  1YYW A;  4JYA E;  4TUI A;  3LLH A;  2RS6 A;  2YZT A;  3EPJ A;  1ZR9 A;  5A6B A;  2EL4 A;  2YPN A;  4LTY A;  2EMK A;  2K7I A;  1O0W A;  3T1Y E;  2EN3 A;  4R2D A;  1GQE A;  1F2I G;  3FIG A;  2B9D A;  3VHT B;  4B3T E;  4DR2 E;  2YSO A;  2ELZ A;  2M9A A;  3JTZ A;  2RSI A;  2LJH A;  2EPZ A;  1A1H A;  4P7D A;  1T38 A;  2EOR A;  2EMZ A;  1HNZ E;  2LUQ A;  3H09 A;  3QG5 C;  2UUA E;  2EZ6 A;  5KL2 A;  1PJQ A;  2VRD A;  1KJK A;  2EOY A;  2UUC E;  2EOI A;  2B7T A;  4JI3 E;  1QNT A;  3VYY A;  2B3T B;  4JI6 E;  2EM7 A;  1YSA C;  4JI2 E;  4TUG A;  2JOX A;  5ADZ A;  1X6F A;  2CSH A;  2V88 A;  2RTX A;  2E5L E;  1X6E A;  4DKK A;  2LCE A;  1XNR E;  3HPZ A;  2V85 A;  3DJW A;  1UBD C;  1J26 A;  1GZ6 A;  2YTQ A;  2J7J A;  1I94 E;  1YPN A;  4NHR A;  4KHP E;  2ODR C;  2EM0 A;  5A6K A;  1A1F A;  2UUB E;  2KHX A;  4BBY A;  3KZY A;  2MKN A;  2EPU A;  1G2F C;  3UK3 C;  5CFF E;  2ADR A;  2LO3 A;  3ADI A;  1X6H A;  2V8Q B;  4LF8 E;  3AV0 A;  2LT7 A;  4RH8 A;  4X65 E;  1N36 E;  3F6H A;  2I13 A;  1JK2 A;  3HXL A;  4DV2 E;  2VQE E;  4F9A B;  2FTX B;  4ZYH A;  3C6M A;  4DR4 E;  2RPC A;  3KZZ A;  2EN7 A;  4BC9 A;  5LMU E;  4NXN E;  5A69 A;  2EN1 A;  2LMZ A;  1UHZ A;  2EP3 A;  2YU8 A;  4BMJ A;  4BHC A;  2DMI A;  3M99 B;  2EN2 A;  2EPN A;  1NEI A;  3IWC A;  5IXM B;  2YU5 A;  2EMF A;  5AC4 A;  5KL6 A;  4R2Q A;  2VF1 A;  1A1J A;  1ZBT A;  4Q28 A;  1PJT A;  2YRH A;  1Z1B A;  2EMC A;  2JPA A;  4ZYE A;  2LJU A;  2CPN A;  2L8T A;  5KL4 A;  2MDG A;  4LFA E;  4BC7 A;  1YUI A;  4DV6 E;  5LMN E;  5LL6 R;  2F8B A;  4DV1 E;  2NAB A;  2EMG A;  3AUZ A;  4LU9 A;  2NUG A;  2JOB A;  4BHB A;  2K4V A;  4BS9 A;  5AAS A;  2YRM A;  2VQF E;  5AE1 A;  4WXC A;  4OOG C;  4KZS A;  1IBK E;  2L33 A;  4WSP A;  2FGG A;  4DR1 E;  1DQ3 A;  5LLQ A;  2EPK X;  2DRP A;  1YUJ A;  2YTN A;  2GLI A;  3ADJ A;  1IQS A;  2EL6 A;  2VE7 C;  1A1G A;  2DLQ A;  4O5G A;  2EPC A;  4HTG A;  4N4R B;  4R2R A;  1HNW E;  1G2D C;  2CTD A;  1A1K A;  2EPX A;  1YZ9 A;  2YSP A;  5A6J A;  3OML A;  4DR6 E;  2EOF A;  1STU A;  4AQY E;  5AC5 A;  2EOM A;  4ZYG A;  2L2K B;  1A1I A;  5TSE A;  5A2Q C;  3HQ1 A;  2EE8 A;  1PKP A;  2LV2 A;  4X64 E;  2GPI A;  4WX9 A;  4JI1 E;  3HPS A;  3C4T A;  1IBM E;  2LRS A;  1RMD A;  2EOZ A;  2EM4 A;  4M0V A;  4LFB E;  3ADL A;  4I8O A;  1T39 A;  4RHB B;  4R2C A;  4M2Z A;  1WHQ A;  1GTK A;  3BID A;  4R2A A;  4X9J A;  2LE2 A;  2LVH A;  4JI8 E;  2EOH A;  4NZV A;  4JI7 E;  1ZBQ A;  2L3J A;  1IMU A;  3EPL A;  4IJD A;  2ENA A;  4OX9 E;  2DIX A;  1UIL A;  2LBS B;  2EJ4 A;  1PDA A;  3P1X A;  4B3R E;  1X49 A;  2NA2 A;  2JP9 A;  3THO B;  2M4I A;  1J5E E;  4WFT A;  4X62 E;  2HGH A;  3KWR A;  2WBT A;  4DV5 E;  1N33 E;  2MDR A;  1AH5 A;  2EPO A;  2V89 A;  4R8O A;  3RMP A;  1IQO A;  5AE3 A;  4LF5 E;  2EQ3 A;  2YT4 A;  2N3G A;  3BBG A;  2YRK A;  3IWD A;  3MSW A;  2EMA A;  2EMX A;  5KL5 A;  1RQ0 A;  5KL7 A;  4K0K E;  1MGT A;  2RQL A;  2EN4 A;  4J8Z A;  2M1S A;  2V87 A;  4O4K A;  5BR8 E;  1YYK A;  4FK5 C;  2UXD E;  4R03 A;  2JY9 A;  5IWA E;  3EPK A;  1RC7 A;  3C6K A;  2HHH E;  2BB8 A;  1XNQ E;  4GKK E;  2YTD A;  2ZM6 E;  2EM3 A;  3MHS C;  2ODR D;  2WCC 3;  4F2J C;  4F6M A;  2YTJ A;  4WSG A;  4X8W A;  2NUF A;  2LTS A;  1IBL E;  5IV8 B;  1EH6 A;  2EMB A;  1XMQ E;  4WPY A;  4JI0 E;  2L3C A;  3HTX A;  2L2N A;  1X47 A;  2HJJ A;  3C4B A;  2MC6 A;  3DF6 A;  4R2S A;  2M7Q A;  4B3M E;  2RS7 A;  2EQ0 A;  1N3G A;  1UN6 B;  1FJG E;  3EPH A;  1LLM C;  4M9V C;  5F3W A;  2EN8 A;  4MLV A;  2WZO A;  1DI2 A;  2RSM A;  4KWY A;  4DV3 E;  3F6G A;  3ADG A;  1SFE A;  1T4L B;  2EPM X;  1A1L A;  2EL5 A;  2EPL X;  1WXR A;  2KON A;  2EQ1 A;  2EN6 A;  2V83 A;  1EKZ A;  2E1M A;  4GKJ E;  2EPP A;  2WBS A;  4B3S E;  4LF6 E;  2DSY A;  2EPA A;  1P47 A;  2E72 A;  2EM2 A;  4WYQ B;  3JU0 A;  4JV5 E;  2KOU A;  4F6N A;  4F54 A;  2EOJ A;  2I9I A;  5DNY A;  4LF4 E;  2NUE A;  2EMY A;  2L92 A;  1FKA E;  4O43 A;  5A6B D;  2H36 X;  4HEI A;  2DB2 A;  1B69 A;  1KYQ A;  3LML A;  3VK6 A;  4DV4 E;  4JI5 E;  3J80 C;  3OTO E;  1EH7 A;  4X66 E;  1TF6 A;  5A6A A;  2L6M A;  3JAM C;  2YTE A;  4R2E A;  1X3C A;  2JR1 A;  2V86 A;  2BBG A;  4Q35 B;  2EM9 A;  4DR3 E;  2EM6 A;  1QU6 A;  4YHH E;  4IS1 C;  2N8X A;  2DGC A;  1WHN A;  1YYO A;  2DLK A;  2LUP B;  1DGC A;  4NXM E;  2CT1 A;  2B7V A;  2ENC A;  2UXC E;  2EMH A;  2HC5 A;  1ZU1 A;  2PRT A;  2YTF A;  4DV7 E;  2YWQ A;  1BB8 A;  2EMW A;  2EOQ A;  1HR0 E;  4DR5 E;  4M30 A;  1WRJ A;  2JVA A;  5FLX C;  4P78 A;  1BBG A;  2MKD A;  2EM5 A;  4L8N A;  1T4O A;  2EOX A;  1PJS A;  5KL3 A;  1X48 A;  1EH8 A;  2YTI A;  2A25 A;  2G7H A;  3IWB A;  4LF9 E;  1TN9 A;  2EM8 A;  3J7A G;  1BBO A;  4DUZ E;  4R2P A;  3L00 A;  4LFC E;  4ZYD A;  2R1F A;  3MHH C;  5IT9 C;  1YFH A;  1HNX E;  1WJP A;  1SR9 A;  4MLQ A;  1L4S A;  1X5W A;  1NCS A;  2Q8U A;  3ZOQ B;  2MC5 A;  4F9C B;  3J81 C;  1AAY A;  4WXD A;  3J7Y p; 
#chains in the Genus database with same CATH homology
 2RS7 A;  1XNR E;  3HPZ A;  2V85 A;  3DJW A;  1FJG E;  1J26 A;  1GZ6 A;  4JI4 E;  1HNW E;  5F3W A;  4GEQ B;  1I94 E;  1YZ9 A;  3VYX A;  2WZO A;  2ODR C;  4LF7 E;  2RSM A;  4DV0 E;  3OML A;  4DV3 E;  3F6G A;  3ADG A;  2E5L E;  4DR6 E;  1DI2 A;  4L5N C;  2UU9 E;  1YYW A;  2UUB E;  1STU A;  1T4L B;  4AQY E;  2KHX A;  2FV4 B;  4DMI A;  4BBY A;  2L2K B;  2F4V E;  5A2Q C;  3HQ1 A;  4YY3 E;  1WXR A;  1PKP A;  4X64 E;  2KON A;  5CFF E;  1T4N A;  2V83 A;  1EKZ A;  2E1M A;  5T6J A;  4JI1 E;  3ADI A;  4GKJ E;  2V8Q B;  3HPS A;  4B3S E;  4LF6 E;  3C4T A;  2EWL A;  2DSY A;  4LF8 E;  3AV0 A;  4X65 E;  1IBM E;  2L2M A;  2LRS A;  1N36 E;  3F6H A;  4M0V A;  4WYQ B;  3JU0 A;  4LFB E;  4BCA A;  2KOU A;  4JV5 E;  3HXL A;  4DV2 E;  4F54 A;  3ADL A;  4I8O A;  4F9B B;  2VQE E;  5DNY A;  4F9A B;  4M2Z A;  4LF4 E;  2NUE A;  1WHQ A;  2L92 A;  2N3H A;  1FKA E;  2FTX B;  2H36 X;  4DR4 E;  2DB2 A;  1N34 E;  3LML A;  2LE2 A;  3VK6 A;  4DV4 E;  4JI5 E;  2UXB E;  4JI8 E;  3J80 C;  3OTO E;  4JI7 E;  2DMY A;  4BC9 A;  5LMU E;  4NXN E;  2IHR 1;  1ZBQ A;  4X66 E;  1XMO E;  2LMZ A;  1UHZ A;  2L3J A;  2L6M A;  4BMJ A;  3JAM C;  4DUY E;  2JR1 A;  3T1H E;  4KHP E;  4DR7 E;  2LTR A;  2V86 A;  2DIX A;  2JWO A;  1UIL A;  3IWC A;  3K6Q A;  3P1X A;  5AE2 A;  4DR3 E;  4TUI A;  2LBS B;  1N32 E;  4B3R E;  1QU6 A;  1X49 A;  3LLH A;  2NA2 A;  2RS6 A;  2YZT A;  4YHH E;  1J5E E;  2M4I A;  4WFT A;  2VF1 A;  1WHN A;  1YYO A;  2LUP B;  4X62 E;  4NXM E;  4LTY A;  3KWR A;  1ZBT A;  2B7V A;  4Q28 A;  4DV5 E;  1N33 E;  2MDR A;  2UXC E;  1O0W A;  3T1Y E;  4R8O A;  2V89 A;  1GQE A;  4DV7 E;  3RMP A;  3FIG A;  5AE3 A;  4LF5 E;  1HR0 E;  2B9D A;  4DR5 E;  4B3T E;  4M30 A;  2YT4 A;  2N3G A;  2CPN A;  2JVA A;  2L8T A;  4DR2 E;  3IWD A;  3MSW A;  3JTZ A;  5FLX C;  4P78 A;  4LFA E;  4BC7 A;  2LJH A;  4OX9 E;  1RQ0 A;  4L8N A;  4K0K E;  1T4O A;  3J7Y p;  4DV6 E;  5LMN E;  4P7D A;  5LL6 R;  4J8Z A;  1X48 A;  2F8B A;  4DV1 E;  2M1S A;  2V87 A;  1HNZ E;  5BR8 E;  1YYK A;  2LUQ A;  3AUZ A;  4LU9 A;  3H09 A;  2G7H A;  2UXD E;  3IWB A;  4R03 A;  4LF9 E;  2JY9 A;  5IWA E;  2JOB A;  1RC7 A;  2NUG A;  2UUA E;  2EZ6 A;  4JYA E;  1XNQ E;  2HHH E;  2K4V A;  4BS9 A;  5AAS A;  3J7A G;  4DUZ E;  4GKK E;  2VQF E;  5AE1 A;  2ZM6 E;  4LFC E;  2ODR D;  4OOG C;  5IT9 C;  1HNX E;  2UUC E;  2B7T A;  4KZS A;  4X8W A;  2NUF A;  2LTS A;  3VYY A;  1IBL E;  4JI3 E;  1IBK E;  2B3T B;  2L33 A;  4JI6 E;  1SR9 A;  4WSP A;  2FGG A;  4DR1 E;  1XMQ E;  1DQ3 A;  4WPY A;  3ZOQ B;  4JI0 E;  4JI2 E;  4TUG A;  2JOX A;  5ADZ A;  2MC5 A;  2L3C A;  2V88 A;  3HTX A;  2L2N A;  2RTX A;  1X47 A;  4F9C B;  3C4B A;  2MC6 A;  3DF6 A;  4DKK A;  2M7Q A;  3J81 C;  3ADJ A;  2VE7 C;  4B3M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...