2LUQA

Solution structure of double-stranded rna binding domain of s.cerevisiae rnase iii (rnt1p)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Intrinsic Dynamics of an Extended Hydrophobic Core in the S. cerevisiae RNase III dsRBD Contributes to Recognition of Specific RNA Binding Sites.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Ribonuclease 3
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2luqA00
5BR8E 4YY3E 4OOGC 4DR3E 1HR0E 4JI5E 2HHHE 1FKAE 4DV1E 1RQ0A 2IHR1 2LUQA 1T4NA 1ZBTA 4JI8E 3C4BA 2CPNA 1N36E 4DV6E 4LF6E 2B7VA 4DV0E 2LRSA 3ADJA 4NXNE 1DI2A 4DKKA 3VYYA 3P1XA 4DR5E 1HNWE 1YYWA 2L33A 2RSMA 4JI0E 2L3JA 4JI7E 1GQEA 2JY9A 1X48A 4DR1E 1X47A 4DR2E 4LFCE 1XNQE 3T1YE 1XNRE 2F4VE 4X62E 4JI4E 4JI6E 1PKPA 2LUPB 1YYOA 4LF7E 3HTXA 4GKJE 3ADGA 1FJGE 4LFAE 4NXME 2L2MA 5CFFE 1EKZA 2L3CA 4B3ME 1T4LB 2DIXA 4DR7E 4JV5E 1IBME 1N34E 1YZ9A 4GKKE 2UU9E 2UUBE 4DV3E 1O0WA 4LF4E 1J26A 2NA2A 4K0KE 3OTOE 2RS6A 4DR6E 4X64E 2UXDE 2RTXA 1T4OA 1IBLE 4DV7E 4JI1E 1YYKA 3J7Yp 1HNZE 4B3RE 4DV2E 1WHQA 4JYAE 2NUFA 2YT4A 4JI2E 3ADLA 1N32E 4M30A 2L2NA 3T1HE 1RC7A 2B3TB 2VQEE 1XMOE 4DUYE 2N3GA 4OX9E 1X49A 2RS7A 4DUZE 4KHPE 2NUGA 2UXCE 3ADIA 3C4TA 2UXBE 4LF9E 1I94E 2MDRA 1N33E 4B3SE 4M2ZA 2LTSA 4WFTA 1J5EE 5IWAE 4LF8E 2UUCE 4LF5E 1QU6A 2EZ6A 4YHHE 1WHNA 2DB2A 1HNXE 1STUA 3VYXA 4DR4E 4X66E 1IBKE 2KHXA 4WYQB 2E5LE 2ZM6E 1UILA 5LMUE 4DV4E 2JVAA 5LMNE 2LBSB 2LJHA 4X65E 4LFBE 4DV5E 2B7TA 2UUAE 2DMYA 2L2KB 1UHZA 2VQFE 4AQYE 4X8WA 4B3TE 2LTRA 4JI3E 2NUEA 2N3HA 1XMQE 3LLHA
chains in the Genus database with same CATH superfamily
2V89A 5KL3A 2ELZA 4O4KA 1HR0E 2IHR1 2WBSA 4P7DA 2YTIA 2EMLA 4ZYGA 3ADJA 2VF1A 4WPYA 2V83A 1YFHA 3VYYA 1Z1BA 1RMDA 2EL6A 2L33A 2RSMA 2YTPA 1BBOA 4DR1E 1X47A 1XNRE 2YTNA 4M9VC 5A6AA 3HTXA 4GKJE 2MC6A 1T4LB 5A6KA 1N34E 5KL2A 2UU9E 2UUBE 1O0WA 1J26A 4NHRA 5AE2A 4BHCA 5A6BD 2GLIA 4X64E 1IBLE 4JI1E 4DV2E 1WRJA 2EM5A 2BB8A 2WCC3 2ODRC 2BBGA 2M4IA 2EORA 2L8TA 2EP3A 4F2JC 3EPHA 3DJWA 2JWOA 2V85A 4DUYE 1JK2A 2ENAA 1X6FA 1YSAC 4BBYA 2E1MA 1F2IG 3ADIA 1PJTA 2EQ3A 4LF9E 4RH8A 4M2ZA 2EPKX 1JK1A 3FIGA 1PJQA 4LF8E 1A1IA 2EN4A 5FLXC 2EZ6A 1WHNA 3J7AG 2FGGA 2A25A 4DR4E 4DMIA 2KONA 2ELYA 2ENCA 3MHSC 4X66E 1G2FC 4MLVA 2F8BA 4DV4E 1EH8A 2LJHA 5AC5A 2EQ0A 5A6BA 2EPUA 1UBDC 3H09A 2EM2A 2L2KB 4O24A 5TSEA 2VRDA 4HEIA 4Q35B 5IT9C 2VQFE 2M9AA 2EN1A 4X8WA 4B3TE 4I8OA 2NUEA 2N3HA 3K6QA 4KWYA 1IMUA 2JY9A 2EN6A 4RHBB 1A1GA 2EMBA 5BR8E 2YTGA 2EOMA 4YY3E 4DR3E 4BMJA 4ZYHA 3QG5C 1FKAE 1X6EA 2EPNA 1X6HA 4DV1E 1T4NA 1MEYC 2I9IA 1N3GA 4JI8E 3ECRA 3JU0A 2CPNA 4L8NA 5T6JA 1N36E 2EOOA 2EN2A 2LRSA 2CTDA 2I13A 3MSWA 4KZSA 3P1XA 2HJJA 1HNWE 1YYWA 2JR1A 3KZZA 5KL4A 2EM6A 2Q8UA 4JI7E 3VK6A 2EMWA 1GQEA 4R2DA 4X9JA 4DR2E 1LLMC 2V87A 4LFCE 3BGHA 4X62E 1PKPA 3L00A 2NABA 4NXME 2JYAA 1NEIA 3DF6A 4ZYEA 2EM9A 2YSPA 2EMAA 1NCSA 2EOFA 1YZ9A 3KZYA 5DNYA 3EPLA 4DV3E 2EMFA 4LF4E 4K0KE 2LT7A 2YTQA 2EMYA 5KL7A 2B9DA 2FV4B 4DR6E 1SR9A 1T4OA 2EE8A 5A6JA 2YRHA 5F3WA 1YYKA 5KL5A 4LTYA 1HNZE 4F9AB 1WHQA 4HTGA 2LO3A 4JYAE 1A1LA 3C6MA 2YTDA 3HQ1A 4M30A 3T1HE 1RC7A 2B3TB 1XMOE 2EOJA 2EN7A 2M7QA 2N3GA 1YUJA 1PDAA 5LL6R 3IWBA 2EMXA 2RS7A 2YPNA 5AE3A 3C4TA 3KWRA 4B3SE 2EPPA 2EPLX 2LTSA 2LV2A 1J5EE 2DSYA 5A69A 4TUIA 1SFEA 3F6HA 2EM7A 2PRTA 3OMLA 1KJKA 4F6NA 1T38A 2K4VA 2WBUA 1HNXE 1STUA 3VYXA 2CSHA 1A1JA 2EL4A 2J7JA 4F6MA 2K7IA 1IBKE 1WJPA 2DMIA 2KHXA 2YTJA 1YUIA 2E5LE 4J8ZA 2MKDA 2LVHA 1GZ6A 4X65E 4GZNC 3MHHC 4MLQA 1PJSA 3BF2A 1TF3A 4LFBE 2E72A 4LU9A 1DQ3A 3JAMC 1G2DC 4BCAA 1UN6B 3HXLA 4WX9A 5IV8B 4AQYE 1QNTA 5AE1A 2LTRA 2LE2A 2EQ1A 2V86A 2V8QB 2EMKA 2EN3A 3M99B 2EN8A 2EPZA 3EQ1A 2EOHA 2EOEA 5ADZA 2LUQA 1A1FA 1ZBTA 2G7HA 3TQMA 1EH6A 2L6MA 2YZTA 2EPXA 2L3JA 1KYQA 3VHTB 4O43A 2KOUA 2YRMA 4WSGA 1AH5A 2LCEA 1XNQE 3T1YE 4JI6E 1YYOA 4LF7E 1A1KA 4N4RB 3THNA 1FJGE 4LFAE 3BBGA 1EKZA 3ZOQB 4DR7E 4JV5E 2EM4A 1IBME 4GKKE 2EM3A 1ZU1A 3F6GA 3OTOE 1GTKA 2ENHA 2RS6A 3BIDA 1BBGA 5AC4A 4WSPA 4R2SA 2RTXA 2JOXA 4GEQB 4DV7E 2EPAA 1X3CA 2EL5A 2NUFA 4JI2E 3ADLA 1N32E 2L2NA 4F9CB 1BB8A 2VQEE 3AV0A 3EPJA 2EOXA 2LMZA 2EJ4A 4OX9E 1X49A 2EOIA 4DUZE 2UXCE 2HGHA 4WXCA 1N33E 4P78A 3LMLA 4WFTA 2FTXB 4R2CA 2YSOA 4R2EA 4F9BB 1X5WA 2UUCE 2YRKA 2RPCA 1QU6A 5IXMB 4IS1C 4BC9A 2DLQA 4WYQB 4R03A 1UILA 2HC5A 4R2AA 5LMUE 1TF6A 5LMNE 4Q28A 4R2RA 4DV5E 2GPIA 4NZVA 2EMIA 2EOYA 2YU5A 2MC5A 2YTFA 2EM8A 2MKNA 1MGTA 2JOBA 2JP9A 2EPCA 2ODRD 3C6KA 4JI3E 1YPNA 5AASA 4OOGC 4JI5E 2HHHE 3UK3C 1RQ0A 1ZR9A 2H36X 3C4BA 2EMGA 4DV6E 4LF6E 2B7VA 4DV0E 4NXNE 2ADRA 2YU8A 1DI2A 4DKKA 3HPSA 4DR5E 2N8XA 1ZBQA 4JI0E 2D9HA 4R2PA 2RQLA 5A2QC 1B69A 4ZYDA 4BS9A 1X48A 2EMHA 2DLKA 4FK5C 4R8OA 4M0VA 2F4VE 2EMCA 4JI4E 2R1FA 4TUGA 2LUPB 1TN9A 3ADGA 2L2MA 2V88A 5CFFE 1A1HA 2L3CA 4B3ME 2DIXA 2DRPA 3J81C 3AUZA 2EOQA 1EH7A 2NA2A 2EOZA 2RSIA 1ZAAC 2UXDE 1L4SA 3THOB 3IWDA 3J7Yp 4F54A 4R2QA 4B3RE 2YT4A 2WZOA 4WXDA 2CT1A 1IQOA 5KL6A 2JXPA 3RMPA 4L5NC 4KHPE 2NUGA 2WBTA 2UXBE 3EPKA 2JPAA 1I94E 2MDRA 3IWCA 2MDGA 2EOSA 2LJUA 2R76A 5IWAE 1T39A 4O5GA 2GHFA 2M1SA 5LLQA 4LF5E 4BC7A 4YHHE 2YTEA 2EPRA 2DB2A 2EMZA 2EPOA 2EWLA 2YWQA 2EPMX 2EM0A 2ZM6E 1P47A 1DGCA 2YTOA 2JVAA 4BHBA 1IQSA 2LBSB 2B7TA 2UUAE 2DMYA 1UHZA 1WXRA 3JTZA 4IJDA 3HPZA 3J80C 1AAYA 2DGCA 1XMQE 2L92A 3LLHA 2VE7C
chains in the Genus database with same CATH topology
5BR8E 2V89A 4YY3E 4OOGC 4DR3E 4BMJA 1HR0E 2HHHE 4JI5E 1FKAE 3LLHA 4DV1E 1RQ0A 2IHR1 2LUQA 1T4NA 5ADZA 1ZBTA 4JI8E 2G7HA 2H36X 3C4BA 3JU0A 4P7DA 2CPNA 4L8NA 5T6JA 2L6MA 2YZTA 4DV6E 1N36E 4LF6E 2B7VA 4DV0E 2LRSA 3ADJA 4NXNE 2VF1A 4WPYA 2V83A 1DI2A 3MSWA 4KZSA 4DKKA 3VYYA 3P1XA 3HPSA 4DR5E 1HNWE 1YYWA 1ZBQA 2L33A 2RSMA 2JR1A 4JI0E 2L3JA 5A2QC 4JI7E 3VK6A 1GQEA 2KOUA 4BS9A 1X48A 4R8OA 4DR1E 1X47A 4DR2E 2V87A 4LFCE 4M0VA 3T1YE 1XNQE 1XNRE 4X62E 2F4VE 4JI4E 4JI6E 4TUGA 1PKPA 2LUPB 1YYOA 4LF7E 3HTXA 4GKJE 3ADGA 1FJGE 2MC6A 4LFAE 4NXME 2L2MA 2V88A 5CFFE 3DF6A 1EKZA 2L3CA 4B3ME 1T4LB 2DIXA 3ZOQB 4DR7E 4JV5E 1IBME 1N34E 1YZ9A 3J81C 5DNYA 3AUZA 2UU9E 4GKKE 2UUBE 4DV3E 1O0WA 3F6GA 4LF4E 2NA2A 5AE2A 4K0KE 1J26A 3OTOE 2RS6A 2B9DA 4WSPA 2FV4B 4DR6E 4X64E 2UXDE 1SR9A 2RTXA 2JOXA 1T4OA 1IBLE 4GEQB 4DV7E 5F3WA 4JI1E 1YYKA 3IWDA 3J7Yp 4LTYA 4F54A 4F9AB 1HNZE 4B3RE 4DV2E 1WHQA 4JYAE 2NUFA 2YT4A 4JI2E 2ODRC 3HQ1A 2WZOA 2M4IA 3ADLA 1N32E 2L2NA 4M30A 4F9CB 2L8TA 3T1HE 1RC7A 2B3TB 3DJWA 3AV0A 2VQEE 2JWOA 2V85A 2M7QA 4DUYE 2N3GA 1XMOE 5LL6R 2LMZA 3IWBA 4OX9E 1X49A 2RS7A 4DUZE 4L5NC 3RMPA 4KHPE 2NUGA 4BBYA 2E1MA 5AE3A 2UXCE 3ADIA 3C4TA 3KWRA 2UXBE 4LF9E 1I94E 2MDRA 1N33E 3IWCA 4P78A 4B3SE 3LMLA 4M2ZA 2LTSA 4WFTA 1J5EE 2DSYA 5IWAE 2FTXB 3FIGA 4F9BB 4TUIA 4LF8E 3F6HA 2M1SA 2UUCE 5FLXC 4LF5E 1QU6A 3OMLA 4BC7A 4YHHE 2EZ6A 4BC9A 1WHNA 2K4VA 2DB2A 1HNXE 1STUA 3J7AG 2FGGA 3VYXA 4DR4E 4DMIA 2KONA 2EWLA 4X66E 1IBKE 2KHXA 4WYQB 2E5LE 2ZM6E 4R03A 1UILA 5LMUE 2F8BA 4DV4E 2JVAA 4J8ZA 5LMNE 2LBSB 2LJHA 1GZ6A 4Q28A 4X65E 4LFBE 4DV5E 2B7TA 2UUAE 3H09A 2DMYA 2L2KB 2MC5A 1UHZA 1DQ3A 4LU9A 3JAMC 4BCAA 3HXLA 2JOBA 5IT9C 2VQFE 4AQYE 4X8WA 2ODRD 4B3TE 1WXRA 4I8OA 3JTZA 5AE1A 2LTRA 4JI3E 2LE2A 3HPZA 3J80C 2V86A 2N3HA 2V8QB 2NUEA 3K6QA 1XMQE 2L92A 2JY9A 5AASA 2VE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 E;  4YY3 E;  4OOG C;  4DR3 E;  1HR0 E;  4JI5 E;  2HHH E;  1FKA E;  4DV1 E;  1RQ0 A;  2IHR 1;  2LUQ A;  1T4N A;  1ZBT A;  4JI8 E;  3C4B A;  2CPN A;  1N36 E;  4DV6 E;  4LF6 E;  2B7V A;  4DV0 E;  2LRS A;  3ADJ A;  4NXN E;  1DI2 A;  4DKK A;  3VYY A;  3P1X A;  4DR5 E;  1HNW E;  1YYW A;  2L33 A;  2RSM A;  4JI0 E;  2L3J A;  4JI7 E;  1GQE A;  2JY9 A;  1X48 A;  4DR1 E;  1X47 A;  4DR2 E;  4LFC E;  1XNQ E;  3T1Y E;  1XNR E;  2F4V E;  4X62 E;  4JI4 E;  4JI6 E;  1PKP A;  2LUP B;  1YYO A;  4LF7 E;  3HTX A;  4GKJ E;  3ADG A;  1FJG E;  4LFA E;  4NXM E;  2L2M A;  5CFF E;  1EKZ A;  2L3C A;  4B3M E;  1T4L B;  2DIX A;  4DR7 E;  4JV5 E;  1IBM E;  1N34 E;  1YZ9 A;  4GKK E;  2UU9 E;  2UUB E;  4DV3 E;  1O0W A;  4LF4 E;  1J26 A;  2NA2 A;  4K0K E;  3OTO E;  2RS6 A;  4DR6 E;  4X64 E;  2UXD E;  2RTX A;  1T4O A;  1IBL E;  4DV7 E;  4JI1 E;  1YYK A;  3J7Y p;  1HNZ E;  4B3R E;  4DV2 E;  1WHQ A;  4JYA E;  2NUF A;  2YT4 A;  4JI2 E;  3ADL A;  1N32 E;  4M30 A;  2L2N A;  3T1H E;  1RC7 A;  2B3T B;  2VQE E;  1XMO E;  4DUY E;  2N3G A;  4OX9 E;  1X49 A;  2RS7 A;  4DUZ E;  4KHP E;  2NUG A;  2UXC E;  3ADI A;  3C4T A;  2UXB E;  4LF9 E;  1I94 E;  2MDR A;  1N33 E;  4B3S E;  4M2Z A;  2LTS A;  4WFT A;  1J5E E;  5IWA E;  4LF8 E;  2UUC E;  4LF5 E;  1QU6 A;  2EZ6 A;  4YHH E;  1WHN A;  2DB2 A;  1HNX E;  1STU A;  3VYX A;  4DR4 E;  4X66 E;  1IBK E;  2KHX A;  4WYQ B;  2E5L E;  2ZM6 E;  1UIL A;  5LMU E;  4DV4 E;  2JVA A;  5LMN E;  2LBS B;  2LJH A;  4X65 E;  4LFB E;  4DV5 E;  2B7T A;  2UUA E;  2DMY A;  2L2K B;  1UHZ A;  2VQF E;  4AQY E;  4X8W A;  4B3T E;  2LTR A;  4JI3 E;  2NUE A;  2N3H A;  1XMQ E;  3LLH A; 
#chains in the Genus database with same CATH topology
 2V89 A;  5KL3 A;  2ELZ A;  4O4K A;  1HR0 E;  2IHR 1;  2WBS A;  4P7D A;  2YTI A;  2EML A;  4ZYG A;  3ADJ A;  2VF1 A;  4WPY A;  2V83 A;  1YFH A;  3VYY A;  1Z1B A;  1RMD A;  2EL6 A;  2L33 A;  2RSM A;  2YTP A;  1BBO A;  4DR1 E;  1X47 A;  1XNR E;  2YTN A;  4M9V C;  5A6A A;  3HTX A;  4GKJ E;  2MC6 A;  1T4L B;  5A6K A;  1N34 E;  5KL2 A;  2UU9 E;  2UUB E;  1O0W A;  1J26 A;  4NHR A;  5AE2 A;  4BHC A;  5A6B D;  2GLI A;  4X64 E;  1IBL E;  4JI1 E;  4DV2 E;  1WRJ A;  2EM5 A;  2BB8 A;  2WCC 3;  2ODR C;  2BBG A;  2M4I A;  2EOR A;  2L8T A;  2EP3 A;  4F2J C;  3EPH A;  3DJW A;  2JWO A;  2V85 A;  4DUY E;  1JK2 A;  2ENA A;  1X6F A;  1YSA C;  4BBY A;  2E1M A;  1F2I G;  3ADI A;  1PJT A;  2EQ3 A;  4LF9 E;  4RH8 A;  4M2Z A;  2EPK X;  1JK1 A;  3FIG A;  1PJQ A;  4LF8 E;  1A1I A;  2EN4 A;  5FLX C;  2EZ6 A;  1WHN A;  3J7A G;  2FGG A;  2A25 A;  4DR4 E;  4DMI A;  2KON A;  2ELY A;  2ENC A;  3MHS C;  4X66 E;  1G2F C;  4MLV A;  2F8B A;  4DV4 E;  1EH8 A;  2LJH A;  5AC5 A;  2EQ0 A;  5A6B A;  2EPU A;  1UBD C;  3H09 A;  2EM2 A;  2L2K B;  4O24 A;  5TSE A;  2VRD A;  4HEI A;  4Q35 B;  5IT9 C;  2VQF E;  2M9A A;  2EN1 A;  4X8W A;  4B3T E;  4I8O A;  2NUE A;  2N3H A;  3K6Q A;  4KWY A;  1IMU A;  2JY9 A;  2EN6 A;  4RHB B;  1A1G A;  2EMB A;  5BR8 E;  2YTG A;  2EOM A;  4YY3 E;  4DR3 E;  4BMJ A;  4ZYH A;  3QG5 C;  1FKA E;  1X6E A;  2EPN A;  1X6H A;  4DV1 E;  1T4N A;  1MEY C;  2I9I A;  1N3G A;  4JI8 E;  3ECR A;  3JU0 A;  2CPN A;  4L8N A;  5T6J A;  1N36 E;  2EOO A;  2EN2 A;  2LRS A;  2CTD A;  2I13 A;  3MSW A;  4KZS A;  3P1X A;  2HJJ A;  1HNW E;  1YYW A;  2JR1 A;  3KZZ A;  5KL4 A;  2EM6 A;  2Q8U A;  4JI7 E;  3VK6 A;  2EMW A;  1GQE A;  4R2D A;  4X9J A;  4DR2 E;  1LLM C;  2V87 A;  4LFC E;  3BGH A;  4X62 E;  1PKP A;  3L00 A;  2NAB A;  4NXM E;  2JYA A;  1NEI A;  3DF6 A;  4ZYE A;  2EM9 A;  2YSP A;  2EMA A;  1NCS A;  2EOF A;  1YZ9 A;  3KZY A;  5DNY A;  3EPL A;  4DV3 E;  2EMF A;  4LF4 E;  4K0K E;  2LT7 A;  2YTQ A;  2EMY A;  5KL7 A;  2B9D A;  2FV4 B;  4DR6 E;  1SR9 A;  1T4O A;  2EE8 A;  5A6J A;  2YRH A;  5F3W A;  1YYK A;  5KL5 A;  4LTY A;  1HNZ E;  4F9A B;  1WHQ A;  4HTG A;  2LO3 A;  4JYA E;  1A1L A;  3C6M A;  2YTD A;  3HQ1 A;  4M30 A;  3T1H E;  1RC7 A;  2B3T B;  1XMO E;  2EOJ A;  2EN7 A;  2M7Q A;  2N3G A;  1YUJ A;  1PDA A;  5LL6 R;  3IWB A;  2EMX A;  2RS7 A;  2YPN A;  5AE3 A;  3C4T A;  3KWR A;  4B3S E;  2EPP A;  2EPL X;  2LTS A;  2LV2 A;  1J5E E;  2DSY A;  5A69 A;  4TUI A;  1SFE A;  3F6H A;  2EM7 A;  2PRT A;  3OML A;  1KJK A;  4F6N A;  1T38 A;  2K4V A;  2WBU A;  1HNX E;  1STU A;  3VYX A;  2CSH A;  1A1J A;  2EL4 A;  2J7J A;  4F6M A;  2K7I A;  1IBK E;  1WJP A;  2DMI A;  2KHX A;  2YTJ A;  1YUI A;  2E5L E;  4J8Z A;  2MKD A;  2LVH A;  1GZ6 A;  4X65 E;  4GZN C;  3MHH C;  4MLQ A;  1PJS A;  3BF2 A;  1TF3 A;  4LFB E;  2E72 A;  4LU9 A;  1DQ3 A;  3JAM C;  1G2D C;  4BCA A;  1UN6 B;  3HXL A;  4WX9 A;  5IV8 B;  4AQY E;  1QNT A;  5AE1 A;  2LTR A;  2LE2 A;  2EQ1 A;  2V86 A;  2V8Q B;  2EMK A;  2EN3 A;  3M99 B;  2EN8 A;  2EPZ A;  3EQ1 A;  2EOH A;  2EOE A;  5ADZ A;  2LUQ A;  1A1F A;  1ZBT A;  2G7H A;  3TQM A;  1EH6 A;  2L6M A;  2YZT A;  2EPX A;  2L3J A;  1KYQ A;  3VHT B;  4O43 A;  2KOU A;  2YRM A;  4WSG A;  1AH5 A;  2LCE A;  1XNQ E;  3T1Y E;  4JI6 E;  1YYO A;  4LF7 E;  1A1K A;  4N4R B;  3THN A;  1FJG E;  4LFA E;  3BBG A;  1EKZ A;  3ZOQ B;  4DR7 E;  4JV5 E;  2EM4 A;  1IBM E;  4GKK E;  2EM3 A;  1ZU1 A;  3F6G A;  3OTO E;  1GTK A;  2ENH A;  2RS6 A;  3BID A;  1BBG A;  5AC4 A;  4WSP A;  4R2S A;  2RTX A;  2JOX A;  4GEQ B;  4DV7 E;  2EPA A;  1X3C A;  2EL5 A;  2NUF A;  4JI2 E;  3ADL A;  1N32 E;  2L2N A;  4F9C B;  1BB8 A;  2VQE E;  3AV0 A;  3EPJ A;  2EOX A;  2LMZ A;  2EJ4 A;  4OX9 E;  1X49 A;  2EOI A;  4DUZ E;  2UXC E;  2HGH A;  4WXC A;  1N33 E;  4P78 A;  3LML A;  4WFT A;  2FTX B;  4R2C A;  2YSO A;  4R2E A;  4F9B B;  1X5W A;  2UUC E;  2YRK A;  2RPC A;  1QU6 A;  5IXM B;  4IS1 C;  4BC9 A;  2DLQ A;  4WYQ B;  4R03 A;  1UIL A;  2HC5 A;  4R2A A;  5LMU E;  1TF6 A;  5LMN E;  4Q28 A;  4R2R A;  4DV5 E;  2GPI A;  4NZV A;  2EMI A;  2EOY A;  2YU5 A;  2MC5 A;  2YTF A;  2EM8 A;  2MKN A;  1MGT A;  2JOB A;  2JP9 A;  2EPC A;  2ODR D;  3C6K A;  4JI3 E;  1YPN A;  5AAS A;  4OOG C;  4JI5 E;  2HHH E;  3UK3 C;  1RQ0 A;  1ZR9 A;  2H36 X;  3C4B A;  2EMG A;  4DV6 E;  4LF6 E;  2B7V A;  4DV0 E;  4NXN E;  2ADR A;  2YU8 A;  1DI2 A;  4DKK A;  3HPS A;  4DR5 E;  2N8X A;  1ZBQ A;  4JI0 E;  2D9H A;  4R2P A;  2RQL A;  5A2Q C;  1B69 A;  4ZYD A;  4BS9 A;  1X48 A;  2EMH A;  2DLK A;  4FK5 C;  4R8O A;  4M0V A;  2F4V E;  2EMC A;  4JI4 E;  2R1F A;  4TUG A;  2LUP B;  1TN9 A;  3ADG A;  2L2M A;  2V88 A;  5CFF E;  1A1H A;  2L3C A;  4B3M E;  2DIX A;  2DRP A;  3J81 C;  3AUZ A;  2EOQ A;  1EH7 A;  2NA2 A;  2EOZ A;  2RSI A;  1ZAA C;  2UXD E;  1L4S A;  3THO B;  3IWD A;  3J7Y p;  4F54 A;  4R2Q A;  4B3R E;  2YT4 A;  2WZO A;  4WXD A;  2CT1 A;  1IQO A;  5KL6 A;  2JXP A;  3RMP A;  4L5N C;  4KHP E;  2NUG A;  2WBT A;  2UXB E;  3EPK A;  2JPA A;  1I94 E;  2MDR A;  3IWC A;  2MDG A;  2EOS A;  2LJU A;  2R76 A;  5IWA E;  1T39 A;  4O5G A;  2GHF A;  2M1S A;  5LLQ A;  4LF5 E;  4BC7 A;  4YHH E;  2YTE A;  2EPR A;  2DB2 A;  2EMZ A;  2EPO A;  2EWL A;  2YWQ A;  2EPM X;  2EM0 A;  2ZM6 E;  1P47 A;  1DGC A;  2YTO A;  2JVA A;  4BHB A;  1IQS A;  2LBS B;  2B7T A;  2UUA E;  2DMY A;  1UHZ A;  1WXR A;  3JTZ A;  4IJD A;  3HPZ A;  3J80 C;  1AAY A;  2DGC A;  1XMQ E;  2L92 A;  3LLH A;  2VE7 C; 
#chains in the Genus database with same CATH homology
 5BR8 E;  2V89 A;  4YY3 E;  4OOG C;  4DR3 E;  4BMJ A;  1HR0 E;  2HHH E;  4JI5 E;  1FKA E;  3LLH A;  4DV1 E;  1RQ0 A;  2IHR 1;  2LUQ A;  1T4N A;  5ADZ A;  1ZBT A;  4JI8 E;  2G7H A;  2H36 X;  3C4B A;  3JU0 A;  4P7D A;  2CPN A;  4L8N A;  5T6J A;  2L6M A;  2YZT A;  4DV6 E;  1N36 E;  4LF6 E;  2B7V A;  4DV0 E;  2LRS A;  3ADJ A;  4NXN E;  2VF1 A;  4WPY A;  2V83 A;  1DI2 A;  3MSW A;  4KZS A;  4DKK A;  3VYY A;  3P1X A;  3HPS A;  4DR5 E;  1HNW E;  1YYW A;  1ZBQ A;  2L33 A;  2RSM A;  2JR1 A;  4JI0 E;  2L3J A;  5A2Q C;  4JI7 E;  3VK6 A;  1GQE A;  2KOU A;  4BS9 A;  1X48 A;  4R8O A;  4DR1 E;  1X47 A;  4DR2 E;  2V87 A;  4LFC E;  4M0V A;  3T1Y E;  1XNQ E;  1XNR E;  4X62 E;  2F4V E;  4JI4 E;  4JI6 E;  4TUG A;  1PKP A;  2LUP B;  1YYO A;  4LF7 E;  3HTX A;  4GKJ E;  3ADG A;  1FJG E;  2MC6 A;  4LFA E;  4NXM E;  2L2M A;  2V88 A;  5CFF E;  3DF6 A;  1EKZ A;  2L3C A;  4B3M E;  1T4L B;  2DIX A;  3ZOQ B;  4DR7 E;  4JV5 E;  1IBM E;  1N34 E;  1YZ9 A;  3J81 C;  5DNY A;  3AUZ A;  2UU9 E;  4GKK E;  2UUB E;  4DV3 E;  1O0W A;  3F6G A;  4LF4 E;  2NA2 A;  5AE2 A;  4K0K E;  1J26 A;  3OTO E;  2RS6 A;  2B9D A;  4WSP A;  2FV4 B;  4DR6 E;  4X64 E;  2UXD E;  1SR9 A;  2RTX A;  2JOX A;  1T4O A;  1IBL E;  4GEQ B;  4DV7 E;  5F3W A;  4JI1 E;  1YYK A;  3IWD A;  3J7Y p;  4LTY A;  4F54 A;  4F9A B;  1HNZ E;  4B3R E;  4DV2 E;  1WHQ A;  4JYA E;  2NUF A;  2YT4 A;  4JI2 E;  2ODR C;  3HQ1 A;  2WZO A;  2M4I A;  3ADL A;  1N32 E;  2L2N A;  4M30 A;  4F9C B;  2L8T A;  3T1H E;  1RC7 A;  2B3T B;  3DJW A;  3AV0 A;  2VQE E;  2JWO A;  2V85 A;  2M7Q A;  4DUY E;  2N3G A;  1XMO E;  5LL6 R;  2LMZ A;  3IWB A;  4OX9 E;  1X49 A;  2RS7 A;  4DUZ E;  4L5N C;  3RMP A;  4KHP E;  2NUG A;  4BBY A;  2E1M A;  5AE3 A;  2UXC E;  3ADI A;  3C4T A;  3KWR A;  2UXB E;  4LF9 E;  1I94 E;  2MDR A;  1N33 E;  3IWC A;  4P78 A;  4B3S E;  3LML A;  4M2Z A;  2LTS A;  4WFT A;  1J5E E;  2DSY A;  5IWA E;  2FTX B;  3FIG A;  4F9B B;  4TUI A;  4LF8 E;  3F6H A;  2M1S A;  2UUC E;  5FLX C;  4LF5 E;  1QU6 A;  3OML A;  4BC7 A;  4YHH E;  2EZ6 A;  4BC9 A;  1WHN A;  2K4V A;  2DB2 A;  1HNX E;  1STU A;  3J7A G;  2FGG A;  3VYX A;  4DR4 E;  4DMI A;  2KON A;  2EWL A;  4X66 E;  1IBK E;  2KHX A;  4WYQ B;  2E5L E;  2ZM6 E;  4R03 A;  1UIL A;  5LMU E;  2F8B A;  4DV4 E;  2JVA A;  4J8Z A;  5LMN E;  2LBS B;  2LJH A;  1GZ6 A;  4Q28 A;  4X65 E;  4LFB E;  4DV5 E;  2B7T A;  2UUA E;  3H09 A;  2DMY A;  2L2K B;  2MC5 A;  1UHZ A;  1DQ3 A;  4LU9 A;  3JAM C;  4BCA A;  3HXL A;  2JOB A;  5IT9 C;  2VQF E;  4AQY E;  4X8W A;  2ODR D;  4B3T E;  1WXR A;  4I8O A;  3JTZ A;  5AE1 A;  2LTR A;  4JI3 E;  2LE2 A;  3HPZ A;  3J80 C;  2V86 A;  2N3H A;  2V8Q B;  2NUE A;  3K6Q A;  1XMQ E;  2L92 A;  2JY9 A;  5AAS A;  2VE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...