1X47A

Solution structure of dsrm domain in dgcr8 protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
GSSGSSGEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords DGCR8 protein
publication title Solution structure of DSRM domain in DGCR8 protein
rcsb
source organism Homo sapiens
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1x47A01
2N3HA 1HR0E 3P1XA 2UXBE 2L33A 1GQEA 2LTRA 4DKKA 1X47A 3C4BA 4AQYE 1XMQE 3LLHA 2UU9E 4K0KE 1HNZE 1FJGE 1YYKA 4DUZE 3ADGA 5LMUE 1RQ0A 4JI5E 4JI8E 2DB2A 2IHR1 2KHXA 2MDRA 4GKJE 2DMYA 4DUYE 4JI1E 2RS6A 4X65E 4LF5E 4NXNE 4JI0E 4LF8E 4DV5E 1X48A 1YYOA 4B3TE 4WFTA 5LMNE 3C4TA 4DV7E 4JI6E 2B7TA 4M30A 2ZM6E 2NUEA 3VYYA 2L3CA 2E5LE 2B3TB 2CPNA 2RTXA 2DIXA 4X66E 4JI3E 1DI2A 4LFBE 1IBKE 1XMOE 1X49A 4DV3E 2UUBE 1PKPA 2VQEE 1T4NA 4WYQB 4B3RE 1STUA 2L2NA 1YZ9A 1N34E 4GKKE 2YT4A 2RS7A 3T1YE 4NXME 1J26A 4X62E 4JI7E 3ADLA 4DR2E 2HHHE 2L2KB 4M2ZA 4LF9E 1I94E 1IBME 2LBSB 1J5EE 2UUAE 2F4VE 2UUCE 1UHZA 2LUPB 4JYAE 4DR3E 4DR7E 5IWAE 4OOGC 4DV4E 2LJHA 2N3GA 4DR5E 4B3SE 1WHQA 3ADIA 1T4OA 4KHPE 2JVAA 1O0WA 1IBLE 3J7Yp 4DV1E 4JI2E 3T1HE 4DR1E 2UXDE 1WHNA 4DV6E 3ADJA 2L3JA 1N33E 2NUFA 1QU6A 4DV2E 3HTXA 4X64E 1XNRE 2JY9A 4JI4E 4DV0E 3VYXA 1T4LB 1UILA 2EZ6A 2LRSA 2VQFE 2NUGA 1ZBTA 1FKAE 2LUQA 4LF4E 1RC7A 5CFFE 4LFAE 1EKZA 1HNWE 5BR8E 1N32E 2RSMA 4YHHE 1YYWA 4X8WA 4LFCE 4B3ME 4YY3E 2LTSA 1N36E 4LF7E 4OX9E 4LF6E 4DR6E 4JV5E 4DR4E 2NA2A 3OTOE 2L2MA 1HNXE 2UXCE 1XNQE 2B7VA
chains in the Genus database with same CATH superfamily
2JWOA 2YTQA 2LTRA 1X5WA 3BGHA 1YUJA 4K0KE 4IJDA 2EMXA 1YYKA 2DRPA 2JP9A 2FGGA 3DF6A 1YFHA 4M0VA 5KL5A 5LL6R 4R03A 2IHR1 3VK6A 2EM0A 4DUYE 3MHSC 4LF5E 2EOOA 1AH5A 4WX9A 4B3TE 4HTGA 1MGTA 2V8QB 4RH8A 1A1IA 4JI6E 4M30A 2YTNA 2L6MA 2WZOA 2EMCA 2E5LE 5A6AA 2JOXA 2DIXA 2EQ0A 4JI3E 1DI2A 3H09A 2R76A 1ZAAC 1X49A 4R2DA 1X6FA 2UUBE 2ODRC 4O4KA 1STUA 2RS7A 2EM5A 2HGHA 3HXLA 4NXME 3BBGA 4X62E 2EM4A 2HHHE 3KZYA 4LF9E 1WRJA 1J5EE 2GPIA 3C6KA 2EL4A 2LUPB 4DR3E 4DR7E 4DV4E 4DR5E 2N3GA 5AC5A 2MDGA 4FK5C 1WHQA 1N3GA 2V87A 3JU0A 2JXPA 1O0WA 2WBUA 4JI2E 3K6QA 3T1HE 1UN6B 2EPAA 2EN6A 2YU8A 3AV0A 2EMGA 4DR1E 1WHNA 1A1LA 2LVHA 4O24A 2EM3A 4F9AB 3EPHA 3IWCA 2EJ4A 4TUIA 1XNRE 3VYXA 4MLVA 2GHFA 1P47A 1UILA 3THNA 2EZ6A 2LRSA 2VQFE 2LUQA 4LF4E 5CFFE 5IXMB 1PJSA 2EN1A 4LFAE 3J7AG 1BB8A 2F8BA 3F6GA 4LFCE 2YSOA 2EMBA 2YSPA 2HJJA 2NA2A 5AE2A 4RHBB 4WSGA 2EPNA 2B7VA 1ZBQA 3KWRA 4DKKA 1X47A 2YPNA 4AQYE 2UU9E 4L5NC 2E72A 2DLKA 4LTYA 2EN2A 3IWBA 2ENCA 4JI5E 2DB2A 2KHXA 4R2CA 2ODRD 2YTJA 4F9CB 5IT9C 2FTXB 2K7IA 2V86A 4WFTA 2CSHA 5AE1A 2BBGA 4R8OA 4X66E 4LFBE 2I9IA 2EPKX 2HC5A 5KL6A 2FV4B 1UBDC 4L8NA 2EM7A 1T4NA 2EOYA 4WYQB 1QNTA 1RMDA 2L2NA 4R2EA 5LLQA 2EP3A 1WXRA 4DR2E 2EOSA 1I94E 1L4SA 2LBSB 3BF2A 3EQ1A 2EOIA 2F4VE 1AAYA 1F2IG 2ENHA 1UHZA 3VHTB 2ENAA 5A69A 5DNYA 2MKDA 4JYAE 5IWAE 1X6HA 4B3SE 2EMZA 3F6HA 1T4OA 4J8ZA 1PDAA 4I8OA 1A1GA 4LU9A 2EE8A 2WBTA 2ELYA 5A6KA 2EMKA 2EMWA 3ADJA 1T38A 2EPPA 3EPLA 4DV2E 2LE2A 2EORA 1IQSA 2EMIA 2JY9A 2L92A 1TN9A 1YSAC 2YTPA 2EN4A 1FKAE 2EOEA 2EM2A 1RC7A 3C6MA 5A6JA 1EKZA 2YRHA 1N32E 3FIGA 1DQ3A 2EMHA 2RSMA 4YHHE 3J81C 4X8WA 2M4IA 3LMLA 4BHCA 4B3ME 2M1SA 2V85A 2RQLA 5KL2A 4F6NA 4Q35B 5ADZA 4F54A 2WBSA 3OTOE 5A6BA 1HNXE 2YTOA 2UXCE 2N3HA 2UXBE 1GQEA 2JYAA 1XMQE 3LLHA 1A1FA 1HNZE 4TUGA 4Q28A 2ELZA 2EN8A 1G2FC 1KYQA 2EOQA 2EPCA 4GKJE 2DMYA 4JI1E 2RS6A 3IWDA 4NXNE 2EOMA 4JI0E 2JR1A 3KZZA 4BBYA 4DV5E 4ZYHA 4DV7E 3C4TA 3JAMC 4O43A 2NUEA 2YU5A 1NEIA 3VYYA 2L3CA 2B3TB 4BCAA 2CPNA 1PJTA 2EQ1A 2EMYA 3EPKA 4WXDA 5A6BD 2NABA 1XMOE 4DV3E 2EOFA 1PKPA 3J80C 1B69A 4B3RE 1N34E 2EMLA 2YZTA 2YT4A 3T1YE 2K4VA 3EPJA 2ADRA 2LO3A 3OMLA 4F2JC 2B9DA 1A1JA 1J26A 4M2ZA 4NZVA 4KWYA 2DMIA 3AUZA 1IBME 3THOB 2UUAE 4ZYDA 5AC4A 2UUCE 2EPMX 1GZ6A 2RSIA 1KJKA 2EPUA 4R2SA 4HEIA 4OOGC 2BB8A 4N4RB 2YWQA 1LLMC 2EQ3A 3ADIA 1JK1A 4BHBA 4BC9A 2EOHA 2JVAA 1X6EA 1IBLE 1WJPA 2EPOA 2JPAA 2Q8UA 1TF3A 5A2QC 2CTDA 5F3WA 4R2AA 2UXDE 5KL4A 2MC6A 5AASA 4ZYGA 2YTGA 3HTXA 3M99B 1Z1BA 4BMJA 2EPLX 3RMPA 4ZYEA 2NUGA 1ZBTA 5KL3A 2D9HA 2LCEA 1HNWE 2V83A 1DGCA 1MEYC 4P78A 1EH8A 1YYWA 2EL6A 4YY3E 4KZSA 2EM8A 2N8XA 2LTSA 1ZR9A 5IV8B 2RPCA 4X9JA 1ZU1A 3HQ1A 1N36E 4OX9E 3MHHC 2H36X 3DJWA 2CT1A 4MLQA 4DR6E 4DR4E 4JV5E 2J7JA 4P7DA 1JK2A 2YTIA 4WXCA 2PRTA 1HR0E 3P1XA 2EN7A 2EPXA 2L33A 3ECRA 2YTFA 1IQOA 3C4BA 2YTEA 2V89A 2G7HA 4WSPA 5KL7A 4BS9A 2EM6A 1GTKA 1FJGE 2M9AA 4DUZE 3ADGA 2VF1A 5LMUE 1RQ0A 2EPZA 4JI8E 2EL5A 2MC5A 2EOXA 2YRKA 2MDRA 2DSYA 2KONA 4X65E 4LF8E 1X48A 1YYOA 2EN3A 5LMNE 4BC7A 2B7TA 2ZM6E 4F6MA 2GLIA 1YPNA 2MKNA 2YRMA 1A1KA 2RTXA 2KOUA 1IBKE 2LT7A 4M9VC 2EMFA 2YTDA 3UK3C 2EWLA 4R2PA 2VQEE 2EOZA 2VRDA 1YZ9A 4GKKE 1SFEA 3TQMA 1EH6A 3JTZA 3HPSA 4JI7E 2A25A 3ADLA 2L2KB 2EOJA 1A1HA 2DGCA 2M7QA 1EH7A 2WCC3 3HPZA 1YUIA 1IMUA 1BBGA 2LJHA 1G2DC 5FLXC 4GZNC 4O5GA 2VE7C 4KHPE 2DLQA 1T39A 2LV2A 2EPRA 3J7Yp 4DMIA 5AE3A 4DV1E 3L00A 2V88A 2E1MA 4DV6E 1BBOA 2L3JA 1N33E 5T6JA 2NUFA 1SR9A 1QU6A 2R1FA 4X64E 4JI4E 1NCSA 3MSWA 4DV0E 4R2RA 1T4LB 2EMAA 2LJUA 2JOBA 1PJQA 5BR8E 4WPYA 3ZOQB 1X3CA 2LMZA 1TF6A 4NHRA 2I13A 4IS1C 4LF7E 2L8TA 4LF6E 4F9BB 4R2QA 2EM9A 3QG5C 4GEQB 2L2MA 3BIDA 1XNQE 5TSEA
chains in the Genus database with same CATH topology
2N3HA 1HR0E 3P1XA 2JWOA 2UXBE 2L33A 1GQEA 1ZBQA 2LTRA 3KWRA 1X47A 4DKKA 3C4BA 2V89A 2G7HA 4WSPA 4AQYE 3LLHA 4BS9A 1XMQE 2UU9E 4K0KE 4L5NC 1HNZE 1FJGE 4LTYA 1YYKA 4DUZE 2FGGA 2VF1A 3ADGA 3DF6A 4M0VA 4TUGA 5LMUE 1RQ0A 4Q28A 3IWBA 5LL6R 4JI8E 4JI5E 2MC5A 4R03A 2DB2A 2IHR1 3VK6A 2KHXA 2MDRA 4GKJE 2DMYA 4DUYE 4JI1E 2DSYA 2RS6A 2KONA 3IWDA 2ODRD 4F9CB 4X65E 5IT9C 2JR1A 4DV5E 4BBYA 4JI0E 1X48A 2FTXB 2V8QB 1YYOA 4B3TE 4LF8E 4JI6E 4WFTA 2V86A 3C4TA 4BC7A 5LMNE 2B7TA 4DV7E 3JAMC 4M30A 2ZM6E 2NUEA 2L6MA 2WZOA 3VYYA 2L3CA 2E5LE 2B3TB 5AE1A 4BCAA 2CPNA 2JOXA 2RTXA 2DIXA 4R8OA 4X66E 4JI3E 1DI2A 2KOUA 3H09A 4LFBE 1IBKE 1XMOE 1X49A 2FV4B 4DV3E 2UUBE 4L8NA 1PKPA 2EWLA 2ODRC 3J80C 2VQEE 1T4NA 4WYQB 4B3RE 1STUA 2L2NA 1YZ9A 1N34E 4GKKE 2YZTA 2YT4A 2RS7A 3T1YE 2K4VA 3OMLA 2B9DA 3HXLA 3JTZA 4NXME 1J26A 3HPSA 4X62E 4JI7E 3ADLA 1WXRA 4DR2E 2HHHE 2L2KB 4M2ZA 4LF9E 1I94E 3AUZA 1IBME 2LBSB 1J5EE 2UUAE 2M7QA 2F4VE 2UUCE 1UHZA 1GZ6A 2LUPB 3HPZA 5DNYA 4JYAE 4DR3E 4DR7E 5IWAE 4OOGC 4DV4E 2LJHA 2N3GA 4DR5E 4B3SE 5FLXC 1WHQA 2V87A 3F6HA 1T4OA 2VE7C 3JU0A 4J8ZA 3ADIA 4KHPE 4BC9A 2JVAA 4I8OA 1O0WA 4LU9A 1IBLE 3J7Yp 4DMIA 5AE3A 4DV1E 4JI2E 3K6QA 3T1HE 5A2QC 3AV0A 5F3WA 4DR1E 2V88A 2UXDE 2MC6A 1WHNA 2E1MA 4DV6E 3ADJA 5AASA 2L3JA 1N33E 5T6JA 4F9AB 2NUFA 1SR9A 1QU6A 4DV2E 3HTXA 3IWCA 2LE2A 4X64E 4TUIA 1XNRE 2JY9A 4JI4E 3MSWA 2L92A 4DV0E 3VYXA 4BMJA 1T4LB 1UILA 3RMPA 2EZ6A 2LRSA 2VQFE 2NUGA 1ZBTA 1FKAE 2JOBA 2LUQA 4LF4E 1RC7A 5CFFE 4LFAE 1EKZA 3J7AG 5BR8E 1N32E 1HNWE 2V83A 3FIGA 1DQ3A 4WPYA 4P78A 2RSMA 4YHHE 3J81C 1YYWA 2F8BA 2M4IA 3F6GA 3LMLA 4X8WA 4LF5E 4LFCE 4B3ME 4YY3E 2M1SA 3ZOQB 4KZSA 2V85A 2LTSA 2LMZA 3HQ1A 1N36E 5ADZA 4LF7E 2L8TA 4LF6E 2H36X 4F54A 4NXNE 4OX9E 3DJWA 4F9BB 4DR6E 4JV5E 4DR4E 4GEQB 2NA2A 5AE2A 3OTOE 2L2MA 4P7DA 1HNXE 2UXCE 1XNQE 2B7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3H A;  1HR0 E;  3P1X A;  2UXB E;  2L33 A;  1GQE A;  2LTR A;  4DKK A;  1X47 A;  3C4B A;  4AQY E;  1XMQ E;  3LLH A;  2UU9 E;  4K0K E;  1HNZ E;  1FJG E;  1YYK A;  4DUZ E;  3ADG A;  5LMU E;  1RQ0 A;  4JI5 E;  4JI8 E;  2DB2 A;  2IHR 1;  2KHX A;  2MDR A;  4GKJ E;  2DMY A;  4DUY E;  4JI1 E;  2RS6 A;  4X65 E;  4LF5 E;  4NXN E;  4JI0 E;  4LF8 E;  4DV5 E;  1X48 A;  1YYO A;  4B3T E;  4WFT A;  5LMN E;  3C4T A;  4DV7 E;  4JI6 E;  2B7T A;  4M30 A;  2ZM6 E;  2NUE A;  3VYY A;  2L3C A;  2E5L E;  2B3T B;  2CPN A;  2RTX A;  2DIX A;  4X66 E;  4JI3 E;  1DI2 A;  4LFB E;  1IBK E;  1XMO E;  1X49 A;  4DV3 E;  2UUB E;  1PKP A;  2VQE E;  1T4N A;  4WYQ B;  4B3R E;  1STU A;  2L2N A;  1YZ9 A;  1N34 E;  4GKK E;  2YT4 A;  2RS7 A;  3T1Y E;  4NXM E;  1J26 A;  4X62 E;  4JI7 E;  3ADL A;  4DR2 E;  2HHH E;  2L2K B;  4M2Z A;  4LF9 E;  1I94 E;  1IBM E;  2LBS B;  1J5E E;  2UUA E;  2F4V E;  2UUC E;  1UHZ A;  2LUP B;  4JYA E;  4DR3 E;  4DR7 E;  5IWA E;  4OOG C;  4DV4 E;  2LJH A;  2N3G A;  4DR5 E;  4B3S E;  1WHQ A;  3ADI A;  1T4O A;  4KHP E;  2JVA A;  1O0W A;  1IBL E;  3J7Y p;  4DV1 E;  4JI2 E;  3T1H E;  4DR1 E;  2UXD E;  1WHN A;  4DV6 E;  3ADJ A;  2L3J A;  1N33 E;  2NUF A;  1QU6 A;  4DV2 E;  3HTX A;  4X64 E;  1XNR E;  2JY9 A;  4JI4 E;  4DV0 E;  3VYX A;  1T4L B;  1UIL A;  2EZ6 A;  2LRS A;  2VQF E;  2NUG A;  1ZBT A;  1FKA E;  2LUQ A;  4LF4 E;  1RC7 A;  5CFF E;  4LFA E;  1EKZ A;  1HNW E;  5BR8 E;  1N32 E;  2RSM A;  4YHH E;  1YYW A;  4X8W A;  4LFC E;  4B3M E;  4YY3 E;  2LTS A;  1N36 E;  4LF7 E;  4OX9 E;  4LF6 E;  4DR6 E;  4JV5 E;  4DR4 E;  2NA2 A;  3OTO E;  2L2M A;  1HNX E;  2UXC E;  1XNQ E;  2B7V A; 
#chains in the Genus database with same CATH topology
 2JWO A;  2YTQ A;  2LTR A;  1X5W A;  3BGH A;  1YUJ A;  4K0K E;  4IJD A;  2EMX A;  1YYK A;  2DRP A;  2JP9 A;  2FGG A;  3DF6 A;  1YFH A;  4M0V A;  5KL5 A;  5LL6 R;  4R03 A;  2IHR 1;  3VK6 A;  2EM0 A;  4DUY E;  3MHS C;  4LF5 E;  2EOO A;  1AH5 A;  4WX9 A;  4B3T E;  4HTG A;  1MGT A;  2V8Q B;  4RH8 A;  1A1I A;  4JI6 E;  4M30 A;  2YTN A;  2L6M A;  2WZO A;  2EMC A;  2E5L E;  5A6A A;  2JOX A;  2DIX A;  2EQ0 A;  4JI3 E;  1DI2 A;  3H09 A;  2R76 A;  1ZAA C;  1X49 A;  4R2D A;  1X6F A;  2UUB E;  2ODR C;  4O4K A;  1STU A;  2RS7 A;  2EM5 A;  2HGH A;  3HXL A;  4NXM E;  3BBG A;  4X62 E;  2EM4 A;  2HHH E;  3KZY A;  4LF9 E;  1WRJ A;  1J5E E;  2GPI A;  3C6K A;  2EL4 A;  2LUP B;  4DR3 E;  4DR7 E;  4DV4 E;  4DR5 E;  2N3G A;  5AC5 A;  2MDG A;  4FK5 C;  1WHQ A;  1N3G A;  2V87 A;  3JU0 A;  2JXP A;  1O0W A;  2WBU A;  4JI2 E;  3K6Q A;  3T1H E;  1UN6 B;  2EPA A;  2EN6 A;  2YU8 A;  3AV0 A;  2EMG A;  4DR1 E;  1WHN A;  1A1L A;  2LVH A;  4O24 A;  2EM3 A;  4F9A B;  3EPH A;  3IWC A;  2EJ4 A;  4TUI A;  1XNR E;  3VYX A;  4MLV A;  2GHF A;  1P47 A;  1UIL A;  3THN A;  2EZ6 A;  2LRS A;  2VQF E;  2LUQ A;  4LF4 E;  5CFF E;  5IXM B;  1PJS A;  2EN1 A;  4LFA E;  3J7A G;  1BB8 A;  2F8B A;  3F6G A;  4LFC E;  2YSO A;  2EMB A;  2YSP A;  2HJJ A;  2NA2 A;  5AE2 A;  4RHB B;  4WSG A;  2EPN A;  2B7V A;  1ZBQ A;  3KWR A;  4DKK A;  1X47 A;  2YPN A;  4AQY E;  2UU9 E;  4L5N C;  2E72 A;  2DLK A;  4LTY A;  2EN2 A;  3IWB A;  2ENC A;  4JI5 E;  2DB2 A;  2KHX A;  4R2C A;  2ODR D;  2YTJ A;  4F9C B;  5IT9 C;  2FTX B;  2K7I A;  2V86 A;  4WFT A;  2CSH A;  5AE1 A;  2BBG A;  4R8O A;  4X66 E;  4LFB E;  2I9I A;  2EPK X;  2HC5 A;  5KL6 A;  2FV4 B;  1UBD C;  4L8N A;  2EM7 A;  1T4N A;  2EOY A;  4WYQ B;  1QNT A;  1RMD A;  2L2N A;  4R2E A;  5LLQ A;  2EP3 A;  1WXR A;  4DR2 E;  2EOS A;  1I94 E;  1L4S A;  2LBS B;  3BF2 A;  3EQ1 A;  2EOI A;  2F4V E;  1AAY A;  1F2I G;  2ENH A;  1UHZ A;  3VHT B;  2ENA A;  5A69 A;  5DNY A;  2MKD A;  4JYA E;  5IWA E;  1X6H A;  4B3S E;  2EMZ A;  3F6H A;  1T4O A;  4J8Z A;  1PDA A;  4I8O A;  1A1G A;  4LU9 A;  2EE8 A;  2WBT A;  2ELY A;  5A6K A;  2EMK A;  2EMW A;  3ADJ A;  1T38 A;  2EPP A;  3EPL A;  4DV2 E;  2LE2 A;  2EOR A;  1IQS A;  2EMI A;  2JY9 A;  2L92 A;  1TN9 A;  1YSA C;  2YTP A;  2EN4 A;  1FKA E;  2EOE A;  2EM2 A;  1RC7 A;  3C6M A;  5A6J A;  1EKZ A;  2YRH A;  1N32 E;  3FIG A;  1DQ3 A;  2EMH A;  2RSM A;  4YHH E;  3J81 C;  4X8W A;  2M4I A;  3LML A;  4BHC A;  4B3M E;  2M1S A;  2V85 A;  2RQL A;  5KL2 A;  4F6N A;  4Q35 B;  5ADZ A;  4F54 A;  2WBS A;  3OTO E;  5A6B A;  1HNX E;  2YTO A;  2UXC E;  2N3H A;  2UXB E;  1GQE A;  2JYA A;  1XMQ E;  3LLH A;  1A1F A;  1HNZ E;  4TUG A;  4Q28 A;  2ELZ A;  2EN8 A;  1G2F C;  1KYQ A;  2EOQ A;  2EPC A;  4GKJ E;  2DMY A;  4JI1 E;  2RS6 A;  3IWD A;  4NXN E;  2EOM A;  4JI0 E;  2JR1 A;  3KZZ A;  4BBY A;  4DV5 E;  4ZYH A;  4DV7 E;  3C4T A;  3JAM C;  4O43 A;  2NUE A;  2YU5 A;  1NEI A;  3VYY A;  2L3C A;  2B3T B;  4BCA A;  2CPN A;  1PJT A;  2EQ1 A;  2EMY A;  3EPK A;  4WXD A;  5A6B D;  2NAB A;  1XMO E;  4DV3 E;  2EOF A;  1PKP A;  3J80 C;  1B69 A;  4B3R E;  1N34 E;  2EML A;  2YZT A;  2YT4 A;  3T1Y E;  2K4V A;  3EPJ A;  2ADR A;  2LO3 A;  3OML A;  4F2J C;  2B9D A;  1A1J A;  1J26 A;  4M2Z A;  4NZV A;  4KWY A;  2DMI A;  3AUZ A;  1IBM E;  3THO B;  2UUA E;  4ZYD A;  5AC4 A;  2UUC E;  2EPM X;  1GZ6 A;  2RSI A;  1KJK A;  2EPU A;  4R2S A;  4HEI A;  4OOG C;  2BB8 A;  4N4R B;  2YWQ A;  1LLM C;  2EQ3 A;  3ADI A;  1JK1 A;  4BHB A;  4BC9 A;  2EOH A;  2JVA A;  1X6E A;  1IBL E;  1WJP A;  2EPO A;  2JPA A;  2Q8U A;  1TF3 A;  5A2Q C;  2CTD A;  5F3W A;  4R2A A;  2UXD E;  5KL4 A;  2MC6 A;  5AAS A;  4ZYG A;  2YTG A;  3HTX A;  3M99 B;  1Z1B A;  4BMJ A;  2EPL X;  3RMP A;  4ZYE A;  2NUG A;  1ZBT A;  5KL3 A;  2D9H A;  2LCE A;  1HNW E;  2V83 A;  1DGC A;  1MEY C;  4P78 A;  1EH8 A;  1YYW A;  2EL6 A;  4YY3 E;  4KZS A;  2EM8 A;  2N8X A;  2LTS A;  1ZR9 A;  5IV8 B;  2RPC A;  4X9J A;  1ZU1 A;  3HQ1 A;  1N36 E;  4OX9 E;  3MHH C;  2H36 X;  3DJW A;  2CT1 A;  4MLQ A;  4DR6 E;  4DR4 E;  4JV5 E;  2J7J A;  4P7D A;  1JK2 A;  2YTI A;  4WXC A;  2PRT A;  1HR0 E;  3P1X A;  2EN7 A;  2EPX A;  2L33 A;  3ECR A;  2YTF A;  1IQO A;  3C4B A;  2YTE A;  2V89 A;  2G7H A;  4WSP A;  5KL7 A;  4BS9 A;  2EM6 A;  1GTK A;  1FJG E;  2M9A A;  4DUZ E;  3ADG A;  2VF1 A;  5LMU E;  1RQ0 A;  2EPZ A;  4JI8 E;  2EL5 A;  2MC5 A;  2EOX A;  2YRK A;  2MDR A;  2DSY A;  2KON A;  4X65 E;  4LF8 E;  1X48 A;  1YYO A;  2EN3 A;  5LMN E;  4BC7 A;  2B7T A;  2ZM6 E;  4F6M A;  2GLI A;  1YPN A;  2MKN A;  2YRM A;  1A1K A;  2RTX A;  2KOU A;  1IBK E;  2LT7 A;  4M9V C;  2EMF A;  2YTD A;  3UK3 C;  2EWL A;  4R2P A;  2VQE E;  2EOZ A;  2VRD A;  1YZ9 A;  4GKK E;  1SFE A;  3TQM A;  1EH6 A;  3JTZ A;  3HPS A;  4JI7 E;  2A25 A;  3ADL A;  2L2K B;  2EOJ A;  1A1H A;  2DGC A;  2M7Q A;  1EH7 A;  2WCC 3;  3HPZ A;  1YUI A;  1IMU A;  1BBG A;  2LJH A;  1G2D C;  5FLX C;  4GZN C;  4O5G A;  2VE7 C;  4KHP E;  2DLQ A;  1T39 A;  2LV2 A;  2EPR A;  3J7Y p;  4DMI A;  5AE3 A;  4DV1 E;  3L00 A;  2V88 A;  2E1M A;  4DV6 E;  1BBO A;  2L3J A;  1N33 E;  5T6J A;  2NUF A;  1SR9 A;  1QU6 A;  2R1F A;  4X64 E;  4JI4 E;  1NCS A;  3MSW A;  4DV0 E;  4R2R A;  1T4L B;  2EMA A;  2LJU A;  2JOB A;  1PJQ A;  5BR8 E;  4WPY A;  3ZOQ B;  1X3C A;  2LMZ A;  1TF6 A;  4NHR A;  2I13 A;  4IS1 C;  4LF7 E;  2L8T A;  4LF6 E;  4F9B B;  4R2Q A;  2EM9 A;  3QG5 C;  4GEQ B;  2L2M A;  3BID A;  1XNQ E;  5TSE A; 
#chains in the Genus database with same CATH homology
 2N3H A;  1HR0 E;  3P1X A;  2JWO A;  2UXB E;  2L33 A;  1GQE A;  1ZBQ A;  2LTR A;  3KWR A;  1X47 A;  4DKK A;  3C4B A;  2V89 A;  2G7H A;  4WSP A;  4AQY E;  3LLH A;  4BS9 A;  1XMQ E;  2UU9 E;  4K0K E;  4L5N C;  1HNZ E;  1FJG E;  4LTY A;  1YYK A;  4DUZ E;  2FGG A;  2VF1 A;  3ADG A;  3DF6 A;  4M0V A;  4TUG A;  5LMU E;  1RQ0 A;  4Q28 A;  3IWB A;  5LL6 R;  4JI8 E;  4JI5 E;  2MC5 A;  4R03 A;  2DB2 A;  2IHR 1;  3VK6 A;  2KHX A;  2MDR A;  4GKJ E;  2DMY A;  4DUY E;  4JI1 E;  2DSY A;  2RS6 A;  2KON A;  3IWD A;  2ODR D;  4F9C B;  4X65 E;  5IT9 C;  2JR1 A;  4DV5 E;  4BBY A;  4JI0 E;  1X48 A;  2FTX B;  2V8Q B;  1YYO A;  4B3T E;  4LF8 E;  4JI6 E;  4WFT A;  2V86 A;  3C4T A;  4BC7 A;  5LMN E;  2B7T A;  4DV7 E;  3JAM C;  4M30 A;  2ZM6 E;  2NUE A;  2L6M A;  2WZO A;  3VYY A;  2L3C A;  2E5L E;  2B3T B;  5AE1 A;  4BCA A;  2CPN A;  2JOX A;  2RTX A;  2DIX A;  4R8O A;  4X66 E;  4JI3 E;  1DI2 A;  2KOU A;  3H09 A;  4LFB E;  1IBK E;  1XMO E;  1X49 A;  2FV4 B;  4DV3 E;  2UUB E;  4L8N A;  1PKP A;  2EWL A;  2ODR C;  3J80 C;  2VQE E;  1T4N A;  4WYQ B;  4B3R E;  1STU A;  2L2N A;  1YZ9 A;  1N34 E;  4GKK E;  2YZT A;  2YT4 A;  2RS7 A;  3T1Y E;  2K4V A;  3OML A;  2B9D A;  3HXL A;  3JTZ A;  4NXM E;  1J26 A;  3HPS A;  4X62 E;  4JI7 E;  3ADL A;  1WXR A;  4DR2 E;  2HHH E;  2L2K B;  4M2Z A;  4LF9 E;  1I94 E;  3AUZ A;  1IBM E;  2LBS B;  1J5E E;  2UUA E;  2M7Q A;  2F4V E;  2UUC E;  1UHZ A;  1GZ6 A;  2LUP B;  3HPZ A;  5DNY A;  4JYA E;  4DR3 E;  4DR7 E;  5IWA E;  4OOG C;  4DV4 E;  2LJH A;  2N3G A;  4DR5 E;  4B3S E;  5FLX C;  1WHQ A;  2V87 A;  3F6H A;  1T4O A;  2VE7 C;  3JU0 A;  4J8Z A;  3ADI A;  4KHP E;  4BC9 A;  2JVA A;  4I8O A;  1O0W A;  4LU9 A;  1IBL E;  3J7Y p;  4DMI A;  5AE3 A;  4DV1 E;  4JI2 E;  3K6Q A;  3T1H E;  5A2Q C;  3AV0 A;  5F3W A;  4DR1 E;  2V88 A;  2UXD E;  2MC6 A;  1WHN A;  2E1M A;  4DV6 E;  3ADJ A;  5AAS A;  2L3J A;  1N33 E;  5T6J A;  4F9A B;  2NUF A;  1SR9 A;  1QU6 A;  4DV2 E;  3HTX A;  3IWC A;  2LE2 A;  4X64 E;  4TUI A;  1XNR E;  2JY9 A;  4JI4 E;  3MSW A;  2L92 A;  4DV0 E;  3VYX A;  4BMJ A;  1T4L B;  1UIL A;  3RMP A;  2EZ6 A;  2LRS A;  2VQF E;  2NUG A;  1ZBT A;  1FKA E;  2JOB A;  2LUQ A;  4LF4 E;  1RC7 A;  5CFF E;  4LFA E;  1EKZ A;  3J7A G;  5BR8 E;  1N32 E;  1HNW E;  2V83 A;  3FIG A;  1DQ3 A;  4WPY A;  4P78 A;  2RSM A;  4YHH E;  3J81 C;  1YYW A;  2F8B A;  2M4I A;  3F6G A;  3LML A;  4X8W A;  4LF5 E;  4LFC E;  4B3M E;  4YY3 E;  2M1S A;  3ZOQ B;  4KZS A;  2V85 A;  2LTS A;  2LMZ A;  3HQ1 A;  1N36 E;  5ADZ A;  4LF7 E;  2L8T A;  4LF6 E;  2H36 X;  4F54 A;  4NXN E;  4OX9 E;  3DJW A;  4F9B B;  4DR6 E;  4JV5 E;  4DR4 E;  4GEQ B;  2NA2 A;  5AE2 A;  3OTO E;  2L2M A;  4P7D A;  1HNX E;  2UXC E;  1XNQ E;  2B7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...