3DJWA

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
DTHEFHKLLIKVVDLFLEDRIKEFELKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAIKKLFVEYVRQPEFKYTVLSIKGVNDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Viral protein, unknown function
molecule keywords ORF99
total genus 25
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3djwA00
3DJWA 2H36X 3DF6A
chains in the Genus database with same CATH superfamily
5LLQA 3KZZA 4ZYEA 3EPJA 3K6QA 1X6FA 4YHHE 4R2EA 2EPOA 3OMLA 4K0KE 2UXCE 1KJKA 3THNA 4N4RB 2EMGA 4DR1E 2B3TB 2VF1A 1UILA 5T6JA 2EOIA 2EE8A 4MLQA 4BS9A 3F6GA 3MHHC 3MHSC 1LLMC 3UK3C 2EMHA 2GPIA 5A69A 2L3CA 1YZ9A 4TUIA 3T1YE 1FKAE 2WBSA 2N8XA 2YZTA 2JR1A 5IXMB 3DF6A 2YTIA 4LTYA 1GZ6A 4O4KA 4R2AA 4IJDA 2NUFA 5A2QC 2LMZA 3EPHA 2RQLA 1UHZA 2R1FA 2MDGA 2YTEA 3ECRA 2VE7C 2LV2A 2EORA 3AV0A 4DV7E 2EOOA 4BMJA 3C6MA 1YUJA 2B7TA 2JXPA 2LBSB 2EN7A 1WXRA 4YY3E 1DQ3A 1ZBQA 2BB8A 2HJJA 1SR9A 3J7Yp 2E5LE 2NUGA 1QNTA 4NZVA 2EN1A 4R2SA 2EN2A 2L92A 2EOMA 4BCAA 3KWRA 4WYQB 4L8NA 5AE1A 1O0WA 2EMBA 2B9DA 4DV1E 2EM0A 1A1KA 4DUYE 2YSPA 3M99B 4RHBB 4R2QA 2L3JA 1DI2A 2EOFA 3JTZA 2EMWA 3J81C 4I8OA 1NEIA 2EN6A 3HPZA 2EM4A 4RH8A 1EH7A 4WFTA 2EPAA 1J5EE 2RS7A 2YT4A 4LFCE 2NABA 2YRHA 1WJPA 2EMYA 1TF6A 2EMAA 1YYKA 2WZOA 2YTPA 2NA2A 2V88A 2EL4A 1ZR9A 2CPNA 2EOJA 1A1GA 4JYAE 1BB8A 2L2MA 2EMCA 2YU8A 2LO3A 2EMFA 1YSAC 1YUIA 2I13A 2ZM6E 1I94E 1UBDC 2RPCA 2EPZA 2G7HA 2WBUA 4DV2E 2M7QA 4F2JC 2EPMX 2L2KB 4NHRA 2EM2A 3EPLA 1JK2A 2GHFA 2YTDA 5IT9C 2DB2A 4WSPA 3RMPA 4L5NC 3HQ1A 4DV5E 4JI1E 2VQEE 4LFBE 2EMKA 4DV4E 2RTXA 1EKZA 2YU5A 2EPNA 2N3HA 2K7IA 1X48A 2EN4A 3TQMA 2YTGA 4B3TE 4JI4E 3JAMC 4R2RA 4DR4E 2EPLX 4KZSA 5A6KA 4BC7A 2ENAA 2JPAA 2V87A 2PRTA 2EPXA 3C4BA 2UXBE 4BHBA 4B3ME 2EJ4A 3IWCA 2ENCA 2KONA 2E72A 5CFFE 2L2NA 1N3GA 1T38A 2EL6A 4F6NA 2UUAE 2FV4B 4FK5C 4KWYA 2V83A 2H36X 1WHNA 4LF7E 2ENHA 2EN8A 2CT1A 4WX9A 4WXDA 2DGCA 1EH6A 2JVAA 1XMOE 1PDAA 4DKKA 1P47A 1X3CA 2ADRA 5A6BA 2EMLA 2J7JA 2UUBE 1IQSA 4F6MA 4JI2E 1B69A 3L00A 2CTDA 2KOUA 2WBTA 4F9CB 2DLKA 1ZAAC 4GZNC 2MC5A 2MDRA 1GQEA 3DJWA 5IV8B 2EM8A 5KL3A 2A25A 2IHR1 2DMIA 1EH8A 2CSHA 3HXLA 1XNRE 3HTXA 2EOSA 2JY9A 4ZYDA 2EPPA 2V89A 2HHHE 4WSGA 4O24A 5A6JA 4LF6E 1AH5A 4HEIA 1PKPA 2EM9A 2M4IA 5KL7A 1GTKA 2N3GA 3ADGA 4AQYE 2Q8UA 2L33A 1X6EA 3QG5C 2DLQA 4WXCA 2LT7A 2FGGA 4X9JA 5F3WA 4LFAE 2LJHA 2DMYA 4BBYA 5KL2A 2V85A 1IBME 3HPSA 1Z1BA 4R2PA 2EN3A 5DNYA 1IMUA 2EM3A 2MC6A 4R8OA 3H09A 1ZU1A 5A6AA 1XMQE 2EP3A 2LRSA 4TUGA 1X49A 2EM5A 4DR5E 2DRPA 3BF2A 2ODRD 1F2IG 3BIDA 4Q28A 2YPNA 1FJGE 2JOXA 1IQOA 5ADZA 2VQFE 4GKJE 4KHPE 4R03A 2JOBA 2EOYA 2DIXA 2ELZA 1RC7A 1UN6B 1T4NA 2HGHA 4B3RE 2GLIA 2M1SA 2LJUA 1T4LB 2UU9E 1YYWA 4DUZE 2EMXA 2EPCA 4DV3E 4LF4E 4BC9A 4JI6E 2EM6A 1MGTA 1PJQA 4X62E 3IWBA 4B3SE 2V8QB 5AASA 1X47A 2K4VA 2MKDA 2EOQA 4Q35B 2LVHA 4LF9E 4WPYA 2YRKA 1ZBTA 2YTOA 1AAYA 4NXNE 2JYAA 2V86A 2RS6A 1YYOA 4F9AB 4JI3E 1WHQA 4GKKE 1XNQE 1NCSA 2FTXB 5LMUE 2L8TA 2F8BA 4BHCA 4F9BB 1N36E 4M30A 4LF5E 1BBGA 2YTJA 2EZ6A 4M0VA 5IWAE 3BBGA 1T39A 2R76A 2EMIA 4OX9E 4HTGA 1J26A 3ZOQB 2F4VE 3LMLA 3BGHA 4JI5E 1QU6A 5KL6A 3LLHA 2EOZA 1WRJA 1A1HA 2ELYA 4M2ZA 3KZYA 1T4OA 2YRMA 2HC5A 4R2CA 4JI8E 1STUA 3F6HA 5TSEA 2MKNA 1X5WA 4JV5E 1KYQA 1N32E 2LUQA 2EOHA 1HNWE 4M9VC 3ADJA 3VK6A 1DGCA 2EQ3A 1MEYC 2LTSA 5AE2A 4ZYGA 2E1MA 4DMIA 2YTFA 5LL6R 1IBLE 1A1LA 3EQ1A 3ADIA 3THOB 2LTRA 3C4TA 1G2DC 4X66E 4DR3E 1X6HA 2JWOA 4DR7E 2BBGA 4GEQB 3P1XA 1TF3A 2EQ0A 1A1FA 2DSYA 4JI0E 2LUPB 1RQ0A 2UXDE 2JP9A 2M9AA 2YTQA 2B7VA 4P7DA 2KHXA 2D9HA 2UUCE 2YWQA 4IS1C 3IWDA 3J80C 1HR0E 3ADLA 2EM7A 3J7AG 1N33E 2ODRC 1RMDA 3AUZA 2LE2A 1PJTA 3C6KA 5AE3A 2WCC3 5BR8E 3OTOE 4O43A 1HNZE 1TN9A 3VHTB 3MSWA 1YPNA 2EOXA 4JI7E 2EOEA 2EPKX 2EL5A 4DV0E 4LF8E 1A1JA 4DV6E 2RSIA 4J8ZA 4X65E 3EPKA 1YFHA 2EPRA 1G2FC 4LU9A 1IBKE 2EQ1A 4X8WA 2EMZA 5AC5A 5AC4A 5FLXC 3FIGA 4R2DA 4MLVA 1HNXE 3VYYA 2L6MA 4P78A 4NXME 1A1IA 4O5GA 5LMNE 4ZYHA 1BBOA 1SFEA 1JK1A 2EPUA 4X64E 2RSMA 2VRDA 3JU0A 5KL5A 1N34E 5A6BD 3T1HE 5KL4A 4OOGC 2YSOA 4DR2E 4F54A 2NUEA 2YTNA 1L4SA 3VYXA 2EWLA 2LCEA 4DR6E 2I9IA 1PJSA
chains in the Genus database with same CATH topology
3F6HA 2M4IA 2CPNA 2N3GA 4JV5E 3ADGA 4AQYE 4JYAE 2L2MA 1N32E 2L33A 2LUQA 1HNWE 3ADJA 3VK6A 2FGGA 3K6QA 5F3WA 2LTSA 4LFAE 2LJHA 2DMYA 4BBYA 2E1MA 4DMIA 5AE2A 4YHHE 2ZM6E 2V85A 1I94E 3HPSA 1IBME 5LL6R 2G7HA 3OMLA 4DV2E 1IBLE 2M7QA 5DNYA 4K0KE 3ADIA 2L2KB 2LTRA 3C4TA 2UXCE 2MC6A 4R8OA 3H09A 2DB2A 4X66E 4DR3E 5IT9C 1XMQE 2LRSA 4WSPA 4TUGA 1X49A 4DR1E 3RMPA 4DR5E 2B3TB 2VF1A 1UILA 3HQ1A 4L5NC 2JWOA 5T6JA 4BS9A 2ODRD 3F6GA 4DV5E 4DR7E 4GEQB 4Q28A 3P1XA 4JI1E 2VQEE 1YZ9A 2L3CA 4LFBE 1FJGE 4TUIA 2JOXA 4DV4E 2RTXA 5ADZA 2VQFE 3T1YE 1EKZA 1FKAE 4GKJE 4KHPE 2DSYA 4JI0E 2LUPB 4R03A 2JOBA 1RQ0A 2N3HA 2UXDE 2YZTA 2JR1A 1X48A 2DIXA 1RC7A 3DF6A 4LTYA 2B7VA 4B3TE 1GZ6A 1T4NA 4P7DA 3JAMC 4JI4E 4B3RE 4DR4E 2M1SA 2NUFA 5A2QC 1T4LB 2LMZA 4KZSA 2UU9E 1YYWA 2KHXA 4BC7A 4DUZE 2UUCE 2V87A 4DV3E 3C4BA 4LF4E 1UHZA 4BC9A 2UXBE 3IWDA 4JI6E 4B3ME 2VE7C 4X62E 3IWCA 3J80C 1HR0E 2KONA 5CFFE 3AV0A 2L2NA 4DV7E 3IWBA 3ADLA 4BMJA 3J7AG 4B3SE 1N33E 2B7TA 2ODRC 2V8QB 3AUZA 2LE2A 2UUAE 2FV4B 5AE3A 5AASA 2LBSB 1X47A 2K4VA 2V83A 2H36X 1WXRA 1WHNA 1DQ3A 1ZBQA 5BR8E 4YY3E 1SR9A 3OTOE 4LF7E 3J7Yp 1HNZE 2E5LE 2JVAA 3MSWA 1XMOE 4LF9E 4WPYA 2NUGA 1ZBTA 4JI7E 4NXNE 2L92A 2V86A 4DV0E 4BCAA 4LF8E 3KWRA 2RS6A 1YYOA 4WYQB 4L8NA 4DKKA 5AE1A 4J8ZA 4DV6E 4F9AB 1O0WA 4X65E 2B9DA 4DV1E 4JI3E 1WHQA 4GKKE 4DUYE 4LU9A 2UUBE 4JI2E 1XNQE 1IBKE 4X8WA 2KOUA 2FTXB 4F9CB 2L3JA 1DI2A 5LMUE 2L8TA 2F8BA 2MC5A 4F9BB 3JTZA 2MDRA 4M30A 1N36E 1GQEA 5FLXC 3DJWA 3FIGA 4LF5E 3J81C 4I8OA 1HNXE 2EZ6A 3VYYA 2L6MA 4M0VA 4P78A 4NXME 2IHR1 3HPZA 5IWAE 5LMNE 4WFTA 4X64E 2RSMA 3HXLA 4OX9E 1XNRE 1J5EE 3JU0A 3HTXA 1J26A 3ZOQB 2RS7A 1N34E 2JY9A 2F4VE 3LMLA 3T1HE 2HHHE 2V89A 2YT4A 4OOGC 4DR2E 4JI5E 1QU6A 4F54A 3LLHA 4LFCE 2NUEA 3VYXA 2EWLA 4LF6E 4DR6E 4M2ZA 1YYKA 1T4OA 2WZOA 1PKPA 4JI8E 2NA2A 2V88A 1STUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJW A;  2H36 X;  3DF6 A; 
#chains in the Genus database with same CATH topology
 5LLQ A;  3KZZ A;  4ZYE A;  3EPJ A;  3K6Q A;  1X6F A;  4YHH E;  4R2E A;  2EPO A;  3OML A;  4K0K E;  2UXC E;  1KJK A;  3THN A;  4N4R B;  2EMG A;  4DR1 E;  2B3T B;  2VF1 A;  1UIL A;  5T6J A;  2EOI A;  2EE8 A;  4MLQ A;  4BS9 A;  3F6G A;  3MHH C;  3MHS C;  1LLM C;  3UK3 C;  2EMH A;  2GPI A;  5A69 A;  2L3C A;  1YZ9 A;  4TUI A;  3T1Y E;  1FKA E;  2WBS A;  2N8X A;  2YZT A;  2JR1 A;  5IXM B;  3DF6 A;  2YTI A;  4LTY A;  1GZ6 A;  4O4K A;  4R2A A;  4IJD A;  2NUF A;  5A2Q C;  2LMZ A;  3EPH A;  2RQL A;  1UHZ A;  2R1F A;  2MDG A;  2YTE A;  3ECR A;  2VE7 C;  2LV2 A;  2EOR A;  3AV0 A;  4DV7 E;  2EOO A;  4BMJ A;  3C6M A;  1YUJ A;  2B7T A;  2JXP A;  2LBS B;  2EN7 A;  1WXR A;  4YY3 E;  1DQ3 A;  1ZBQ A;  2BB8 A;  2HJJ A;  1SR9 A;  3J7Y p;  2E5L E;  2NUG A;  1QNT A;  4NZV A;  2EN1 A;  4R2S A;  2EN2 A;  2L92 A;  2EOM A;  4BCA A;  3KWR A;  4WYQ B;  4L8N A;  5AE1 A;  1O0W A;  2EMB A;  2B9D A;  4DV1 E;  2EM0 A;  1A1K A;  4DUY E;  2YSP A;  3M99 B;  4RHB B;  4R2Q A;  2L3J A;  1DI2 A;  2EOF A;  3JTZ A;  2EMW A;  3J81 C;  4I8O A;  1NEI A;  2EN6 A;  3HPZ A;  2EM4 A;  4RH8 A;  1EH7 A;  4WFT A;  2EPA A;  1J5E E;  2RS7 A;  2YT4 A;  4LFC E;  2NAB A;  2YRH A;  1WJP A;  2EMY A;  1TF6 A;  2EMA A;  1YYK A;  2WZO A;  2YTP A;  2NA2 A;  2V88 A;  2EL4 A;  1ZR9 A;  2CPN A;  2EOJ A;  1A1G A;  4JYA E;  1BB8 A;  2L2M A;  2EMC A;  2YU8 A;  2LO3 A;  2EMF A;  1YSA C;  1YUI A;  2I13 A;  2ZM6 E;  1I94 E;  1UBD C;  2RPC A;  2EPZ A;  2G7H A;  2WBU A;  4DV2 E;  2M7Q A;  4F2J C;  2EPM X;  2L2K B;  4NHR A;  2EM2 A;  3EPL A;  1JK2 A;  2GHF A;  2YTD A;  5IT9 C;  2DB2 A;  4WSP A;  3RMP A;  4L5N C;  3HQ1 A;  4DV5 E;  4JI1 E;  2VQE E;  4LFB E;  2EMK A;  4DV4 E;  2RTX A;  1EKZ A;  2YU5 A;  2EPN A;  2N3H A;  2K7I A;  1X48 A;  2EN4 A;  3TQM A;  2YTG A;  4B3T E;  4JI4 E;  3JAM C;  4R2R A;  4DR4 E;  2EPL X;  4KZS A;  5A6K A;  4BC7 A;  2ENA A;  2JPA A;  2V87 A;  2PRT A;  2EPX A;  3C4B A;  2UXB E;  4BHB A;  4B3M E;  2EJ4 A;  3IWC A;  2ENC A;  2KON A;  2E72 A;  5CFF E;  2L2N A;  1N3G A;  1T38 A;  2EL6 A;  4F6N A;  2UUA E;  2FV4 B;  4FK5 C;  4KWY A;  2V83 A;  2H36 X;  1WHN A;  4LF7 E;  2ENH A;  2EN8 A;  2CT1 A;  4WX9 A;  4WXD A;  2DGC A;  1EH6 A;  2JVA A;  1XMO E;  1PDA A;  4DKK A;  1P47 A;  1X3C A;  2ADR A;  5A6B A;  2EML A;  2J7J A;  2UUB E;  1IQS A;  4F6M A;  4JI2 E;  1B69 A;  3L00 A;  2CTD A;  2KOU A;  2WBT A;  4F9C B;  2DLK A;  1ZAA C;  4GZN C;  2MC5 A;  2MDR A;  1GQE A;  3DJW A;  5IV8 B;  2EM8 A;  5KL3 A;  2A25 A;  2IHR 1;  2DMI A;  1EH8 A;  2CSH A;  3HXL A;  1XNR E;  3HTX A;  2EOS A;  2JY9 A;  4ZYD A;  2EPP A;  2V89 A;  2HHH E;  4WSG A;  4O24 A;  5A6J A;  4LF6 E;  1AH5 A;  4HEI A;  1PKP A;  2EM9 A;  2M4I A;  5KL7 A;  1GTK A;  2N3G A;  3ADG A;  4AQY E;  2Q8U A;  2L33 A;  1X6E A;  3QG5 C;  2DLQ A;  4WXC A;  2LT7 A;  2FGG A;  4X9J A;  5F3W A;  4LFA E;  2LJH A;  2DMY A;  4BBY A;  5KL2 A;  2V85 A;  1IBM E;  3HPS A;  1Z1B A;  4R2P A;  2EN3 A;  5DNY A;  1IMU A;  2EM3 A;  2MC6 A;  4R8O A;  3H09 A;  1ZU1 A;  5A6A A;  1XMQ E;  2EP3 A;  2LRS A;  4TUG A;  1X49 A;  2EM5 A;  4DR5 E;  2DRP A;  3BF2 A;  2ODR D;  1F2I G;  3BID A;  4Q28 A;  2YPN A;  1FJG E;  2JOX A;  1IQO A;  5ADZ A;  2VQF E;  4GKJ E;  4KHP E;  4R03 A;  2JOB A;  2EOY A;  2DIX A;  2ELZ A;  1RC7 A;  1UN6 B;  1T4N A;  2HGH A;  4B3R E;  2GLI A;  2M1S A;  2LJU A;  1T4L B;  2UU9 E;  1YYW A;  4DUZ E;  2EMX A;  2EPC A;  4DV3 E;  4LF4 E;  4BC9 A;  4JI6 E;  2EM6 A;  1MGT A;  1PJQ A;  4X62 E;  3IWB A;  4B3S E;  2V8Q B;  5AAS A;  1X47 A;  2K4V A;  2MKD A;  2EOQ A;  4Q35 B;  2LVH A;  4LF9 E;  4WPY A;  2YRK A;  1ZBT A;  2YTO A;  1AAY A;  4NXN E;  2JYA A;  2V86 A;  2RS6 A;  1YYO A;  4F9A B;  4JI3 E;  1WHQ A;  4GKK E;  1XNQ E;  1NCS A;  2FTX B;  5LMU E;  2L8T A;  2F8B A;  4BHC A;  4F9B B;  1N36 E;  4M30 A;  4LF5 E;  1BBG A;  2YTJ A;  2EZ6 A;  4M0V A;  5IWA E;  3BBG A;  1T39 A;  2R76 A;  2EMI A;  4OX9 E;  4HTG A;  1J26 A;  3ZOQ B;  2F4V E;  3LML A;  3BGH A;  4JI5 E;  1QU6 A;  5KL6 A;  3LLH A;  2EOZ A;  1WRJ A;  1A1H A;  2ELY A;  4M2Z A;  3KZY A;  1T4O A;  2YRM A;  2HC5 A;  4R2C A;  4JI8 E;  1STU A;  3F6H A;  5TSE A;  2MKN A;  1X5W A;  4JV5 E;  1KYQ A;  1N32 E;  2LUQ A;  2EOH A;  1HNW E;  4M9V C;  3ADJ A;  3VK6 A;  1DGC A;  2EQ3 A;  1MEY C;  2LTS A;  5AE2 A;  4ZYG A;  2E1M A;  4DMI A;  2YTF A;  5LL6 R;  1IBL E;  1A1L A;  3EQ1 A;  3ADI A;  3THO B;  2LTR A;  3C4T A;  1G2D C;  4X66 E;  4DR3 E;  1X6H A;  2JWO A;  4DR7 E;  2BBG A;  4GEQ B;  3P1X A;  1TF3 A;  2EQ0 A;  1A1F A;  2DSY A;  4JI0 E;  2LUP B;  1RQ0 A;  2UXD E;  2JP9 A;  2M9A A;  2YTQ A;  2B7V A;  4P7D A;  2KHX A;  2D9H A;  2UUC E;  2YWQ A;  4IS1 C;  3IWD A;  3J80 C;  1HR0 E;  3ADL A;  2EM7 A;  3J7A G;  1N33 E;  2ODR C;  1RMD A;  3AUZ A;  2LE2 A;  1PJT A;  3C6K A;  5AE3 A;  2WCC 3;  5BR8 E;  3OTO E;  4O43 A;  1HNZ E;  1TN9 A;  3VHT B;  3MSW A;  1YPN A;  2EOX A;  4JI7 E;  2EOE A;  2EPK X;  2EL5 A;  4DV0 E;  4LF8 E;  1A1J A;  4DV6 E;  2RSI A;  4J8Z A;  4X65 E;  3EPK A;  1YFH A;  2EPR A;  1G2F C;  4LU9 A;  1IBK E;  2EQ1 A;  4X8W A;  2EMZ A;  5AC5 A;  5AC4 A;  5FLX C;  3FIG A;  4R2D A;  4MLV A;  1HNX E;  3VYY A;  2L6M A;  4P78 A;  4NXM E;  1A1I A;  4O5G A;  5LMN E;  4ZYH A;  1BBO A;  1SFE A;  1JK1 A;  2EPU A;  4X64 E;  2RSM A;  2VRD A;  3JU0 A;  5KL5 A;  1N34 E;  5A6B D;  3T1H E;  5KL4 A;  4OOG C;  2YSO A;  4DR2 E;  4F54 A;  2NUE A;  2YTN A;  1L4S A;  3VYX A;  2EWL A;  2LCE A;  4DR6 E;  2I9I A;  1PJS A; 
#chains in the Genus database with same CATH homology
 3F6H A;  2M4I A;  2CPN A;  2N3G A;  4JV5 E;  3ADG A;  4AQY E;  4JYA E;  2L2M A;  1N32 E;  2L33 A;  2LUQ A;  1HNW E;  3ADJ A;  3VK6 A;  2FGG A;  3K6Q A;  5F3W A;  2LTS A;  4LFA E;  2LJH A;  2DMY A;  4BBY A;  2E1M A;  4DMI A;  5AE2 A;  4YHH E;  2ZM6 E;  2V85 A;  1I94 E;  3HPS A;  1IBM E;  5LL6 R;  2G7H A;  3OML A;  4DV2 E;  1IBL E;  2M7Q A;  5DNY A;  4K0K E;  3ADI A;  2L2K B;  2LTR A;  3C4T A;  2UXC E;  2MC6 A;  4R8O A;  3H09 A;  2DB2 A;  4X66 E;  4DR3 E;  5IT9 C;  1XMQ E;  2LRS A;  4WSP A;  4TUG A;  1X49 A;  4DR1 E;  3RMP A;  4DR5 E;  2B3T B;  2VF1 A;  1UIL A;  3HQ1 A;  4L5N C;  2JWO A;  5T6J A;  4BS9 A;  2ODR D;  3F6G A;  4DV5 E;  4DR7 E;  4GEQ B;  4Q28 A;  3P1X A;  4JI1 E;  2VQE E;  1YZ9 A;  2L3C A;  4LFB E;  1FJG E;  4TUI A;  2JOX A;  4DV4 E;  2RTX A;  5ADZ A;  2VQF E;  3T1Y E;  1EKZ A;  1FKA E;  4GKJ E;  4KHP E;  2DSY A;  4JI0 E;  2LUP B;  4R03 A;  2JOB A;  1RQ0 A;  2N3H A;  2UXD E;  2YZT A;  2JR1 A;  1X48 A;  2DIX A;  1RC7 A;  3DF6 A;  4LTY A;  2B7V A;  4B3T E;  1GZ6 A;  1T4N A;  4P7D A;  3JAM C;  4JI4 E;  4B3R E;  4DR4 E;  2M1S A;  2NUF A;  5A2Q C;  1T4L B;  2LMZ A;  4KZS A;  2UU9 E;  1YYW A;  2KHX A;  4BC7 A;  4DUZ E;  2UUC E;  2V87 A;  4DV3 E;  3C4B A;  4LF4 E;  1UHZ A;  4BC9 A;  2UXB E;  3IWD A;  4JI6 E;  4B3M E;  2VE7 C;  4X62 E;  3IWC A;  3J80 C;  1HR0 E;  2KON A;  5CFF E;  3AV0 A;  2L2N A;  4DV7 E;  3IWB A;  3ADL A;  4BMJ A;  3J7A G;  4B3S E;  1N33 E;  2B7T A;  2ODR C;  2V8Q B;  3AUZ A;  2LE2 A;  2UUA E;  2FV4 B;  5AE3 A;  5AAS A;  2LBS B;  1X47 A;  2K4V A;  2V83 A;  2H36 X;  1WXR A;  1WHN A;  1DQ3 A;  1ZBQ A;  5BR8 E;  4YY3 E;  1SR9 A;  3OTO E;  4LF7 E;  3J7Y p;  1HNZ E;  2E5L E;  2JVA A;  3MSW A;  1XMO E;  4LF9 E;  4WPY A;  2NUG A;  1ZBT A;  4JI7 E;  4NXN E;  2L92 A;  2V86 A;  4DV0 E;  4BCA A;  4LF8 E;  3KWR A;  2RS6 A;  1YYO A;  4WYQ B;  4L8N A;  4DKK A;  5AE1 A;  4J8Z A;  4DV6 E;  4F9A B;  1O0W A;  4X65 E;  2B9D A;  4DV1 E;  4JI3 E;  1WHQ A;  4GKK E;  4DUY E;  4LU9 A;  2UUB E;  4JI2 E;  1XNQ E;  1IBK E;  4X8W A;  2KOU A;  2FTX B;  4F9C B;  2L3J A;  1DI2 A;  5LMU E;  2L8T A;  2F8B A;  2MC5 A;  4F9B B;  3JTZ A;  2MDR A;  4M30 A;  1N36 E;  1GQE A;  5FLX C;  3DJW A;  3FIG A;  4LF5 E;  3J81 C;  4I8O A;  1HNX E;  2EZ6 A;  3VYY A;  2L6M A;  4M0V A;  4P78 A;  4NXM E;  2IHR 1;  3HPZ A;  5IWA E;  5LMN E;  4WFT A;  4X64 E;  2RSM A;  3HXL A;  4OX9 E;  1XNR E;  1J5E E;  3JU0 A;  3HTX A;  1J26 A;  3ZOQ B;  2RS7 A;  1N34 E;  2JY9 A;  2F4V E;  3LML A;  3T1H E;  2HHH E;  2V89 A;  2YT4 A;  4OOG C;  4DR2 E;  4JI5 E;  1QU6 A;  4F54 A;  3LLH A;  4LFC E;  2NUE A;  3VYX A;  2EWL A;  4LF6 E;  4DR6 E;  4M2Z A;  1YYK A;  1T4O A;  2WZO A;  1PKP A;  4JI8 E;  2NA2 A;  2V88 A;  1STU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...