3DJWA

The thermo- and acido-stable orf-99 from the archaeal virus afv1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
95
structure length
95
Chain Sequence
DTHEFHKLLIKVVDLFLEDRIKEFELKLNTTLDELEFEELIGKPDSSNSAENNGIFIDEYSYDASENAIKKLFVEYVRQPEFKYTVLSIKGVNDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF99
publication title The thermo- and acido-stable ORF-99 from the archaeal virus AFV1
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Viral protein, unknown function
total genus 25
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3djwA00
3DJWA 3DF6A 2H36X
chains in the Genus database with same CATH superfamily
1IBME 1NCSA 2EN7A 2NUGA 2FV4B 4JYAE 2ENCA 3C6KA 1IQOA 2EPKX 2L3CA 1YUJA 4LF4E 2EM4A 3F6GA 1EKZA 2EPPA 4BS9A 2EM7A 2CTDA 2DLKA 2YRMA 3C4BA 4BHBA 2EPOA 4R2PA 3IWBA 2RPCA 2I13A 2H36X 4JI0E 2B3TB 3LLHA 1N34E 1FKAE 1YSAC 2CPNA 2JPAA 2EPZA 2L2MA 1YUIA 3J80C 5A6AA 4O5GA 2EN8A 3EQ1A 2NUEA 2JYAA 2VE7C 2EPNA 2EMZA 2E72A 2M1SA 4KZSA 3BF2A 3VYYA 4OX9E 2L8TA 2UXCE 4BCAA 3P1XA 4DR3E 4LTYA 1TF6A 4JI5E 3JAMC 2Q8UA 5FLXC 2EOOA 4NXNE 4O24A 2ODRC 3VHTB 1YYWA 2L33A 2EOZA 1MEYC 5KL3A 4WX9A 3ADGA 3T1HE 3EPKA 5DNYA 2V86A 2GPIA 1B69A 2MKNA 1UILA 2L3JA 4F2JC 2I9IA 2EOEA 2LV2A 2EM5A 3K6QA 4R2DA 4WYQB 1RMDA 3UK3C 5KL5A 4P78A 1X6EA 2F8BA 1DQ3A 1UHZA 3J7Yp 2EM2A 5IWAE 2NUFA 1IQSA 5LLQA 4DR2E 4DV2E 2NA2A 4JI7E 2EOXA 2DMIA 2B9DA 4GZNC 2EM0A 2DIXA 4I8OA 3MHSC 1EH6A 1GQEA 2YTOA 2HHHE 1SFEA 4JI2E 1O0WA 3KZZA 4HTGA 2DLQA 2JP9A 1EH7A 4DUYE 2VQEE 4DV5E 1A1JA 4B3TE 3DJWA 5CFFE 2V85A 2LT7A 3KWRA 2MKDA 3BGHA 3MSWA 1RC7A 2YU8A 3RMPA 3T1YE 3ADLA 2D9HA 4YY3E 4LF7E 5KL4A 1WJPA 2EMKA 2LCEA 1X5WA 4GEQB 2HGHA 2JWOA 2EQ0A 4DR6E 5KL6A 4L5NC 4B3ME 5AE2A 5LMNE 1IMUA 2YTQA 1X3CA 2BBGA 4NZVA 2WCC3 5LL6R 5AE1A 2VF1A 2ELZA 2UXDE 1T38A 4L8NA 5A6BD 1A1GA 1N36E 1IBLE 3HPSA 4R2SA 2YSOA 1HNXE 2ENAA 2LE2A 2EPLX 4MLQA 1G2FC 5AASA 2V87A 4O43A 1X6FA 3FIGA 2J7JA 2YRKA 2DRPA 1GTKA 4DV0E 2UXBE 4LFAE 3TQMA 1T4LB 4R2EA 2ADRA 2B7TA 3MHHC 2EPCA 2RTXA 2YTGA 2RS6A 2EOQA 4TUGA 2MDRA 1A1IA 4BHCA 2EOSA 5A6BA 4X65E 4IS1C 1A1HA 2EWLA 2MDGA 1HR0E 2UUAE 4LFBE 2LBSB 1A1KA 4DR4E 4JV5E 2DSYA 3ADJA 2LUQA 1N32E 2V8QB 4WFTA 1AH5A 2EN4A 3AV0A 4R8OA 4LF8E 3VK6A 4BBYA 4ZYDA 1XNRE 2BB8A 3EPLA 2EMCA 2RS7A 3HTXA 2DMYA 3KZYA 4BMJA 4JI4E 2YPNA 1F2IG 1N33E 1WHNA 2YTJA 1STUA 3AUZA 2EORA 2RQLA 4GKJE 4X9JA 2LUPB 4WXCA 1BBGA 4JI6E 2EQ1A 2ELYA 2EQ3A 3C4TA 1XMQE 4R2AA 2A25A 3L00A 4DV6E 1IBKE 2JVAA 4FK5C 4X64E 5AC5A 4ZYGA 3HQ1A 2LMZA 1DI2A 4IJDA 2EN2A 4HEIA 2WZOA 1X49A 2RSMA 2WBTA 4F9BB 3DF6A 1DGCA 4Q28A 5IXMB 5A2QC 2M7QA 1MGTA 2EOMA 2EOHA 3THOB 4GKKE 2PRTA 2L2KB 2EPRA 1ZBTA 4AQYE 1YPNA 1ZAAC 3ZOQB 2LJUA 1TN9A 4DV1E 2DB2A 4X8WA 3JU0A 2YWQA 5A6JA 3BIDA 1X48A 1KJKA 1XNQE 5T6JA 5IV8B 1LLMC 2EMGA 2UUBE 1T4NA 1FJGE 4Q35B 3M99B 2N3HA 3HXLA 1I94E 2LJHA 2EOFA 2ZM6E 3IWDA 2EP3A 4TUIA 2EMLA 2EPUA 2YSPA 4RHBB 1HNWE 2YRHA 2EN6A 5LMUE 4F6MA 1RQ0A 2E1MA 1P47A 2EN3A 4MLVA 2FTXB 4B3RE 4LU9A 2MC6A 4WXDA 1JK2A 4X62E 1ZU1A 2EM3A 2N8XA 2YTNA 4WPYA 4DMIA 4K0KE 2M9AA 4N4RB 1XMOE 1AAYA 2K7IA 2EL5A 2ODRD 2GHFA 1JK1A 3F6HA 2YU5A 1WXRA 2YTFA 4R2QA 4F9AB 2YTDA 2EOYA 2JOBA 1QU6A 1N3GA 5AC4A 4B3SE 1YFHA 4DR5E 1YYKA 4OOGC 1YYOA 1BBOA 3QG5C 2EMXA 4JI1E 4ZYEA 4R2CA 4DV7E 2E5LE 3H09A 2GLIA 5A69A 2F4VE 2R76A 3J7AG 4R2RA 2EOJA 4X66E 1X47A 2LTRA 5ADZA 2EMFA 1TF3A 2EN1A 1HNZE 2EL6A 3EPHA 4DUZE 3OTOE 1A1LA 1UBDC 1KYQA 2LO3A 4DKKA 4F6NA 3ECRA 2ENHA 2HC5A 5IT9C 2YZTA 2CT1A 1ZBQA 2UUCE 2WBSA 2JOXA 2JY9A 2EMHA 4M0VA 2CSHA 1UN6B 2EZ6A 2UU9E 1QNTA 3BBGA 2NABA 5KL7A 2EOIA 4WSGA 1PJQA 2LRSA 4O4KA 4LF5E 2RSIA 4JI3E 4DR7E 3IWCA 2EPXA 1ZR9A 4NHRA 4DV3E 4NXME 1Z1BA 2VQFE 2EM9A 2KHXA 2VRDA 2EMBA 2K4VA 2LTSA 5A6KA 5KL2A 4R03A 4DV4E 1PKPA 5TSEA 4ZYHA 5AE3A 1J5EE 2YTEA 2KONA 2FGGA 2YT4A 4BC9A 4RH8A 2G7HA 2IHR1 4WSPA 2EPAA 2JR1A 5BR8E 4F9CB 2V89A 4F54A 2WBUA 1BB8A 2EMAA 1T39A 4P7DA 4LFCE 3HPZA 4LF6E 2N3GA 2V88A 1T4OA 4BC7A 4J8ZA 2HJJA 1G2DC 1EH8A 2EM8A 2EMYA 3EPJA 2MC5A 3OMLA 2L6MA 1YZ9A 1PDAA 2M4IA 2L92A 2JXPA 1PJSA 1L4SA 2KOUA 1X6HA 2EMWA 3VYXA 1NEIA 1SR9A 2EJ4A 4LF9E 2YTPA 2B7VA 2EL4A 3JTZA 2YTIA 4YHHE 1WRJA 3ADIA 4KHPE 1PJTA 4DR1E 2DGCA 4M9VC 2EE8A 4KWYA 3J81C 2L2NA 2EMIA 2LVHA 2V83A 5F3WA 1J26A 2EPMX 2EM6A 3C6MA 3THNA 4M2ZA 2R1FA 4M30A 1A1FA 4JI8E 1WHQA 3LMLA 1GZ6A
chains in the Genus database with same CATH topology
3HQ1A 2LMZA 1DI2A 1IBME 4GEQB 4DKKA 2JWOA 4DR6E 2NUGA 2WZOA 4L5NC 1X49A 2RSMA 5AE2A 2FV4B 4F9BB 5LMNE 5IT9C 4B3ME 2YZTA 4JYAE 3DF6A 1ZBQA 2UUCE 4Q28A 2JOXA 5A2QC 2JY9A 5LL6R 5AE1A 2M7QA 4GKKE 2VF1A 4M0VA 2L3CA 2EZ6A 2L2KB 4LF4E 2UXDE 1ZBTA 4AQYE 3F6GA 4L8NA 2UU9E 3ZOQB 1N36E 1IBLE 3HPSA 1EKZA 4BS9A 4DV1E 1HNXE 2DB2A 4X8WA 3JU0A 2LE2A 2LRSA 3C4BA 1X48A 5AASA 4LF5E 2V87A 4JI3E 4DR7E 1XNQE 5T6JA 3IWBA 3IWCA 3FIGA 2UUBE 1T4NA 2H36X 1FJGE 4DV0E 4JI0E 2B3TB 3LLHA 1N34E 1FKAE 4LFAE 2UXBE 2CPNA 4DV3E 4NXME 2L2MA 2N3HA 3HXLA 1T4LB 3J80C 1I94E 2B7TA 2VQFE 2KHXA 2LJHA 2NUEA 2ZM6E 2K4VA 2LTSA 2RTXA 2VE7C 3IWDA 2M1SA 4KZSA 4R03A 3VYYA 2RS6A 4DV4E 4OX9E 4TUIA 2L8TA 2UXCE 1PKPA 1HNWE 4TUGA 4BCAA 2MDRA 5AE3A 1J5EE 3P1XA 2KONA 4DR3E 4LTYA 4X65E 2FGGA 3JAMC 4JI5E 2YT4A 5FLXC 4NXNE 5LMUE 2ODRC 1RQ0A 2E1MA 2EWLA 4BC9A 1YYWA 2G7HA 2IHR1 2L33A 4WSPA 2FTXB 1HR0E 2JR1A 2UUAE 5BR8E 3ADGA 4F9CB 4B3RE 2V89A 4F54A 3T1HE 4LU9A 2MC6A 2V86A 5DNYA 4X62E 4LFBE 1UILA 2L3JA 4P7DA 2LBSB 4LFCE 3K6QA 4DR4E 3HPZA 4LF6E 2N3GA 2V88A 4WPYA 1T4OA 4WYQB 4BC7A 4DMIA 4J8ZA 4JV5E 4K0KE 2DSYA 3ADJA 2LUQA 4P78A 1XMOE 1N32E 2V8QB 2F8BA 1DQ3A 2ODRD 1UHZA 2MC5A 3OMLA 4WFTA 3J7Yp 2L6MA 3AV0A 5IWAE 2M4IA 1YZ9A 2NUFA 3F6HA 2L92A 4R8OA 1WXRA 4DR2E 4LF8E 3VK6A 4DV2E 4BBYA 4F9AB 2NA2A 4JI7E 2JOBA 2KOUA 1QU6A 3VYXA 1XNRE 1SR9A 2B9DA 2RS7A 4B3SE 4LF9E 4DR5E 3HTXA 2DIXA 2B7VA 2DMYA 4I8OA 3JTZA 4BMJA 4YHHE 4JI4E 1GQEA 1WHNA 2HHHE 3AUZA 1STUA 4JI2E 1YYKA 4OOGC 3ADIA 1YYOA 4KHPE 1O0WA 4GKJE 4DR1E 2LUPB 4B3TE 4DUYE 2VQEE 4DV5E 4JI1E 4JI6E 2E5LE 4DV7E 3DJWA 3H09A 2V85A 5CFFE 3J81C 3C4TA 2L2NA 1XMQE 2F4VE 3J7AG 1N33E 2V83A 3KWRA 5F3WA 3MSWA 4X66E 1J26A 1X47A 2LTRA 1RC7A 5ADZA 3RMPA 3T1YE 4M2ZA 4DV6E 1IBKE 2JVAA 4M30A 1HNZE 3ADLA 4JI8E 4X64E 4DUZE 1WHQA 4YY3E 3OTOE 3LMLA 4LF7E 1GZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJW A;  3DF6 A;  2H36 X; 
#chains in the Genus database with same CATH topology
 1IBM E;  1NCS A;  2EN7 A;  2NUG A;  2FV4 B;  4JYA E;  2ENC A;  3C6K A;  1IQO A;  2EPK X;  2L3C A;  1YUJ A;  4LF4 E;  2EM4 A;  3F6G A;  1EKZ A;  2EPP A;  4BS9 A;  2EM7 A;  2CTD A;  2DLK A;  2YRM A;  3C4B A;  4BHB A;  2EPO A;  4R2P A;  3IWB A;  2RPC A;  2I13 A;  2H36 X;  4JI0 E;  2B3T B;  3LLH A;  1N34 E;  1FKA E;  1YSA C;  2CPN A;  2JPA A;  2EPZ A;  2L2M A;  1YUI A;  3J80 C;  5A6A A;  4O5G A;  2EN8 A;  3EQ1 A;  2NUE A;  2JYA A;  2VE7 C;  2EPN A;  2EMZ A;  2E72 A;  2M1S A;  4KZS A;  3BF2 A;  3VYY A;  4OX9 E;  2L8T A;  2UXC E;  4BCA A;  3P1X A;  4DR3 E;  4LTY A;  1TF6 A;  4JI5 E;  3JAM C;  2Q8U A;  5FLX C;  2EOO A;  4NXN E;  4O24 A;  2ODR C;  3VHT B;  1YYW A;  2L33 A;  2EOZ A;  1MEY C;  5KL3 A;  4WX9 A;  3ADG A;  3T1H E;  3EPK A;  5DNY A;  2V86 A;  2GPI A;  1B69 A;  2MKN A;  1UIL A;  2L3J A;  4F2J C;  2I9I A;  2EOE A;  2LV2 A;  2EM5 A;  3K6Q A;  4R2D A;  4WYQ B;  1RMD A;  3UK3 C;  5KL5 A;  4P78 A;  1X6E A;  2F8B A;  1DQ3 A;  1UHZ A;  3J7Y p;  2EM2 A;  5IWA E;  2NUF A;  1IQS A;  5LLQ A;  4DR2 E;  4DV2 E;  2NA2 A;  4JI7 E;  2EOX A;  2DMI A;  2B9D A;  4GZN C;  2EM0 A;  2DIX A;  4I8O A;  3MHS C;  1EH6 A;  1GQE A;  2YTO A;  2HHH E;  1SFE A;  4JI2 E;  1O0W A;  3KZZ A;  4HTG A;  2DLQ A;  2JP9 A;  1EH7 A;  4DUY E;  2VQE E;  4DV5 E;  1A1J A;  4B3T E;  3DJW A;  5CFF E;  2V85 A;  2LT7 A;  3KWR A;  2MKD A;  3BGH A;  3MSW A;  1RC7 A;  2YU8 A;  3RMP A;  3T1Y E;  3ADL A;  2D9H A;  4YY3 E;  4LF7 E;  5KL4 A;  1WJP A;  2EMK A;  2LCE A;  1X5W A;  4GEQ B;  2HGH A;  2JWO A;  2EQ0 A;  4DR6 E;  5KL6 A;  4L5N C;  4B3M E;  5AE2 A;  5LMN E;  1IMU A;  2YTQ A;  1X3C A;  2BBG A;  4NZV A;  2WCC 3;  5LL6 R;  5AE1 A;  2VF1 A;  2ELZ A;  2UXD E;  1T38 A;  4L8N A;  5A6B D;  1A1G A;  1N36 E;  1IBL E;  3HPS A;  4R2S A;  2YSO A;  1HNX E;  2ENA A;  2LE2 A;  2EPL X;  4MLQ A;  1G2F C;  5AAS A;  2V87 A;  4O43 A;  1X6F A;  3FIG A;  2J7J A;  2YRK A;  2DRP A;  1GTK A;  4DV0 E;  2UXB E;  4LFA E;  3TQM A;  1T4L B;  4R2E A;  2ADR A;  2B7T A;  3MHH C;  2EPC A;  2RTX A;  2YTG A;  2RS6 A;  2EOQ A;  4TUG A;  2MDR A;  1A1I A;  4BHC A;  2EOS A;  5A6B A;  4X65 E;  4IS1 C;  1A1H A;  2EWL A;  2MDG A;  1HR0 E;  2UUA E;  4LFB E;  2LBS B;  1A1K A;  4DR4 E;  4JV5 E;  2DSY A;  3ADJ A;  2LUQ A;  1N32 E;  2V8Q B;  4WFT A;  1AH5 A;  2EN4 A;  3AV0 A;  4R8O A;  4LF8 E;  3VK6 A;  4BBY A;  4ZYD A;  1XNR E;  2BB8 A;  3EPL A;  2EMC A;  2RS7 A;  3HTX A;  2DMY A;  3KZY A;  4BMJ A;  4JI4 E;  2YPN A;  1F2I G;  1N33 E;  1WHN A;  2YTJ A;  1STU A;  3AUZ A;  2EOR A;  2RQL A;  4GKJ E;  4X9J A;  2LUP B;  4WXC A;  1BBG A;  4JI6 E;  2EQ1 A;  2ELY A;  2EQ3 A;  3C4T A;  1XMQ E;  4R2A A;  2A25 A;  3L00 A;  4DV6 E;  1IBK E;  2JVA A;  4FK5 C;  4X64 E;  5AC5 A;  4ZYG A;  3HQ1 A;  2LMZ A;  1DI2 A;  4IJD A;  2EN2 A;  4HEI A;  2WZO A;  1X49 A;  2RSM A;  2WBT A;  4F9B B;  3DF6 A;  1DGC A;  4Q28 A;  5IXM B;  5A2Q C;  2M7Q A;  1MGT A;  2EOM A;  2EOH A;  3THO B;  4GKK E;  2PRT A;  2L2K B;  2EPR A;  1ZBT A;  4AQY E;  1YPN A;  1ZAA C;  3ZOQ B;  2LJU A;  1TN9 A;  4DV1 E;  2DB2 A;  4X8W A;  3JU0 A;  2YWQ A;  5A6J A;  3BID A;  1X48 A;  1KJK A;  1XNQ E;  5T6J A;  5IV8 B;  1LLM C;  2EMG A;  2UUB E;  1T4N A;  1FJG E;  4Q35 B;  3M99 B;  2N3H A;  3HXL A;  1I94 E;  2LJH A;  2EOF A;  2ZM6 E;  3IWD A;  2EP3 A;  4TUI A;  2EML A;  2EPU A;  2YSP A;  4RHB B;  1HNW E;  2YRH A;  2EN6 A;  5LMU E;  4F6M A;  1RQ0 A;  2E1M A;  1P47 A;  2EN3 A;  4MLV A;  2FTX B;  4B3R E;  4LU9 A;  2MC6 A;  4WXD A;  1JK2 A;  4X62 E;  1ZU1 A;  2EM3 A;  2N8X A;  2YTN A;  4WPY A;  4DMI A;  4K0K E;  2M9A A;  4N4R B;  1XMO E;  1AAY A;  2K7I A;  2EL5 A;  2ODR D;  2GHF A;  1JK1 A;  3F6H A;  2YU5 A;  1WXR A;  2YTF A;  4R2Q A;  4F9A B;  2YTD A;  2EOY A;  2JOB A;  1QU6 A;  1N3G A;  5AC4 A;  4B3S E;  1YFH A;  4DR5 E;  1YYK A;  4OOG C;  1YYO A;  1BBO A;  3QG5 C;  2EMX A;  4JI1 E;  4ZYE A;  4R2C A;  4DV7 E;  2E5L E;  3H09 A;  2GLI A;  5A69 A;  2F4V E;  2R76 A;  3J7A G;  4R2R A;  2EOJ A;  4X66 E;  1X47 A;  2LTR A;  5ADZ A;  2EMF A;  1TF3 A;  2EN1 A;  1HNZ E;  2EL6 A;  3EPH A;  4DUZ E;  3OTO E;  1A1L A;  1UBD C;  1KYQ A;  2LO3 A;  4DKK A;  4F6N A;  3ECR A;  2ENH A;  2HC5 A;  5IT9 C;  2YZT A;  2CT1 A;  1ZBQ A;  2UUC E;  2WBS A;  2JOX A;  2JY9 A;  2EMH A;  4M0V A;  2CSH A;  1UN6 B;  2EZ6 A;  2UU9 E;  1QNT A;  3BBG A;  2NAB A;  5KL7 A;  2EOI A;  4WSG A;  1PJQ A;  2LRS A;  4O4K A;  4LF5 E;  2RSI A;  4JI3 E;  4DR7 E;  3IWC A;  2EPX A;  1ZR9 A;  4NHR A;  4DV3 E;  4NXM E;  1Z1B A;  2VQF E;  2EM9 A;  2KHX A;  2VRD A;  2EMB A;  2K4V A;  2LTS A;  5A6K A;  5KL2 A;  4R03 A;  4DV4 E;  1PKP A;  5TSE A;  4ZYH A;  5AE3 A;  1J5E E;  2YTE A;  2KON A;  2FGG A;  2YT4 A;  4BC9 A;  4RH8 A;  2G7H A;  2IHR 1;  4WSP A;  2EPA A;  2JR1 A;  5BR8 E;  4F9C B;  2V89 A;  4F54 A;  2WBU A;  1BB8 A;  2EMA A;  1T39 A;  4P7D A;  4LFC E;  3HPZ A;  4LF6 E;  2N3G A;  2V88 A;  1T4O A;  4BC7 A;  4J8Z A;  2HJJ A;  1G2D C;  1EH8 A;  2EM8 A;  2EMY A;  3EPJ A;  2MC5 A;  3OML A;  2L6M A;  1YZ9 A;  1PDA A;  2M4I A;  2L92 A;  2JXP A;  1PJS A;  1L4S A;  2KOU A;  1X6H A;  2EMW A;  3VYX A;  1NEI A;  1SR9 A;  2EJ4 A;  4LF9 E;  2YTP A;  2B7V A;  2EL4 A;  3JTZ A;  2YTI A;  4YHH E;  1WRJ A;  3ADI A;  4KHP E;  1PJT A;  4DR1 E;  2DGC A;  4M9V C;  2EE8 A;  4KWY A;  3J81 C;  2L2N A;  2EMI A;  2LVH A;  2V83 A;  5F3W A;  1J26 A;  2EPM X;  2EM6 A;  3C6M A;  3THN A;  4M2Z A;  2R1F A;  4M30 A;  1A1F A;  4JI8 E;  1WHQ A;  3LML A;  1GZ6 A; 
#chains in the Genus database with same CATH homology
 3HQ1 A;  2LMZ A;  1DI2 A;  1IBM E;  4GEQ B;  4DKK A;  2JWO A;  4DR6 E;  2NUG A;  2WZO A;  4L5N C;  1X49 A;  2RSM A;  5AE2 A;  2FV4 B;  4F9B B;  5LMN E;  5IT9 C;  4B3M E;  2YZT A;  4JYA E;  3DF6 A;  1ZBQ A;  2UUC E;  4Q28 A;  2JOX A;  5A2Q C;  2JY9 A;  5LL6 R;  5AE1 A;  2M7Q A;  4GKK E;  2VF1 A;  4M0V A;  2L3C A;  2EZ6 A;  2L2K B;  4LF4 E;  2UXD E;  1ZBT A;  4AQY E;  3F6G A;  4L8N A;  2UU9 E;  3ZOQ B;  1N36 E;  1IBL E;  3HPS A;  1EKZ A;  4BS9 A;  4DV1 E;  1HNX E;  2DB2 A;  4X8W A;  3JU0 A;  2LE2 A;  2LRS A;  3C4B A;  1X48 A;  5AAS A;  4LF5 E;  2V87 A;  4JI3 E;  4DR7 E;  1XNQ E;  5T6J A;  3IWB A;  3IWC A;  3FIG A;  2UUB E;  1T4N A;  2H36 X;  1FJG E;  4DV0 E;  4JI0 E;  2B3T B;  3LLH A;  1N34 E;  1FKA E;  4LFA E;  2UXB E;  2CPN A;  4DV3 E;  4NXM E;  2L2M A;  2N3H A;  3HXL A;  1T4L B;  3J80 C;  1I94 E;  2B7T A;  2VQF E;  2KHX A;  2LJH A;  2NUE A;  2ZM6 E;  2K4V A;  2LTS A;  2RTX A;  2VE7 C;  3IWD A;  2M1S A;  4KZS A;  4R03 A;  3VYY A;  2RS6 A;  4DV4 E;  4OX9 E;  4TUI A;  2L8T A;  2UXC E;  1PKP A;  1HNW E;  4TUG A;  4BCA A;  2MDR A;  5AE3 A;  1J5E E;  3P1X A;  2KON A;  4DR3 E;  4LTY A;  4X65 E;  2FGG A;  3JAM C;  4JI5 E;  2YT4 A;  5FLX C;  4NXN E;  5LMU E;  2ODR C;  1RQ0 A;  2E1M A;  2EWL A;  4BC9 A;  1YYW A;  2G7H A;  2IHR 1;  2L33 A;  4WSP A;  2FTX B;  1HR0 E;  2JR1 A;  2UUA E;  5BR8 E;  3ADG A;  4F9C B;  4B3R E;  2V89 A;  4F54 A;  3T1H E;  4LU9 A;  2MC6 A;  2V86 A;  5DNY A;  4X62 E;  4LFB E;  1UIL A;  2L3J A;  4P7D A;  2LBS B;  4LFC E;  3K6Q A;  4DR4 E;  3HPZ A;  4LF6 E;  2N3G A;  2V88 A;  4WPY A;  1T4O A;  4WYQ B;  4BC7 A;  4DMI A;  4J8Z A;  4JV5 E;  4K0K E;  2DSY A;  3ADJ A;  2LUQ A;  4P78 A;  1XMO E;  1N32 E;  2V8Q B;  2F8B A;  1DQ3 A;  2ODR D;  1UHZ A;  2MC5 A;  3OML A;  4WFT A;  3J7Y p;  2L6M A;  3AV0 A;  5IWA E;  2M4I A;  1YZ9 A;  2NUF A;  3F6H A;  2L92 A;  4R8O A;  1WXR A;  4DR2 E;  4LF8 E;  3VK6 A;  4DV2 E;  4BBY A;  4F9A B;  2NA2 A;  4JI7 E;  2JOB A;  2KOU A;  1QU6 A;  3VYX A;  1XNR E;  1SR9 A;  2B9D A;  2RS7 A;  4B3S E;  4LF9 E;  4DR5 E;  3HTX A;  2DIX A;  2B7V A;  2DMY A;  4I8O A;  3JTZ A;  4BMJ A;  4YHH E;  4JI4 E;  1GQE A;  1WHN A;  2HHH E;  3AUZ A;  1STU A;  4JI2 E;  1YYK A;  4OOG C;  3ADI A;  1YYO A;  4KHP E;  1O0W A;  4GKJ E;  4DR1 E;  2LUP B;  4B3T E;  4DUY E;  2VQE E;  4DV5 E;  4JI1 E;  4JI6 E;  2E5L E;  4DV7 E;  3DJW A;  3H09 A;  2V85 A;  5CFF E;  3J81 C;  3C4T A;  2L2N A;  1XMQ E;  2F4V E;  3J7A G;  1N33 E;  2V83 A;  3KWR A;  5F3W A;  3MSW A;  4X66 E;  1J26 A;  1X47 A;  2LTR A;  1RC7 A;  5ADZ A;  3RMP A;  3T1Y E;  4M2Z A;  4DV6 E;  1IBK E;  2JVA A;  4M30 A;  1HNZ E;  3ADL A;  4JI8 E;  4X64 E;  4DUZ E;  1WHQ A;  4YY3 E;  3OTO E;  3LML A;  4LF7 E;  1GZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...