3DJWA

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
DTHEFHKLLIKVVDLFLEDRIKEFELKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAIKKLFVEYVRQPEFKYTVLSIKGVNDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, unknown function
molecule keywords ORF99
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
total genus 25
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3djwA00
3DJWA 3DF6A 2H36X
chains in the Genus database with same CATH superfamily
2JXPA 2EMYA 2VF1A 1PJTA 1N36E 3HTXA 2D9HA 1EH8A 4JI0E 4GKKE 1A1IA 4JI4E 1O0WA 3ADGA 2EM7A 3RMPA 2K4VA 3MHSC 2GLIA 1A1HA 2LO3A 3L00A 2L2NA 4OX9E 2EMAA 2B3TB 2EJ4A 3THOB 4GEQB 1IMUA 5A6KA 2RQLA 2L8TA 4B3SE 2YTEA 2EWLA 2ELYA 2YTPA 2EPOA 3JTZA 1T4NA 2RSMA 4M30A 5A6AA 2WCC3 2WZOA 4R2AA 2EMGA 5IXMB 2ENCA 2KOUA 5AC5A 1HR0E 1WHQA 3LLHA 5A69A 1BBOA 4JI7E 4WFTA 2EN7A 2HGHA 2EMCA 3ADIA 2EL5A 2EQ1A 5IWAE 5AASA 2HJJA 4X62E 4GZNC 2EMBA 1A1KA 4X64E 2CT1A 4BC7A 2B7TA 2WBUA 1QU6A 2EM3A 4LFCE 3VYXA 4ZYHA 1AH5A 5DNYA 1UILA 3J80C 4O24A 2F4VE 1MGTA 1GTKA 4DR6E 4BMJA 2EOXA 2LJHA 4JI8E 2CPNA 3MHHC 4JV5E 1G2FC 2N3HA 2V87A 1XNRE 5LLQA 2F8BA 2G7HA 2HC5A 1A1JA 2PRTA 1N33E 1STUA 4KZSA 1BB8A 1WHNA 1UN6B 2JPAA 4DV7E 1YFHA 1X6EA 1X6HA 2M4IA 2RPCA 2JYAA 2RTXA 5LMNE 3AUZA 2YU5A 1DGCA 4JI2E 5A6BA 2YRKA 2EPUA 1X3CA 2LVHA 3KWRA 2EN4A 4L5NC 1YYWA 4FK5C 2EM8A 4LFBE 1I94E 2DLKA 2BB8A 4M0VA 3J7Yp 2DLQA 2UUCE 2UUAE 1KJKA 3HXLA 3AV0A 2NUEA 3BIDA 4J8ZA 4X65E 4F2JC 3ZOQB 2JWOA 2EOHA 1YPNA 1A1GA 2FGGA 2V83A 4WPYA 5KL5A 4X8WA 2EOEA 4DR1E 2EMHA 2EMXA 4X9JA 4HTGA 4R2PA 1T4OA 1AAYA 2FV4B 4KWYA 1YYOA 2EN6A 4JI5E 2EPPA 2EOIA 2B9DA 5ADZA 3THNA 4MLVA 2YTQA 1WXRA 4DR5E 3JAMC 4WSGA 2LTRA 2YTGA 2FTXB 3BGHA 2EOSA 2YTFA 4R2DA 2MKNA 2YRMA 3J7AG 4R2RA 4DKKA 5KL6A 2EM0A 1N32E 4RH8A 3C6MA 4F6NA 1B69A 2L2MA 4R2SA 4M2ZA 4AQYE 4NXME 4DUYE 3EPHA 1P47A 4TUIA 3ADLA 2DRPA 3BF2A 3TQMA 2LT7A 2ENAA 2ZM6E 1EH6A 5KL2A 1EH7A 2EN2A 4LF8E 1MEYC 4WX9A 2VQEE 1SFEA 2K7IA 2L3JA 2GPIA 4LU9A 4P7DA 4RHBB 2NUFA 4X66E 2R1FA 3ECRA 1LLMC 3QG5C 4P78A 1UHZA 2EMWA 1RMDA 2LBSB 2EMLA 3F6HA 1IQOA 4LFAE 1X48A 1JK2A 2M9AA 2VRDA 2YZTA 1SR9A 4BBYA 5AE1A 2EOJA 4NXNE 3JU0A 2E1MA 1PKPA 3C4BA 4YHHE 2UUBE 2JVAA 1N3GA 5F3WA 3VYYA 1HNZE 2NUGA 2LCEA 4BCAA 4K0KE 2EMFA 2IHR1 3J81C 2YTOA 1UBDC 2LE2A 4F9CB 4F6MA 1TF6A 2JR1A 4BS9A 4NZVA 3DF6A 4R2CA 4R2EA 5A2QC 1T38A 2EPCA 2MDRA 4KHPE 2BBGA 2EM9A 2EP3A 2YPNA 5A6BD 1ZBTA 4DR2E 2LRSA 3C4TA 2YRHA 4DV4E 2EOOA 1ZU1A 2YTNA 1XMOE 4WXDA 3IWDA 2V88A 2L6MA 4JI3E 1GQEA 5IT9C 2M7QA 4I8OA 2EM5A 2EN1A 1IQSA 1NEIA 2MC6A 2YSPA 4ZYDA 5AE3A 3OMLA 3VK6A 2ENHA 1HNWE 2LMZA 1IBME 4DV0E 5T6JA 5TSEA 2KONA 3HQ1A 2EORA 2KHXA 4F54A 2EZ6A 4O43A 4LF7E 2EPMX 2ELZA 1HNXE 2UU9E 5IV8B 4O5GA 5FLXC 4F9BB 3T1YE 2E72A 3K6QA 1QNTA 2EPNA 2DSYA 2I13A 3KZZA 5KL7A 1A1FA 1X49A 2YSOA 2DB2A 2B7VA 2L33A 1N34E 2DIXA 2WBTA 1BBGA 2DMYA 4LTYA 1ZAAC 3T1HE 4HEIA 3P1XA 5LMUE 1YSAC 2HHHE 2V8QB 4YY3E 2VE7C 2ODRC 5KL4A 2EN8A 2ADRA 1J26A 4R03A 2N8XA 2A25A 2EN3A 2LJUA 2YTIA 2R76A 2EE8A 2E5LE 2RS7A 2EOYA 4DV5E 2LUPB 4DMIA 1Z1BA 2GHFA 3LMLA 4F9AB 2H36X 2YT4A 2UXDE 2EMKA 4BHCA 1RQ0A 2V85A 5CFFE 2JP9A 5AC4A 2CTDA 1PJSA 2DGCA 4Q35B 1YZ9A 2EPRA 5BR8E 1X5WA 2DMIA 2EPXA 5KL3A 3IWCA 2L2KB 3KZYA 5A6JA 2Q8UA 2EOFA 2UXCE 3IWBA 4JI1E 2M1SA 5LL6R 4DUZE 2L3CA 1T4LB 2MDGA 2EM2A 4DR4E 2MKDA 2EMZA 3EQ1A 1NCSA 1ZBQA 4WXCA 4MLQA 2VQFE 2EPAA 3F6GA 3VHTB 4DV2E 4DR3E 4R2QA 1DQ3A 2MC5A 4LF6E 1XNQE 1XMQE 1X47A 4O4KA 4B3ME 4JI6E 2YTJA 2NA2A 1A1LA 3EPLA 4DV3E 4B3RE 4JYAE 3EPKA 1WRJA 2EM6A 1F2IG 1PJQA 1TN9A 3H09A 2LV2A 4TUGA 1RC7A 5AE2A 1PDAA 1WJPA 2JY9A 4B3TE 2YU8A 4WSPA 3DJWA 1T39A 2EQ0A 1IBKE 1X6FA 1DI2A 2V89A 2EOQA 4ZYGA 1JK1A 1TF3A 4DV1E 2EOMA 2J7JA 3HPSA 1G2DC 3BBGA 4IJDA 2EPZA 2NABA 1L4SA 3FIGA 4GKJE 4M9VC 2YTDA 2EPKX 2EOZA 4ZYEA 1EKZA 2RSIA 3OTOE 2EL6A 4Q28A 2I9IA 3HPZA 4LF5E 4DR7E 3MSWA 2EL4A 3ADJA 1FJGE 2V86A 4L8NA 2JOXA 4WYQB 1GZ6A 2EMIA 2ODRD 4LF9E 2WBSA 4DV6E 2EM4A 1FKAE 3M99B 1YUIA 4LF4E 1KYQA 4N4RB 2L92A 1IBLE 4R8OA 4NHRA 2YWQA 2EPLX 2LUQA 2N3GA 4OOGC 3C6KA 2RS6A 4BC9A 2LTSA 3EPJA 1J5EE 4IS1C 1ZR9A 1YYKA 4BHBA 2EQ3A 2CSHA 1YUJA 2UXBE 3UK3C 2JOBA
chains in the Genus database with same CATH topology
2JR1A 2JWOA 3IWBA 4BS9A 2UXCE 2FGGA 2M1SA 2V83A 2VF1A 3DF6A 4WPYA 4X8WA 5LL6R 5A2QC 2L3CA 4DUZE 4DR1E 1T4LB 1N36E 2MDRA 3HTXA 4JI0E 4KHPE 4GKKE 4JI4E 1O0WA 1ZBTA 1T4OA 3ADGA 4DR2E 3RMPA 4DR4E 2LRSA 3C4TA 2K4VA 2L2NA 4DV4E 2FV4B 4OX9E 1XMOE 1YYOA 2B3TB 2L2KB 3IWDA 4GEQB 1ZBQA 2V88A 2L6MA 2VQFE 4JI3E 3F6GA 4JI5E 5ADZA 4DV2E 2B9DA 2L8TA 4DR3E 4B3SE 1GQEA 5IT9C 2EWLA 1DQ3A 2M7QA 4I8OA 1WXRA 4DR5E 2MC5A 3JAMC 4LF6E 2LTRA 2FTXB 3JTZA 2RSMA 1T4NA 4M30A 1XNQE 1XMQE 1X47A 4B3ME 3J7AG 2WZOA 2MC6A 4JI6E 5AE3A 2NA2A 2KOUA 3OMLA 3VK6A 4DKKA 1HNWE 2LMZA 1HR0E 1N32E 1WHQA 1IBME 4DV0E 3LLHA 5T6JA 4DV3E 4B3RE 2KONA 4JI7E 4JYAE 3HQ1A 4WFTA 4M2ZA 2KHXA 2L2MA 4F54A 2EZ6A 4AQYE 4LF7E 3H09A 1HNXE 3ADIA 4TUGA 1RC7A 2UU9E 5AE2A 4NXME 4DUYE 5IWAE 2JY9A 5FLXC 5AASA 4F9BB 3T1YE 4X62E 4TUIA 4B3TE 3ADLA 3K6QA 4WSPA 2DSYA 3DJWA 2ZM6E 4X64E 1X49A 4BC7A 2B7TA 2DB2A 1IBKE 2L33A 2B7VA 1QU6A 1DI2A 2V89A 1N34E 4LFCE 2DIXA 4LF8E 3VYXA 4DV1E 5DNYA 3J80C 1UILA 2DMYA 4LTYA 3HPSA 3T1HE 2F4VE 2VQEE 3P1XA 5LMUE 3FIGA 4DR6E 4GKJE 4BMJA 2LJHA 4JI8E 2CPNA 4JV5E 2HHHE 2L3JA 2N3HA 2V8QB 2V87A 4YY3E 4LU9A 1XNRE 2VE7C 4P7DA 1EKZA 2F8BA 2G7HA 2ODRC 4X66E 2NUFA 3OTOE 1J26A 1N33E 4Q28A 1STUA 4KZSA 3HPZA 4R03A 4LF5E 4P78A 4DR7E 1UHZA 1WHNA 3MSWA 3ADJA 2LBSB 4DV7E 3F6HA 1FJGE 2V86A 2M4IA 2RTXA 4LFAE 4L8NA 2JOXA 4WYQB 5LMNE 1X48A 3AUZA 1GZ6A 2ODRD 2YZTA 4JI2E 4LF9E 2E5LE 2RS7A 4DV6E 1SR9A 4BBYA 3KWRA 5AE1A 4DV5E 2LUPB 1FKAE 3JU0A 4L5NC 2E1MA 4LF4E 4NXNE 4JI1E 4DMIA 1PKPA 2L92A 1IBLE 3C4BA 4YHHE 1YYWA 4R8OA 3LMLA 4F9AB 2H36X 2YT4A 2LUQA 2UUBE 1I94E 4LFBE 2UXDE 2JVAA 2N3GA 4OOGC 5F3WA 3J7Yp 4M0VA 3VYYA 1HNZE 2NUGA 1RQ0A 2V85A 2RS6A 4BC9A 5CFFE 2UUCE 2UUAE 2LTSA 4BCAA 4K0KE 1YZ9A 2IHR1 1J5EE 3J81C 1YYKA 5BR8E 3HXLA 3AV0A 2NUEA 2LE2A 4F9CB 4J8ZA 4X65E 3IWCA 2UXBE 2JOBA 3ZOQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJW A;  3DF6 A;  2H36 X; 
#chains in the Genus database with same CATH topology
 2JXP A;  2EMY A;  2VF1 A;  1PJT A;  1N36 E;  3HTX A;  2D9H A;  1EH8 A;  4JI0 E;  4GKK E;  1A1I A;  4JI4 E;  1O0W A;  3ADG A;  2EM7 A;  3RMP A;  2K4V A;  3MHS C;  2GLI A;  1A1H A;  2LO3 A;  3L00 A;  2L2N A;  4OX9 E;  2EMA A;  2B3T B;  2EJ4 A;  3THO B;  4GEQ B;  1IMU A;  5A6K A;  2RQL A;  2L8T A;  4B3S E;  2YTE A;  2EWL A;  2ELY A;  2YTP A;  2EPO A;  3JTZ A;  1T4N A;  2RSM A;  4M30 A;  5A6A A;  2WCC 3;  2WZO A;  4R2A A;  2EMG A;  5IXM B;  2ENC A;  2KOU A;  5AC5 A;  1HR0 E;  1WHQ A;  3LLH A;  5A69 A;  1BBO A;  4JI7 E;  4WFT A;  2EN7 A;  2HGH A;  2EMC A;  3ADI A;  2EL5 A;  2EQ1 A;  5IWA E;  5AAS A;  2HJJ A;  4X62 E;  4GZN C;  2EMB A;  1A1K A;  4X64 E;  2CT1 A;  4BC7 A;  2B7T A;  2WBU A;  1QU6 A;  2EM3 A;  4LFC E;  3VYX A;  4ZYH A;  1AH5 A;  5DNY A;  1UIL A;  3J80 C;  4O24 A;  2F4V E;  1MGT A;  1GTK A;  4DR6 E;  4BMJ A;  2EOX A;  2LJH A;  4JI8 E;  2CPN A;  3MHH C;  4JV5 E;  1G2F C;  2N3H A;  2V87 A;  1XNR E;  5LLQ A;  2F8B A;  2G7H A;  2HC5 A;  1A1J A;  2PRT A;  1N33 E;  1STU A;  4KZS A;  1BB8 A;  1WHN A;  1UN6 B;  2JPA A;  4DV7 E;  1YFH A;  1X6E A;  1X6H A;  2M4I A;  2RPC A;  2JYA A;  2RTX A;  5LMN E;  3AUZ A;  2YU5 A;  1DGC A;  4JI2 E;  5A6B A;  2YRK A;  2EPU A;  1X3C A;  2LVH A;  3KWR A;  2EN4 A;  4L5N C;  1YYW A;  4FK5 C;  2EM8 A;  4LFB E;  1I94 E;  2DLK A;  2BB8 A;  4M0V A;  3J7Y p;  2DLQ A;  2UUC E;  2UUA E;  1KJK A;  3HXL A;  3AV0 A;  2NUE A;  3BID A;  4J8Z A;  4X65 E;  4F2J C;  3ZOQ B;  2JWO A;  2EOH A;  1YPN A;  1A1G A;  2FGG A;  2V83 A;  4WPY A;  5KL5 A;  4X8W A;  2EOE A;  4DR1 E;  2EMH A;  2EMX A;  4X9J A;  4HTG A;  4R2P A;  1T4O A;  1AAY A;  2FV4 B;  4KWY A;  1YYO A;  2EN6 A;  4JI5 E;  2EPP A;  2EOI A;  2B9D A;  5ADZ A;  3THN A;  4MLV A;  2YTQ A;  1WXR A;  4DR5 E;  3JAM C;  4WSG A;  2LTR A;  2YTG A;  2FTX B;  3BGH A;  2EOS A;  2YTF A;  4R2D A;  2MKN A;  2YRM A;  3J7A G;  4R2R A;  4DKK A;  5KL6 A;  2EM0 A;  1N32 E;  4RH8 A;  3C6M A;  4F6N A;  1B69 A;  2L2M A;  4R2S A;  4M2Z A;  4AQY E;  4NXM E;  4DUY E;  3EPH A;  1P47 A;  4TUI A;  3ADL A;  2DRP A;  3BF2 A;  3TQM A;  2LT7 A;  2ENA A;  2ZM6 E;  1EH6 A;  5KL2 A;  1EH7 A;  2EN2 A;  4LF8 E;  1MEY C;  4WX9 A;  2VQE E;  1SFE A;  2K7I A;  2L3J A;  2GPI A;  4LU9 A;  4P7D A;  4RHB B;  2NUF A;  4X66 E;  2R1F A;  3ECR A;  1LLM C;  3QG5 C;  4P78 A;  1UHZ A;  2EMW A;  1RMD A;  2LBS B;  2EML A;  3F6H A;  1IQO A;  4LFA E;  1X48 A;  1JK2 A;  2M9A A;  2VRD A;  2YZT A;  1SR9 A;  4BBY A;  5AE1 A;  2EOJ A;  4NXN E;  3JU0 A;  2E1M A;  1PKP A;  3C4B A;  4YHH E;  2UUB E;  2JVA A;  1N3G A;  5F3W A;  3VYY A;  1HNZ E;  2NUG A;  2LCE A;  4BCA A;  4K0K E;  2EMF A;  2IHR 1;  3J81 C;  2YTO A;  1UBD C;  2LE2 A;  4F9C B;  4F6M A;  1TF6 A;  2JR1 A;  4BS9 A;  4NZV A;  3DF6 A;  4R2C A;  4R2E A;  5A2Q C;  1T38 A;  2EPC A;  2MDR A;  4KHP E;  2BBG A;  2EM9 A;  2EP3 A;  2YPN A;  5A6B D;  1ZBT A;  4DR2 E;  2LRS A;  3C4T A;  2YRH A;  4DV4 E;  2EOO A;  1ZU1 A;  2YTN A;  1XMO E;  4WXD A;  3IWD A;  2V88 A;  2L6M A;  4JI3 E;  1GQE A;  5IT9 C;  2M7Q A;  4I8O A;  2EM5 A;  2EN1 A;  1IQS A;  1NEI A;  2MC6 A;  2YSP A;  4ZYD A;  5AE3 A;  3OML A;  3VK6 A;  2ENH A;  1HNW E;  2LMZ A;  1IBM E;  4DV0 E;  5T6J A;  5TSE A;  2KON A;  3HQ1 A;  2EOR A;  2KHX A;  4F54 A;  2EZ6 A;  4O43 A;  4LF7 E;  2EPM X;  2ELZ A;  1HNX E;  2UU9 E;  5IV8 B;  4O5G A;  5FLX C;  4F9B B;  3T1Y E;  2E72 A;  3K6Q A;  1QNT A;  2EPN A;  2DSY A;  2I13 A;  3KZZ A;  5KL7 A;  1A1F A;  1X49 A;  2YSO A;  2DB2 A;  2B7V A;  2L33 A;  1N34 E;  2DIX A;  2WBT A;  1BBG A;  2DMY A;  4LTY A;  1ZAA C;  3T1H E;  4HEI A;  3P1X A;  5LMU E;  1YSA C;  2HHH E;  2V8Q B;  4YY3 E;  2VE7 C;  2ODR C;  5KL4 A;  2EN8 A;  2ADR A;  1J26 A;  4R03 A;  2N8X A;  2A25 A;  2EN3 A;  2LJU A;  2YTI A;  2R76 A;  2EE8 A;  2E5L E;  2RS7 A;  2EOY A;  4DV5 E;  2LUP B;  4DMI A;  1Z1B A;  2GHF A;  3LML A;  4F9A B;  2H36 X;  2YT4 A;  2UXD E;  2EMK A;  4BHC A;  1RQ0 A;  2V85 A;  5CFF E;  2JP9 A;  5AC4 A;  2CTD A;  1PJS A;  2DGC A;  4Q35 B;  1YZ9 A;  2EPR A;  5BR8 E;  1X5W A;  2DMI A;  2EPX A;  5KL3 A;  3IWC A;  2L2K B;  3KZY A;  5A6J A;  2Q8U A;  2EOF A;  2UXC E;  3IWB A;  4JI1 E;  2M1S A;  5LL6 R;  4DUZ E;  2L3C A;  1T4L B;  2MDG A;  2EM2 A;  4DR4 E;  2MKD A;  2EMZ A;  3EQ1 A;  1NCS A;  1ZBQ A;  4WXC A;  4MLQ A;  2VQF E;  2EPA A;  3F6G A;  3VHT B;  4DV2 E;  4DR3 E;  4R2Q A;  1DQ3 A;  2MC5 A;  4LF6 E;  1XNQ E;  1XMQ E;  1X47 A;  4O4K A;  4B3M E;  4JI6 E;  2YTJ A;  2NA2 A;  1A1L A;  3EPL A;  4DV3 E;  4B3R E;  4JYA E;  3EPK A;  1WRJ A;  2EM6 A;  1F2I G;  1PJQ A;  1TN9 A;  3H09 A;  2LV2 A;  4TUG A;  1RC7 A;  5AE2 A;  1PDA A;  1WJP A;  2JY9 A;  4B3T E;  2YU8 A;  4WSP A;  3DJW A;  1T39 A;  2EQ0 A;  1IBK E;  1X6F A;  1DI2 A;  2V89 A;  2EOQ A;  4ZYG A;  1JK1 A;  1TF3 A;  4DV1 E;  2EOM A;  2J7J A;  3HPS A;  1G2D C;  3BBG A;  4IJD A;  2EPZ A;  2NAB A;  1L4S A;  3FIG A;  4GKJ E;  4M9V C;  2YTD A;  2EPK X;  2EOZ A;  4ZYE A;  1EKZ A;  2RSI A;  3OTO E;  2EL6 A;  4Q28 A;  2I9I A;  3HPZ A;  4LF5 E;  4DR7 E;  3MSW A;  2EL4 A;  3ADJ A;  1FJG E;  2V86 A;  4L8N A;  2JOX A;  4WYQ B;  1GZ6 A;  2EMI A;  2ODR D;  4LF9 E;  2WBS A;  4DV6 E;  2EM4 A;  1FKA E;  3M99 B;  1YUI A;  4LF4 E;  1KYQ A;  4N4R B;  2L92 A;  1IBL E;  4R8O A;  4NHR A;  2YWQ A;  2EPL X;  2LUQ A;  2N3G A;  4OOG C;  3C6K A;  2RS6 A;  4BC9 A;  2LTS A;  3EPJ A;  1J5E E;  4IS1 C;  1ZR9 A;  1YYK A;  4BHB A;  2EQ3 A;  2CSH A;  1YUJ A;  2UXB E;  3UK3 C;  2JOB A; 
#chains in the Genus database with same CATH homology
 2JR1 A;  2JWO A;  3IWB A;  4BS9 A;  2UXC E;  2FGG A;  2M1S A;  2V83 A;  2VF1 A;  3DF6 A;  4WPY A;  4X8W A;  5LL6 R;  5A2Q C;  2L3C A;  4DUZ E;  4DR1 E;  1T4L B;  1N36 E;  2MDR A;  3HTX A;  4JI0 E;  4KHP E;  4GKK E;  4JI4 E;  1O0W A;  1ZBT A;  1T4O A;  3ADG A;  4DR2 E;  3RMP A;  4DR4 E;  2LRS A;  3C4T A;  2K4V A;  2L2N A;  4DV4 E;  2FV4 B;  4OX9 E;  1XMO E;  1YYO A;  2B3T B;  2L2K B;  3IWD A;  4GEQ B;  1ZBQ A;  2V88 A;  2L6M A;  2VQF E;  4JI3 E;  3F6G A;  4JI5 E;  5ADZ A;  4DV2 E;  2B9D A;  2L8T A;  4DR3 E;  4B3S E;  1GQE A;  5IT9 C;  2EWL A;  1DQ3 A;  2M7Q A;  4I8O A;  1WXR A;  4DR5 E;  2MC5 A;  3JAM C;  4LF6 E;  2LTR A;  2FTX B;  3JTZ A;  2RSM A;  1T4N A;  4M30 A;  1XNQ E;  1XMQ E;  1X47 A;  4B3M E;  3J7A G;  2WZO A;  2MC6 A;  4JI6 E;  5AE3 A;  2NA2 A;  2KOU A;  3OML A;  3VK6 A;  4DKK A;  1HNW E;  2LMZ A;  1HR0 E;  1N32 E;  1WHQ A;  1IBM E;  4DV0 E;  3LLH A;  5T6J A;  4DV3 E;  4B3R E;  2KON A;  4JI7 E;  4JYA E;  3HQ1 A;  4WFT A;  4M2Z A;  2KHX A;  2L2M A;  4F54 A;  2EZ6 A;  4AQY E;  4LF7 E;  3H09 A;  1HNX E;  3ADI A;  4TUG A;  1RC7 A;  2UU9 E;  5AE2 A;  4NXM E;  4DUY E;  5IWA E;  2JY9 A;  5FLX C;  5AAS A;  4F9B B;  3T1Y E;  4X62 E;  4TUI A;  4B3T E;  3ADL A;  3K6Q A;  4WSP A;  2DSY A;  3DJW A;  2ZM6 E;  4X64 E;  1X49 A;  4BC7 A;  2B7T A;  2DB2 A;  1IBK E;  2L33 A;  2B7V A;  1QU6 A;  1DI2 A;  2V89 A;  1N34 E;  4LFC E;  2DIX A;  4LF8 E;  3VYX A;  4DV1 E;  5DNY A;  3J80 C;  1UIL A;  2DMY A;  4LTY A;  3HPS A;  3T1H E;  2F4V E;  2VQE E;  3P1X A;  5LMU E;  3FIG A;  4DR6 E;  4GKJ E;  4BMJ A;  2LJH A;  4JI8 E;  2CPN A;  4JV5 E;  2HHH E;  2L3J A;  2N3H A;  2V8Q B;  2V87 A;  4YY3 E;  4LU9 A;  1XNR E;  2VE7 C;  4P7D A;  1EKZ A;  2F8B A;  2G7H A;  2ODR C;  4X66 E;  2NUF A;  3OTO E;  1J26 A;  1N33 E;  4Q28 A;  1STU A;  4KZS A;  3HPZ A;  4R03 A;  4LF5 E;  4P78 A;  4DR7 E;  1UHZ A;  1WHN A;  3MSW A;  3ADJ A;  2LBS B;  4DV7 E;  3F6H A;  1FJG E;  2V86 A;  2M4I A;  2RTX A;  4LFA E;  4L8N A;  2JOX A;  4WYQ B;  5LMN E;  1X48 A;  3AUZ A;  1GZ6 A;  2ODR D;  2YZT A;  4JI2 E;  4LF9 E;  2E5L E;  2RS7 A;  4DV6 E;  1SR9 A;  4BBY A;  3KWR A;  5AE1 A;  4DV5 E;  2LUP B;  1FKA E;  3JU0 A;  4L5N C;  2E1M A;  4LF4 E;  4NXN E;  4JI1 E;  4DMI A;  1PKP A;  2L92 A;  1IBL E;  3C4B A;  4YHH E;  1YYW A;  4R8O A;  3LML A;  4F9A B;  2H36 X;  2YT4 A;  2LUQ A;  2UUB E;  1I94 E;  4LFB E;  2UXD E;  2JVA A;  2N3G A;  4OOG C;  5F3W A;  3J7Y p;  4M0V A;  3VYY A;  1HNZ E;  2NUG A;  1RQ0 A;  2V85 A;  2RS6 A;  4BC9 A;  5CFF E;  2UUC E;  2UUA E;  2LTS A;  4BCA A;  4K0K E;  1YZ9 A;  2IHR 1;  1J5E E;  3J81 C;  1YYK A;  5BR8 E;  3HXL A;  3AV0 A;  2NUE A;  2LE2 A;  4F9C B;  4J8Z A;  4X65 E;  3IWC A;  2UXB E;  2JOB A;  3ZOQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...