2LUQA

Solution structure of double-stranded rna binding domain of s.cerevisiae rnase iii (rnt1p)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
b'GSLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease 3
publication title Intrinsic Dynamics of an Extended Hydrophobic Core in the S. cerevisiae RNase III dsRBD Contributes to Recognition of Specific RNA Binding Sites.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2luqA00
1RQ0A 4X8WA 2KHXA 1HNZE 2B7TA 4M30A 2LJHA 1FKAE 4GKJE 4DV4E 4LFBE 1DI2A 4OX9E 4B3SE 2B3TB 4JI1E 1PKPA 1HR0E 1WHQA 1EKZA 3HTXA 2L3JA 1GQEA 2ZM6E 4DR2E 2F4VE 1IBME 2HHHE 4JI2E 4WFTA 4X66E 1XNQE 2NUFA 4M2ZA 4LFAE 4JYAE 4DUZE 4DR1E 4X64E 2LBSB 5BR8E 1N36E 4OOGC 4LF4E 2JY9A 2YT4A 4DV3E 1HNXE 1QU6A 4JI7E 1N32E 3ADLA 4JV5E 4LF7E 4LF6E 5LMUE 2UUCE 4NXME 3LLHA 3OTOE 1T4LB 1RC7A 4JI5E 3ADGA 2NUGA 2UXBE 2NA2A 4DV2E 2N3HA 4JI3E 1XNRE 4K0KE 1J5EE 2L2KB 1YYOA 1XMQE 3VYYA 2IHR1 4DR4E 3C4BA 4X65E 1STUA 2VQEE 2B7VA 2LTSA 3J7Yp 2L3CA 2L2NA 3T1HE 1X49A 1UHZA 1T4OA 4GKKE 5LMNE 2RS6A 3T1YE 2UXCE 2NUEA 2L33A 4DV0E 1I94E 4LFCE 3VYXA 4LF5E 4B3RE 2VQFE 2DIXA 4WYQB 4JI6E 1T4NA 4DR7E 2E5LE 3C4TA 4DV5E 4B3TE 1O0WA 2MDRA 4DV7E 4DR3E 1N34E 5IWAE 4LF8E 4JI4E 4DR6E 2LRSA 4NXNE 1X47A 2DB2A 1YZ9A 1YYKA 1X48A 4AQYE 2JVAA 2RS7A 2UUAE 5CFFE 4JI8E 2RTXA 4YY3E 1IBLE 1N33E 4DV1E 3P1XA 2LUPB 4YHHE 2L2MA 4X62E 3ADJA 1ZBTA 1XMOE 1FJGE 2LTRA 2CPNA 1IBKE 2LUQA 2N3GA 2UUBE 1YYWA 3ADIA 2DMYA 2EZ6A 4DV6E 1WHNA 2UXDE 4DUYE 4JI0E 2UU9E 4LF9E 4DR5E 2RSMA 4DKKA 4KHPE 4B3ME 1HNWE 1J26A 1UILA
chains in the Genus database with same CATH superfamily
1RQ0A 1EH7A 4M30A 4GKJE 4DV4E 4KWYA 1DI2A 2DMIA 4ZYGA 5KL3A 4B3SE 2B3TB 1PKPA 1HR0E 4O5GA 1GQEA 2FGGA 1IBME 2HHHE 2YTJA 2YRHA 2K7IA 3OMLA 4WFTA 1IMUA 2EM2A 3KZZA 4LFAE 2YZTA 3C6KA 2KONA 2JY9A 2DRPA 2R1FA 2ENCA 2L6MA 4WXCA 2EL5A 4F9BB 2EQ1A 2EMLA 4NXME 3THNA 2EQ3A 2YPNA 2CT1A 2EPKX 2EMIA 3VYYA 2IHR1 4Q35B 2K4VA 2E1MA 2HJJA 1STUA 5A69A 1DQ3A 2B7VA 3AUZA 1X49A 3AV0A 2YWQA 2EOYA 4P78A 5LLQA 2EORA 2LJUA 2UXCE 4DV0E 1G2DC 2DIXA 5AE2A 4R2RA 2YSOA 2JYAA 4BCAA 4ZYHA 4FK5C 1T4NA 2EN7A 2H36X 4ZYEA 2MDRA 4DR3E 3HPSA 3F6HA 5IWAE 2EOFA 4NXNE 1YUIA 4IS1C 2DB2A 2EMGA 1YSAC 4RH8A 2JVAA 4R2AA 3TQMA 3DJWA 2M9AA 2YTEA 4BHCA 4YHHE 2RQLA 2YTQA 3ADJA 3JAMC 2L92A 1XMOE 1FJGE 2CPNA 2YTDA 4WSPA 1YYWA 2EN3A 2EPAA 1WHNA 2UU9E 2R76A 4LTYA 2HGHA 2LMZA 2WZOA 2A25A 2RSMA 4R2PA 4DKKA 1KYQA 4B3ME 4O24A 2YTFA 2EN8A 2L8TA 2KHXA 5IT9C 1A1FA 2YTIA 1WHQA 1PJTA 4WPYA 1EKZA 4BS9A 2F4VE 2V83A 4WX9A 4JI2E 2EPCA 3JTZA 2DGCA 2EPLX 2EM4A 2EOHA 1N3GA 1AH5A 2LBSB 4LF4E 2D9HA 1X6EA 3ZOQB 3EPKA 4L8NA 1PJSA 2EE8A 2EWLA 1X3CA 3BF2A 3JU0A 1N32E 2EJ4A 3ADLA 1GTKA 4NZVA 1NCSA 4Q28A 3C6MA 2FV4B 2EPOA 2EMZA 2EPNA 2EN2A 1A1KA 2UXBE 2DSYA 2NA2A 3ECRA 2MC5A 2G7HA 1J5EE 2M1SA 2L2KB 3KWRA 1XMQE 2LE2A 2YU8A 1T38A 2MDGA 2VQEE 2EN6A 3THOB 5A6KA 2L3CA 2L2NA 1T4OA 3K6QA 2RSIA 2YU5A 2VF1A 4B3RE 2MC6A 2EPPA 3BBGA 4WYQB 3EQ1A 1A1HA 4DR7E 4DV5E 5AE3A 4B3TE 5A6BA 4F6MA 4DV7E 4DR6E 1N34E 4JI4E 3L00A 2B9DA 5LL6R 4M9VC 2E72A 4BC9A 2ODRD 2YRKA 2V86A 4I8OA 5CFFE 4JI8E 4YY3E 1IBLE 2V85A 4LU9A 5TSEA 4DV1E 1WRJA 3P1XA 2LUPB 3BGHA 4X62E 2EOQA 1IQOA 2N3GA 2UUBE 2EMFA 4GEQB 4DV6E 1TF3A 2EMXA 4JI0E 1BBGA 1UBDC 1F2IG 5F3WA 4NHRA 2MKNA 2ELZA 2EPUA 2WBSA 5A6JA 2WBUA 1J26A 2Q8UA 2EL6A 1HNZE 2B7TA 2LJHA 3J7AG 4OX9E 2EM3A 2EP3A 3EPLA 1YUJA 1GZ6A 2L3JA 1SFEA 2N8XA 2ZM6E 4DR2E 2YTNA 5FLXC 4X66E 3FIGA 1XNQE 2YTOA 2NUFA 4R2EA 1NEIA 5AASA 4JYAE 4DR1E 4X64E 3EPHA 1A1GA 2GHFA 2YT4A 1X6FA 4DV3E 1QU6A 3F6GA 4R03A 5KL7A 4JI7E 5KL4A 4JV5E 5LMUE 2UUCE 2EOEA 2EMAA 5AC4A 3OTOE 1T4LB 4JI5E 2EPRA 3ADGA 2I9IA 5KL2A 2V89A 4DV2E 2N3HA 4K0KE 3LMLA 2YTPA 1XNRE 2KOUA 5IV8B 4R8OA 3MHHC 2PRTA 3C4BA 2CTDA 1PJQA 2ADRA 2LCEA 3RMPA 2CSHA 1UHZA 1RMDA 5LMNE 2EMBA 2RS6A 3MHSC 2EMWA 1SR9A 2V88A 3KZYA 1X5WA 3HXLA 2EOIA 4BBYA 2EOXA 1TN9A 4JI6E 2BBGA 2GPIA 1PDAA 2HC5A 2EM6A 2EMCA 3C4TA 3J80C 2NABA 4L5NC 3HQ1A 1QNTA 2EMHA 4F54A 2LRSA 1X47A 1L4SA 1YZ9A 3IWDA 2ENHA 4O4KA 2M7QA 1YFHA 1X6HA 3M99B 1X48A 2EM9A 4R2QA 2JP9A 1ZBQA 4P7DA 2UUAE 3HPZA 2RTXA 3DF6A 4TUIA 2EOOA 2VE7C 2LV2A 1ZBTA 4MLQA 5KL6A 2WBTA 1IBKE 2LUQA 4RHBB 2DMYA 2EZ6A 2JOBA 4DUYE 1ZR9A 4DR5E 1WXRA 1AAYA 1B69A 2EOJA 4F9CB 1BBOA 1UILA 4X8WA 2GLIA 2LO3A 4R2SA 1FKAE 1TF6A 2I13A 1BB8A 1MGTA 4LFBE 1T39A 2EOZA 4JI1E 2V87A 5ADZA 3UK3C 1Z1BA 3HTXA 3EPJA 2JWOA 4F2JC 4IJDA 5DNYA 4M2ZA 2BB8A 4DUZE 5IXMB 4J8ZA 5AC5A 1EH8A 5T6JA 2EPXA 1EH6A 5BR8E 1KJKA 1N36E 4OOGC 2ELYA 4R2CA 5A6BD 1HNXE 2EN4A 2EN1A 2EQ0A 4LF7E 4KZSA 4LF6E 4M0VA 3LLHA 2EPMX 5A6AA 1JK2A 1RC7A 2NUGA 2JPAA 1YPNA 4JI3E 4HEIA 3VK6A 2FTXB 3QG5C 1YYOA 3H09A 2EOSA 4TUGA 4DR4E 4X65E 1LLMC 3VHTB 2JOXA 1WJPA 1A1IA 2MKDA 2LTSA 2RPCA 5AE1A 2YTGA 3J7Yp 5A2QC 2LVHA 3T1HE 3IWBA 4GKKE 2EMYA 1UN6B 3T1YE 4N4RB 2NUEA 2L33A 1I94E 4LFCE 4X9JA 4BMJA 3VYXA 4LF5E 1ZU1A 2DLQA 2EL4A 3BIDA 2VQFE 3MSWA 4F6NA 1HNWE 2JXPA 2M4IA 2EM8A 2EPZA 2F8BA 1A1LA 2E5LE 1ZAAC 1O0WA 2ENAA 3J81C 4GZNC 4LF8E 1MEYC 2VRDA 4F9AB 4WSGA 3IWCA 1YYKA 4AQYE 2RS7A 1DGCA 2YSPA 5KL5A 1A1JA 4DMIA 2WCC3 1N33E 4WXDA 2EM5A 2EM7A 2ODRC 2V8QB 2L2MA 4BHBA 1G2FC 2LT7A 2JR1A 2LTRA 4HTGA 3ADIA 2EM0A 1IQSA 2YRMA 2UXDE 4LF9E 2EOMA 4O43A 1JK1A 4BC7A 2J7JA 4R2DA 4MLVA 4KHPE 1P47A 2EMKA 2DLKA 4ZYDA
chains in the Genus database with same CATH topology
1RQ0A 2L8TA 4X8WA 2KHXA 1HNZE 2B7TA 4M30A 2LJHA 5IT9C 1FKAE 4DV4E 3J7AG 4GKJE 4LFBE 1DI2A 4OX9E 4B3SE 2B3TB 2V87A 1PKPA 4JI1E 1HR0E 1WHQA 5ADZA 4WPYA 1EKZA 4BS9A 3HTXA 1GZ6A 1GQEA 2L3JA 2ZM6E 2FGGA 4DR2E 2JWOA 2F4VE 1IBME 2HHHE 2V83A 5DNYA 5FLXC 4JI2E 4WFTA 3OMLA 4X66E 3FIGA 1XNQE 3JTZA 2NUFA 4M2ZA 4LFAE 5AASA 4JYAE 4DUZE 4DR1E 4X64E 2YZTA 4J8ZA 2KONA 5T6JA 2LBSB 5BR8E 1N36E 4OOGC 4LF4E 2JY9A 2YT4A 4DV3E 1HNXE 1QU6A 3F6GA 4R03A 4JI7E 3ZOQB 2L6MA 4L8NA 1N32E 3ADLA 2EWLA 3JU0A 4LF7E 4JV5E 4F9BB 4KZSA 4Q28A 4LF6E 5LMUE 2UUCE 2FV4B 4NXME 4M0VA 3LLHA 3OTOE 1T4LB 1RC7A 4JI5E 3ADGA 2NUGA 2UXBE 2DSYA 2NA2A 2N3HA 2MC5A 2V89A 3LMLA 3VK6A 4DV2E 2G7HA 4JI3E 2KOUA 1XNRE 2FTXB 1J5EE 2M1SA 2L2KB 1YYOA 4R8OA 3KWRA 1XMQE 3H09A 3VYYA 2IHR1 4TUGA 4DR4E 2LE2A 3C4BA 4X65E 2K4VA 2E1MA 2JOXA 1STUA 2VQEE 1DQ3A 2B7VA 2LTSA 5AE1A 3J7Yp 3RMPA 5A2QC 3AUZA 2L3CA 2L2NA 3T1HE 1X49A 3AV0A 1UHZA 1T4OA 3IWBA 4P78A 4GKKE 5LMNE 2RS6A 3T1YE 4DR6E 2NUEA 2UXCE 2L33A 3K6QA 4DV0E 1I94E 4LFCE 3VYXA 4BMJA 1SR9A 2V88A 2VF1A 4LF5E 2MC6A 2VQFE 4B3RE 3MSWA 2DIXA 4WYQB 5AE2A 3HXLA 4BCAA 4BBYA 4JI6E 1T4NA 2M4IA 4DR7E 2F8BA 2E5LE 3C4TA 4DV5E 3J80C 5AE3A 4B3TE 4L5NC 3HQ1A 2H36X 1O0WA 3J81C 2MDRA 4DV7E 4DR3E 3HPSA 3F6HA 5IWAE 1N34E 4F54A 4JI4E 2LRSA 4LF8E 4F9AB 4NXNE 2B9DA 1X47A 5LL6R 2DB2A 3IWDA 2M7QA 1YZ9A 3IWCA 1YYKA 1X48A 4AQYE 2JVAA 4K0KE 4BC9A 2ODRD 2RS7A 1ZBQA 3DJWA 4P7DA 2UUAE 2V86A 4I8OA 5CFFE 4DMIA 3HPZA 4JI8E 2RTXA 4YY3E 1IBLE 1N33E 2V85A 4LU9A 4DV1E 3DF6A 2ODRC 3P1XA 2LUPB 2V8QB 4YHHE 4TUIA 2L2MA 4X62E 2VE7C 3ADJA 1ZBTA 3JAMC 2L92A 1XMOE 2JR1A 1FJGE 2LTRA 2CPNA 4WSPA 2LUQA 2N3GA 1IBKE 2UUBE 1YYWA 2DMYA 3ADIA 4GEQB 4DV6E 2EZ6A 2JOBA 1WHNA 2UXDE 4DUYE 4JI0E 2UU9E 4LTYA 4LF9E 4DR5E 1WXRA 5F3WA 2LMZA 2WZOA 2RSMA 4BC7A 4DKKA 4KHPE 4B3ME 4F9CB 1HNWE 1J26A 1UILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQ0 A;  4X8W A;  2KHX A;  1HNZ E;  2B7T A;  4M30 A;  2LJH A;  1FKA E;  4GKJ E;  4DV4 E;  4LFB E;  1DI2 A;  4OX9 E;  4B3S E;  2B3T B;  4JI1 E;  1PKP A;  1HR0 E;  1WHQ A;  1EKZ A;  3HTX A;  2L3J A;  1GQE A;  2ZM6 E;  4DR2 E;  2F4V E;  1IBM E;  2HHH E;  4JI2 E;  4WFT A;  4X66 E;  1XNQ E;  2NUF A;  4M2Z A;  4LFA E;  4JYA E;  4DUZ E;  4DR1 E;  4X64 E;  2LBS B;  5BR8 E;  1N36 E;  4OOG C;  4LF4 E;  2JY9 A;  2YT4 A;  4DV3 E;  1HNX E;  1QU6 A;  4JI7 E;  1N32 E;  3ADL A;  4JV5 E;  4LF7 E;  4LF6 E;  5LMU E;  2UUC E;  4NXM E;  3LLH A;  3OTO E;  1T4L B;  1RC7 A;  4JI5 E;  3ADG A;  2NUG A;  2UXB E;  2NA2 A;  4DV2 E;  2N3H A;  4JI3 E;  1XNR E;  4K0K E;  1J5E E;  2L2K B;  1YYO A;  1XMQ E;  3VYY A;  2IHR 1;  4DR4 E;  3C4B A;  4X65 E;  1STU A;  2VQE E;  2B7V A;  2LTS A;  3J7Y p;  2L3C A;  2L2N A;  3T1H E;  1X49 A;  1UHZ A;  1T4O A;  4GKK E;  5LMN E;  2RS6 A;  3T1Y E;  2UXC E;  2NUE A;  2L33 A;  4DV0 E;  1I94 E;  4LFC E;  3VYX A;  4LF5 E;  4B3R E;  2VQF E;  2DIX A;  4WYQ B;  4JI6 E;  1T4N A;  4DR7 E;  2E5L E;  3C4T A;  4DV5 E;  4B3T E;  1O0W A;  2MDR A;  4DV7 E;  4DR3 E;  1N34 E;  5IWA E;  4LF8 E;  4JI4 E;  4DR6 E;  2LRS A;  4NXN E;  1X47 A;  2DB2 A;  1YZ9 A;  1YYK A;  1X48 A;  4AQY E;  2JVA A;  2RS7 A;  2UUA E;  5CFF E;  4JI8 E;  2RTX A;  4YY3 E;  1IBL E;  1N33 E;  4DV1 E;  3P1X A;  2LUP B;  4YHH E;  2L2M A;  4X62 E;  3ADJ A;  1ZBT A;  1XMO E;  1FJG E;  2LTR A;  2CPN A;  1IBK E;  2LUQ A;  2N3G A;  2UUB E;  1YYW A;  3ADI A;  2DMY A;  2EZ6 A;  4DV6 E;  1WHN A;  2UXD E;  4DUY E;  4JI0 E;  2UU9 E;  4LF9 E;  4DR5 E;  2RSM A;  4DKK A;  4KHP E;  4B3M E;  1HNW E;  1J26 A;  1UIL A; 
#chains in the Genus database with same CATH topology
 1RQ0 A;  1EH7 A;  4M30 A;  4GKJ E;  4DV4 E;  4KWY A;  1DI2 A;  2DMI A;  4ZYG A;  5KL3 A;  4B3S E;  2B3T B;  1PKP A;  1HR0 E;  4O5G A;  1GQE A;  2FGG A;  1IBM E;  2HHH E;  2YTJ A;  2YRH A;  2K7I A;  3OML A;  4WFT A;  1IMU A;  2EM2 A;  3KZZ A;  4LFA E;  2YZT A;  3C6K A;  2KON A;  2JY9 A;  2DRP A;  2R1F A;  2ENC A;  2L6M A;  4WXC A;  2EL5 A;  4F9B B;  2EQ1 A;  2EML A;  4NXM E;  3THN A;  2EQ3 A;  2YPN A;  2CT1 A;  2EPK X;  2EMI A;  3VYY A;  2IHR 1;  4Q35 B;  2K4V A;  2E1M A;  2HJJ A;  1STU A;  5A69 A;  1DQ3 A;  2B7V A;  3AUZ A;  1X49 A;  3AV0 A;  2YWQ A;  2EOY A;  4P78 A;  5LLQ A;  2EOR A;  2LJU A;  2UXC E;  4DV0 E;  1G2D C;  2DIX A;  5AE2 A;  4R2R A;  2YSO A;  2JYA A;  4BCA A;  4ZYH A;  4FK5 C;  1T4N A;  2EN7 A;  2H36 X;  4ZYE A;  2MDR A;  4DR3 E;  3HPS A;  3F6H A;  5IWA E;  2EOF A;  4NXN E;  1YUI A;  4IS1 C;  2DB2 A;  2EMG A;  1YSA C;  4RH8 A;  2JVA A;  4R2A A;  3TQM A;  3DJW A;  2M9A A;  2YTE A;  4BHC A;  4YHH E;  2RQL A;  2YTQ A;  3ADJ A;  3JAM C;  2L92 A;  1XMO E;  1FJG E;  2CPN A;  2YTD A;  4WSP A;  1YYW A;  2EN3 A;  2EPA A;  1WHN A;  2UU9 E;  2R76 A;  4LTY A;  2HGH A;  2LMZ A;  2WZO A;  2A25 A;  2RSM A;  4R2P A;  4DKK A;  1KYQ A;  4B3M E;  4O24 A;  2YTF A;  2EN8 A;  2L8T A;  2KHX A;  5IT9 C;  1A1F A;  2YTI A;  1WHQ A;  1PJT A;  4WPY A;  1EKZ A;  4BS9 A;  2F4V E;  2V83 A;  4WX9 A;  4JI2 E;  2EPC A;  3JTZ A;  2DGC A;  2EPL X;  2EM4 A;  2EOH A;  1N3G A;  1AH5 A;  2LBS B;  4LF4 E;  2D9H A;  1X6E A;  3ZOQ B;  3EPK A;  4L8N A;  1PJS A;  2EE8 A;  2EWL A;  1X3C A;  3BF2 A;  3JU0 A;  1N32 E;  2EJ4 A;  3ADL A;  1GTK A;  4NZV A;  1NCS A;  4Q28 A;  3C6M A;  2FV4 B;  2EPO A;  2EMZ A;  2EPN A;  2EN2 A;  1A1K A;  2UXB E;  2DSY A;  2NA2 A;  3ECR A;  2MC5 A;  2G7H A;  1J5E E;  2M1S A;  2L2K B;  3KWR A;  1XMQ E;  2LE2 A;  2YU8 A;  1T38 A;  2MDG A;  2VQE E;  2EN6 A;  3THO B;  5A6K A;  2L3C A;  2L2N A;  1T4O A;  3K6Q A;  2RSI A;  2YU5 A;  2VF1 A;  4B3R E;  2MC6 A;  2EPP A;  3BBG A;  4WYQ B;  3EQ1 A;  1A1H A;  4DR7 E;  4DV5 E;  5AE3 A;  4B3T E;  5A6B A;  4F6M A;  4DV7 E;  4DR6 E;  1N34 E;  4JI4 E;  3L00 A;  2B9D A;  5LL6 R;  4M9V C;  2E72 A;  4BC9 A;  2ODR D;  2YRK A;  2V86 A;  4I8O A;  5CFF E;  4JI8 E;  4YY3 E;  1IBL E;  2V85 A;  4LU9 A;  5TSE A;  4DV1 E;  1WRJ A;  3P1X A;  2LUP B;  3BGH A;  4X62 E;  2EOQ A;  1IQO A;  2N3G A;  2UUB E;  2EMF A;  4GEQ B;  4DV6 E;  1TF3 A;  2EMX A;  4JI0 E;  1BBG A;  1UBD C;  1F2I G;  5F3W A;  4NHR A;  2MKN A;  2ELZ A;  2EPU A;  2WBS A;  5A6J A;  2WBU A;  1J26 A;  2Q8U A;  2EL6 A;  1HNZ E;  2B7T A;  2LJH A;  3J7A G;  4OX9 E;  2EM3 A;  2EP3 A;  3EPL A;  1YUJ A;  1GZ6 A;  2L3J A;  1SFE A;  2N8X A;  2ZM6 E;  4DR2 E;  2YTN A;  5FLX C;  4X66 E;  3FIG A;  1XNQ E;  2YTO A;  2NUF A;  4R2E A;  1NEI A;  5AAS A;  4JYA E;  4DR1 E;  4X64 E;  3EPH A;  1A1G A;  2GHF A;  2YT4 A;  1X6F A;  4DV3 E;  1QU6 A;  3F6G A;  4R03 A;  5KL7 A;  4JI7 E;  5KL4 A;  4JV5 E;  5LMU E;  2UUC E;  2EOE A;  2EMA A;  5AC4 A;  3OTO E;  1T4L B;  4JI5 E;  2EPR A;  3ADG A;  2I9I A;  5KL2 A;  2V89 A;  4DV2 E;  2N3H A;  4K0K E;  3LML A;  2YTP A;  1XNR E;  2KOU A;  5IV8 B;  4R8O A;  3MHH C;  2PRT A;  3C4B A;  2CTD A;  1PJQ A;  2ADR A;  2LCE A;  3RMP A;  2CSH A;  1UHZ A;  1RMD A;  5LMN E;  2EMB A;  2RS6 A;  3MHS C;  2EMW A;  1SR9 A;  2V88 A;  3KZY A;  1X5W A;  3HXL A;  2EOI A;  4BBY A;  2EOX A;  1TN9 A;  4JI6 E;  2BBG A;  2GPI A;  1PDA A;  2HC5 A;  2EM6 A;  2EMC A;  3C4T A;  3J80 C;  2NAB A;  4L5N C;  3HQ1 A;  1QNT A;  2EMH A;  4F54 A;  2LRS A;  1X47 A;  1L4S A;  1YZ9 A;  3IWD A;  2ENH A;  4O4K A;  2M7Q A;  1YFH A;  1X6H A;  3M99 B;  1X48 A;  2EM9 A;  4R2Q A;  2JP9 A;  1ZBQ A;  4P7D A;  2UUA E;  3HPZ A;  2RTX A;  3DF6 A;  4TUI A;  2EOO A;  2VE7 C;  2LV2 A;  1ZBT A;  4MLQ A;  5KL6 A;  2WBT A;  1IBK E;  2LUQ A;  4RHB B;  2DMY A;  2EZ6 A;  2JOB A;  4DUY E;  1ZR9 A;  4DR5 E;  1WXR A;  1AAY A;  1B69 A;  2EOJ A;  4F9C B;  1BBO A;  1UIL A;  4X8W A;  2GLI A;  2LO3 A;  4R2S A;  1FKA E;  1TF6 A;  2I13 A;  1BB8 A;  1MGT A;  4LFB E;  1T39 A;  2EOZ A;  4JI1 E;  2V87 A;  5ADZ A;  3UK3 C;  1Z1B A;  3HTX A;  3EPJ A;  2JWO A;  4F2J C;  4IJD A;  5DNY A;  4M2Z A;  2BB8 A;  4DUZ E;  5IXM B;  4J8Z A;  5AC5 A;  1EH8 A;  5T6J A;  2EPX A;  1EH6 A;  5BR8 E;  1KJK A;  1N36 E;  4OOG C;  2ELY A;  4R2C A;  5A6B D;  1HNX E;  2EN4 A;  2EN1 A;  2EQ0 A;  4LF7 E;  4KZS A;  4LF6 E;  4M0V A;  3LLH A;  2EPM X;  5A6A A;  1JK2 A;  1RC7 A;  2NUG A;  2JPA A;  1YPN A;  4JI3 E;  4HEI A;  3VK6 A;  2FTX B;  3QG5 C;  1YYO A;  3H09 A;  2EOS A;  4TUG A;  4DR4 E;  4X65 E;  1LLM C;  3VHT B;  2JOX A;  1WJP A;  1A1I A;  2MKD A;  2LTS A;  2RPC A;  5AE1 A;  2YTG A;  3J7Y p;  5A2Q C;  2LVH A;  3T1H E;  3IWB A;  4GKK E;  2EMY A;  1UN6 B;  3T1Y E;  4N4R B;  2NUE A;  2L33 A;  1I94 E;  4LFC E;  4X9J A;  4BMJ A;  3VYX A;  4LF5 E;  1ZU1 A;  2DLQ A;  2EL4 A;  3BID A;  2VQF E;  3MSW A;  4F6N A;  1HNW E;  2JXP A;  2M4I A;  2EM8 A;  2EPZ A;  2F8B A;  1A1L A;  2E5L E;  1ZAA C;  1O0W A;  2ENA A;  3J81 C;  4GZN C;  4LF8 E;  1MEY C;  2VRD A;  4F9A B;  4WSG A;  3IWC A;  1YYK A;  4AQY E;  2RS7 A;  1DGC A;  2YSP A;  5KL5 A;  1A1J A;  4DMI A;  2WCC 3;  1N33 E;  4WXD A;  2EM5 A;  2EM7 A;  2ODR C;  2V8Q B;  2L2M A;  4BHB A;  1G2F C;  2LT7 A;  2JR1 A;  2LTR A;  4HTG A;  3ADI A;  2EM0 A;  1IQS A;  2YRM A;  2UXD E;  4LF9 E;  2EOM A;  4O43 A;  1JK1 A;  4BC7 A;  2J7J A;  4R2D A;  4MLV A;  4KHP E;  1P47 A;  2EMK A;  2DLK A;  4ZYD A; 
#chains in the Genus database with same CATH homology
 1RQ0 A;  2L8T A;  4X8W A;  2KHX A;  1HNZ E;  2B7T A;  4M30 A;  2LJH A;  5IT9 C;  1FKA E;  4DV4 E;  3J7A G;  4GKJ E;  4LFB E;  1DI2 A;  4OX9 E;  4B3S E;  2B3T B;  2V87 A;  1PKP A;  4JI1 E;  1HR0 E;  1WHQ A;  5ADZ A;  4WPY A;  1EKZ A;  4BS9 A;  3HTX A;  1GZ6 A;  1GQE A;  2L3J A;  2ZM6 E;  2FGG A;  4DR2 E;  2JWO A;  2F4V E;  1IBM E;  2HHH E;  2V83 A;  5DNY A;  5FLX C;  4JI2 E;  4WFT A;  3OML A;  4X66 E;  3FIG A;  1XNQ E;  3JTZ A;  2NUF A;  4M2Z A;  4LFA E;  5AAS A;  4JYA E;  4DUZ E;  4DR1 E;  4X64 E;  2YZT A;  4J8Z A;  2KON A;  5T6J A;  2LBS B;  5BR8 E;  1N36 E;  4OOG C;  4LF4 E;  2JY9 A;  2YT4 A;  4DV3 E;  1HNX E;  1QU6 A;  3F6G A;  4R03 A;  4JI7 E;  3ZOQ B;  2L6M A;  4L8N A;  1N32 E;  3ADL A;  2EWL A;  3JU0 A;  4LF7 E;  4JV5 E;  4F9B B;  4KZS A;  4Q28 A;  4LF6 E;  5LMU E;  2UUC E;  2FV4 B;  4NXM E;  4M0V A;  3LLH A;  3OTO E;  1T4L B;  1RC7 A;  4JI5 E;  3ADG A;  2NUG A;  2UXB E;  2DSY A;  2NA2 A;  2N3H A;  2MC5 A;  2V89 A;  3LML A;  3VK6 A;  4DV2 E;  2G7H A;  4JI3 E;  2KOU A;  1XNR E;  2FTX B;  1J5E E;  2M1S A;  2L2K B;  1YYO A;  4R8O A;  3KWR A;  1XMQ E;  3H09 A;  3VYY A;  2IHR 1;  4TUG A;  4DR4 E;  2LE2 A;  3C4B A;  4X65 E;  2K4V A;  2E1M A;  2JOX A;  1STU A;  2VQE E;  1DQ3 A;  2B7V A;  2LTS A;  5AE1 A;  3J7Y p;  3RMP A;  5A2Q C;  3AUZ A;  2L3C A;  2L2N A;  3T1H E;  1X49 A;  3AV0 A;  1UHZ A;  1T4O A;  3IWB A;  4P78 A;  4GKK E;  5LMN E;  2RS6 A;  3T1Y E;  4DR6 E;  2NUE A;  2UXC E;  2L33 A;  3K6Q A;  4DV0 E;  1I94 E;  4LFC E;  3VYX A;  4BMJ A;  1SR9 A;  2V88 A;  2VF1 A;  4LF5 E;  2MC6 A;  2VQF E;  4B3R E;  3MSW A;  2DIX A;  4WYQ B;  5AE2 A;  3HXL A;  4BCA A;  4BBY A;  4JI6 E;  1T4N A;  2M4I A;  4DR7 E;  2F8B A;  2E5L E;  3C4T A;  4DV5 E;  3J80 C;  5AE3 A;  4B3T E;  4L5N C;  3HQ1 A;  2H36 X;  1O0W A;  3J81 C;  2MDR A;  4DV7 E;  4DR3 E;  3HPS A;  3F6H A;  5IWA E;  1N34 E;  4F54 A;  4JI4 E;  2LRS A;  4LF8 E;  4F9A B;  4NXN E;  2B9D A;  1X47 A;  5LL6 R;  2DB2 A;  3IWD A;  2M7Q A;  1YZ9 A;  3IWC A;  1YYK A;  1X48 A;  4AQY E;  2JVA A;  4K0K E;  4BC9 A;  2ODR D;  2RS7 A;  1ZBQ A;  3DJW A;  4P7D A;  2UUA E;  2V86 A;  4I8O A;  5CFF E;  4DMI A;  3HPZ A;  4JI8 E;  2RTX A;  4YY3 E;  1IBL E;  1N33 E;  2V85 A;  4LU9 A;  4DV1 E;  3DF6 A;  2ODR C;  3P1X A;  2LUP B;  2V8Q B;  4YHH E;  4TUI A;  2L2M A;  4X62 E;  2VE7 C;  3ADJ A;  1ZBT A;  3JAM C;  2L92 A;  1XMO E;  2JR1 A;  1FJG E;  2LTR A;  2CPN A;  4WSP A;  2LUQ A;  2N3G A;  1IBK E;  2UUB E;  1YYW A;  2DMY A;  3ADI A;  4GEQ B;  4DV6 E;  2EZ6 A;  2JOB A;  1WHN A;  2UXD E;  4DUY E;  4JI0 E;  2UU9 E;  4LTY A;  4LF9 E;  4DR5 E;  1WXR A;  5F3W A;  2LMZ A;  2WZO A;  2RSM A;  4BC7 A;  4DKK A;  4KHP E;  4B3M E;  4F9C B;  1HNW E;  1J26 A;  1UIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...