1X3CA

Solution structure of the c2h2 type zinc-binding domain of human zinc finger protein 292
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
GSSGSSGRKKPVSQSLEFPTRYSPYRPYRCVHQGCFAAFTIQQNLILHYQAVHKSDLPAFSAEVEEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 292
publication title Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 292
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1x3cA00
2EL6A 2EPCA 2PRTA 2YTFA 2EMXA 2EM0A 2EMWA 2WCC3 2YTDA 2EOMA 2EMZA 1ZR9A 2ADRA 2EPRA 1A1HA 3EPJA 2EOXA 3UK3C 1MEYC 2I13A 2YSOA 1YUIA 2CSHA 2YTNA 1A1LA 2EMCA 4X9JA 5KL7A 2EM6A 2YU8A 3MHSC 2EE8A 1A1FA 4IS1C 2EQ1A 1YUJA 1A1GA 1RMDA 3M99B 2LV2A 2RPCA 5KL3A 2EOSA 1BBOA 1JK1A 2VRDA 1X3CA 2YTOA 2JP9A 4IJDA 2EQ3A 2EOJA 2EOQA 2LVHA 4GZNC 2EJ4A 2YTQA 1BB8A 1A1KA 2NABA 5KL2A 2EN8A 4R2QA 1TF6A 2EOOA 1YSAC 2D9HA 2EOIA 2EM4A 2YRKA 2LCEA 2EM8A 2MDGA 2ELYA 1LLMC 2JPAA 1A1IA 1A1JA 2ELZA 2GLIA 4R2EA 2YTEA 2EOYA 2M9AA 4R2SA 2EMIA 2GHFA 2EMAA 2EMBA 2YRMA 2EMFA 1UBDC 2DMIA 2DRPA 3EPLA 2EMKA 2EN3A 2YTIA 2EMLA 1X5WA 1X6HA 4F2JC 2EPUA 4FK5C 3EPHA 4R2CA 2EORA 2EPAA 2EQ0A 4WSGA 1ZAAC 2EM3A 2ENCA 2LO3A 1Z1BA 1X6FA 2EOZA 2EPXA 4R2AA 2CTDA 2EPZA 2WBSA 2YTJA 1B69A 1G2FC 4F6NA 1JK2A 2EM9A 2EN1A 1DGCA 5KL4A 4R2RA 2RSIA 2ENAA 2EN4A 2ENHA 2E72A 1KJKA 2EL4A 2EN7A 2A25A 2CT1A 1AAYA 2EMYA 4M9VC 2MKNA 1NCSA 2EM2A 5KL6A 2EPPA 2R1FA 2EMHA 2WBTA 3VHTB 2DGCA 2MKDA 2HGHA 2EM5A 3EPKA 1X6EA 2EOHA 2EN2A 2J7JA 1TF3A 4F6MA 2YU5A 2BB8A 2EM7A 1ZU1A 3MHHC 2DLKA 2WBUA 2EL5A 2DLQA 2EN6A 5KL5A 1P47A 2EOFA 2YTGA 2YSPA 2EOEA 4R2DA 1WJPA 1TN9A 2LT7A 1UN6B 1G2DC 2YTPA 4R2PA 2EMGA 2YRHA 1F2IG 2EP3A
chains in the Genus database with same CATH superfamily
1UHZA 4DR2E 2HHHE 2E1MA 2EMXA 2WCC3 2EMWA 3LLHA 1T38A 1RC7A 2EPRA 2B7TA 3THOB 3QG5C 1A1HA 3EPJA 1PKPA 2I13A 2YSOA 2L3JA 1YUIA 4DR4E 1N33E 1EH6A 5KL7A 2EQ1A 1HR0E 4R8OA 1X49A 2JOBA 1RMDA 2KHXA 5A2QC 2LV2A 2EZ6A 2FGGA 3ADGA 2EQ3A 4GZNC 4BHCA 4M0VA 2NABA 2YT4A 2EOOA 3J7Yp 2EOIA 2YRKA 2EPLX 5T6JA 3HPZA 3LMLA 3KZYA 3P1XA 2M7QA 4NHRA 5FLXC 1LLMC 1A1IA 4BMJA 4DMIA 3DJWA 1GQEA 2M9AA 3ADLA 2YRMA 2EMFA 2DMIA 3OTOE 3AV0A 1XNRE 2EMKA 2EN3A 2UXCE 4WPYA 1X5WA 2EPUA 3EPHA 1X47A 3BIDA 2VQFE 4WSGA 4BHBA 4YHHE 4GKKE 1X6FA 1IBKE 3MSWA 2MC5A 1WXRA 4F6NA 4GEQB 2EM9A 2RQLA 1DGCA 5KL4A 4WXDA 1DQ3A 3JTZA 2E72A 2VE7C 1HNZE 2A25A 2EPNA 2DSYA 2HC5A 3BF2A 2MKNA 1DI2A 2RTXA 5KL6A 2EPPA 2ODRD 4DV1E 2HGHA 4LFAE 1IBME 2JVAA 3EPKA 5A6BA 3RMPA 2LUQA 4NZVA 4BS9A 2UUCE 2N3HA 4MLVA 4F6MA 3ADIA 1YPNA 2BB8A 2V85A 3DF6A 3MHHC 2DLKA 2WZOA 2L2KB 3ECRA 2ODRC 2EOFA 2EOEA 4R2DA 2JWOA 4JI4E 4LF7E 4R2PA 2YRHA 2E5LE 4JI3E 1XMQE 5ADZA 2L33A 2EL6A 2EPCA 2YTFA 2EM0A 2YTDA 2EMZA 4M30A 1KYQA 4DV7E 4DR6E 4K0KE 2YPNA 2CSHA 2L2MA 2YTNA 2LJUA 4F9AB 5AE3A 4DV6E 2VQEE 5LL6R 2YU8A 5A69A 2G7HA 1A1FA 1YUJA 4MLQA 2V88A 4DR7E 2RPCA 5KL3A 2EOSA 1JK1A 2NUGA 2EOJA 2EOQA 2LTSA 2LVHA 4O5GA 2EJ4A 1BB8A 4R2QA 1TF6A 1FJGE 2D9HA 2EM4A 2EM8A 3J7AG 2MDGA 2JYAA 2UUBE 2ELYA 2V86A 2F4VE 4ZYHA 2V83A 1UILA 2JPAA 1WHNA 2UXBE 2GLIA 4R2EA 2YTEA 4R2SA 1PJTA 2EMAA 4LF9E 2EMBA 1UBDC 3HTXA 4NXNE 1ZBQA 3EPLA 4JI6E 4L8NA 1IQOA 3HXLA 4FK5C 2B3TB 4O24A 2EORA 1YYOA 4JI2E 4X66E 2DMYA 2EM3A 2ENCA 5LMUE 3THNA 3FIGA 2EPZA 4M2ZA 2WBSA 1IQSA 2YTJA 1G2FC 2EN1A 2FV4B 2RSIA 4LF8E 5IT9C 2EPOA 1MGTA 4DKKA 1XNQE 1T39A 2EM2A 2JR1A 4WX9A 4B3TE 1YZ9A 1N32E 4JI8E 2MKDA 2RS6A 2EM5A 4WSPA 4P7DA 4X62E 3AUZA 3KZZA 2EWLA 2J7JA 1SFEA 2YU5A 1QU6A 1SR9A 5TSEA 3F6GA 4ZYGA 2ZM6E 4DR3E 2UUAE 2VF1A 4X8WA 4BC7A 1UN6B 1WJPA 5AASA 2IHR1 1NEIA 2KONA 4HTGA 4DV3E 1X48A 4GKJE 2EMGA 1YYWA 2GPIA 2EP3A 4DUYE 4AQYE 3HQ1A 1PJSA 1WRJA 4LTYA 4LU9A 3L00A 2EOMA 2MC6A 4TUIA 1ZR9A 4TUGA 3J80C 2JXPA 3C4BA 4B3ME 2EOXA 3UK3C 2NUFA 4JI1E 3ZOQB 5A6AA 2YWQA 4BBYA 1EKZA 2EMCA 5AC5A 2N8XA 2EM6A 2EE8A 1A1GA 2L2NA 3J81C 4KHPE 4Q28A 3M99B 2CPNA 4LF6E 2LBSB 2VRDA 4LF4E 3BGHA 4DR1E 4IJDA 2YTQA 4HEIA 4NXME 3JU0A 1RQ0A 5CFFE 3HPSA 3VYXA 1GZ6A 2YZTA 4LFCE 2EPMX 2ELZA 4X64E 2BBGA 4JI7E 2EOYA 4L5NC 2EMIA 4DUZE 2F8BA 2GHFA 4DR5E 3C6MA 1J5EE 1T4LB 1BBGA 1QNTA 1WHQA 2K7IA 4DV4E 1STUA 2EMLA 2JY9A 4DV5E 1IBLE 4R2CA 3VYYA 2EQ0A 2M4IA 4WFTA 4ZYEA 2LO3A 2UU9E 4DV2E 1L4SA 2EOZA 1EH8A 2EPXA 4JV5E 4N4RB 1B69A 1YYKA 1JK2A 2V87A 4RHBB 3TQMA 5A6JA 2ENAA 2EN4A 2EN7A 3T1HE 3VK6A 1NCSA 2R1FA 2WBTA 3VHTB 2DGCA 1FKAE 4JI5E 4R03A 1N34E 5AE1A 2H36X 2EOHA 2EN2A 1TF3A 4B3SE 3ADJA 4RH8A 3IWBA 2I9IA 2FTXB 5KL5A 1HNXE 2MDRA 4F9CB 2LT7A 1G2DC 2YTPA 4J8ZA 2L3CA 1F2IG 4F54A 4YY3E 1PDAA 1AH5A 5LMNE 2PRTA 2EPKX 2ADRA 4BCAA 4X65E 1XMOE 2LE2A 4JI0E 4Q35B 1MEYC 1N3GA 1A1LA 4WYQB 2L8TA 4X9JA 4LFBE 4BC9A 4B3RE 3MHSC 3BBGA 3IWDA 4IS1C 4O4KA 5LLQA 4LF5E 2LUPB 3C6KA 1N36E 5DNYA 1BBOA 2YTOA 1X3CA 5AC4A 3KWRA 5BR8E 2JP9A 4KWYA 2B7VA 3C4TA 2M1SA 1A1KA 4O43A 5KL2A 2EN8A 2N3GA 5AE2A 1YSAC 5IWAE 5IV8B 1T4OA 2LCEA 2NUEA 1HNWE 2Q8UA 1A1JA 2L6MA 2UXDE 1T4NA 2RSMA 4OX9E 2DRPA 1EH7A 1O0WA 2R76A 2YTIA 2DB2A 1X6HA 4F2JC 2NA2A 5A6KA 2K4VA 2EPAA 3JAMC 1ZAAC 1I94E 2RS7A 1Z1BA 3F6HA 3H09A 2V89A 4R2AA 2CTDA 3EQ1A 3T1YE 4R2RA 3K6QA 4WXCA 3IWCA 1J26A 4DV0E 1YFHA 1KJKA 2ENHA 2EL4A 5IXMB 2CT1A 1AAYA 2EMYA 4M9VC 5A6BD 3OMLA 2V8QB 2JOXA 2L92A 2HJJA 2EMHA 4F9BB 4JYAE 2DIXA 2KOUA 4ZYDA 2LRSA 1IMUA 1PJQA 1X6EA 1GTKA 1ZBTA 4I8OA 4P78A 2EM7A 1ZU1A 2B9DA 2WBUA 2EL5A 2DLQA 2EN6A 1P47A 2LMZA 2YTGA 2YSPA 1TN9A 2LJHA 5F3WA 2LTRA 4OOGC 4KZSA
chains in the Genus database with same CATH topology
2EL6A 2EPCA 2PRTA 2YTFA 2EMXA 2EM0A 2EMWA 2WCC3 2YTDA 2EOMA 2EMZA 1ZR9A 2ADRA 2EPRA 1A1HA 3EPJA 2EOXA 3UK3C 1MEYC 2I13A 2YSOA 1YUIA 2CSHA 2YTNA 1A1LA 2EMCA 4X9JA 5KL7A 2EM6A 2YU8A 3MHSC 2EE8A 1A1FA 4IS1C 2EQ1A 1YUJA 1A1GA 1RMDA 3M99B 2LV2A 2RPCA 5KL3A 2EOSA 1BBOA 1JK1A 2VRDA 1X3CA 2YTOA 2JP9A 4IJDA 2EQ3A 2EOJA 2EOQA 2LVHA 4GZNC 2EJ4A 2YTQA 1BB8A 1A1KA 2NABA 5KL2A 2EN8A 4R2QA 1TF6A 2EOOA 1YSAC 2D9HA 2EOIA 2EM4A 2YRKA 2LCEA 2EM8A 2MDGA 2ELYA 1LLMC 2JPAA 1A1IA 1A1JA 2ELZA 2GLIA 4R2EA 2YTEA 2EOYA 2M9AA 4R2SA 2EMIA 2GHFA 2EMAA 2EMBA 2YRMA 2EMFA 1UBDC 2DMIA 2DRPA 3EPLA 2EMKA 2EN3A 2YTIA 2EMLA 1X5WA 1X6HA 4F2JC 2EPUA 4FK5C 3EPHA 4R2CA 2EORA 2EPAA 2EQ0A 4WSGA 1ZAAC 2EM3A 2ENCA 2LO3A 1Z1BA 1X6FA 2EOZA 2EPXA 4R2AA 2CTDA 2EPZA 2WBSA 2YTJA 1B69A 1G2FC 4F6NA 1JK2A 2EM9A 2EN1A 1DGCA 5KL4A 4R2RA 2RSIA 2ENAA 2EN4A 2ENHA 2E72A 1KJKA 2EL4A 2EN7A 2A25A 2CT1A 1AAYA 2EMYA 4M9VC 2MKNA 1NCSA 2EM2A 5KL6A 2EPPA 2R1FA 2EMHA 2WBTA 3VHTB 2DGCA 2MKDA 2HGHA 2EM5A 3EPKA 1X6EA 2EOHA 2EN2A 2J7JA 1TF3A 4F6MA 2YU5A 2BB8A 2EM7A 1ZU1A 3MHHC 2DLKA 2WBUA 2EL5A 2DLQA 2EN6A 5KL5A 1P47A 2EOFA 2YTGA 2YSPA 2EOEA 4R2DA 1WJPA 1TN9A 2LT7A 1UN6B 1G2DC 2YTPA 4R2PA 2EMGA 2YRHA 1F2IG 2EP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL6 A;  2EPC A;  2PRT A;  2YTF A;  2EMX A;  2EM0 A;  2EMW A;  2WCC 3;  2YTD A;  2EOM A;  2EMZ A;  1ZR9 A;  2ADR A;  2EPR A;  1A1H A;  3EPJ A;  2EOX A;  3UK3 C;  1MEY C;  2I13 A;  2YSO A;  1YUI A;  2CSH A;  2YTN A;  1A1L A;  2EMC A;  4X9J A;  5KL7 A;  2EM6 A;  2YU8 A;  3MHS C;  2EE8 A;  1A1F A;  4IS1 C;  2EQ1 A;  1YUJ A;  1A1G A;  1RMD A;  3M99 B;  2LV2 A;  2RPC A;  5KL3 A;  2EOS A;  1BBO A;  1JK1 A;  2VRD A;  1X3C A;  2YTO A;  2JP9 A;  4IJD A;  2EQ3 A;  2EOJ A;  2EOQ A;  2LVH A;  4GZN C;  2EJ4 A;  2YTQ A;  1BB8 A;  1A1K A;  2NAB A;  5KL2 A;  2EN8 A;  4R2Q A;  1TF6 A;  2EOO A;  1YSA C;  2D9H A;  2EOI A;  2EM4 A;  2YRK A;  2LCE A;  2EM8 A;  2MDG A;  2ELY A;  1LLM C;  2JPA A;  1A1I A;  1A1J A;  2ELZ A;  2GLI A;  4R2E A;  2YTE A;  2EOY A;  2M9A A;  4R2S A;  2EMI A;  2GHF A;  2EMA A;  2EMB A;  2YRM A;  2EMF A;  1UBD C;  2DMI A;  2DRP A;  3EPL A;  2EMK A;  2EN3 A;  2YTI A;  2EML A;  1X5W A;  1X6H A;  4F2J C;  2EPU A;  4FK5 C;  3EPH A;  4R2C A;  2EOR A;  2EPA A;  2EQ0 A;  4WSG A;  1ZAA C;  2EM3 A;  2ENC A;  2LO3 A;  1Z1B A;  1X6F A;  2EOZ A;  2EPX A;  4R2A A;  2CTD A;  2EPZ A;  2WBS A;  2YTJ A;  1B69 A;  1G2F C;  4F6N A;  1JK2 A;  2EM9 A;  2EN1 A;  1DGC A;  5KL4 A;  4R2R A;  2RSI A;  2ENA A;  2EN4 A;  2ENH A;  2E72 A;  1KJK A;  2EL4 A;  2EN7 A;  2A25 A;  2CT1 A;  1AAY A;  2EMY A;  4M9V C;  2MKN A;  1NCS A;  2EM2 A;  5KL6 A;  2EPP A;  2R1F A;  2EMH A;  2WBT A;  3VHT B;  2DGC A;  2MKD A;  2HGH A;  2EM5 A;  3EPK A;  1X6E A;  2EOH A;  2EN2 A;  2J7J A;  1TF3 A;  4F6M A;  2YU5 A;  2BB8 A;  2EM7 A;  1ZU1 A;  3MHH C;  2DLK A;  2WBU A;  2EL5 A;  2DLQ A;  2EN6 A;  5KL5 A;  1P47 A;  2EOF A;  2YTG A;  2YSP A;  2EOE A;  4R2D A;  1WJP A;  1TN9 A;  2LT7 A;  1UN6 B;  1G2D C;  2YTP A;  4R2P A;  2EMG A;  2YRH A;  1F2I G;  2EP3 A; 
#chains in the Genus database with same CATH topology
 1UHZ A;  4DR2 E;  2HHH E;  2E1M A;  2EMX A;  2WCC 3;  2EMW A;  3LLH A;  1T38 A;  1RC7 A;  2EPR A;  2B7T A;  3THO B;  3QG5 C;  1A1H A;  3EPJ A;  1PKP A;  2I13 A;  2YSO A;  2L3J A;  1YUI A;  4DR4 E;  1N33 E;  1EH6 A;  5KL7 A;  2EQ1 A;  1HR0 E;  4R8O A;  1X49 A;  2JOB A;  1RMD A;  2KHX A;  5A2Q C;  2LV2 A;  2EZ6 A;  2FGG A;  3ADG A;  2EQ3 A;  4GZN C;  4BHC A;  4M0V A;  2NAB A;  2YT4 A;  2EOO A;  3J7Y p;  2EOI A;  2YRK A;  2EPL X;  5T6J A;  3HPZ A;  3LML A;  3KZY A;  3P1X A;  2M7Q A;  4NHR A;  5FLX C;  1LLM C;  1A1I A;  4BMJ A;  4DMI A;  3DJW A;  1GQE A;  2M9A A;  3ADL A;  2YRM A;  2EMF A;  2DMI A;  3OTO E;  3AV0 A;  1XNR E;  2EMK A;  2EN3 A;  2UXC E;  4WPY A;  1X5W A;  2EPU A;  3EPH A;  1X47 A;  3BID A;  2VQF E;  4WSG A;  4BHB A;  4YHH E;  4GKK E;  1X6F A;  1IBK E;  3MSW A;  2MC5 A;  1WXR A;  4F6N A;  4GEQ B;  2EM9 A;  2RQL A;  1DGC A;  5KL4 A;  4WXD A;  1DQ3 A;  3JTZ A;  2E72 A;  2VE7 C;  1HNZ E;  2A25 A;  2EPN A;  2DSY A;  2HC5 A;  3BF2 A;  2MKN A;  1DI2 A;  2RTX A;  5KL6 A;  2EPP A;  2ODR D;  4DV1 E;  2HGH A;  4LFA E;  1IBM E;  2JVA A;  3EPK A;  5A6B A;  3RMP A;  2LUQ A;  4NZV A;  4BS9 A;  2UUC E;  2N3H A;  4MLV A;  4F6M A;  3ADI A;  1YPN A;  2BB8 A;  2V85 A;  3DF6 A;  3MHH C;  2DLK A;  2WZO A;  2L2K B;  3ECR A;  2ODR C;  2EOF A;  2EOE A;  4R2D A;  2JWO A;  4JI4 E;  4LF7 E;  4R2P A;  2YRH A;  2E5L E;  4JI3 E;  1XMQ E;  5ADZ A;  2L33 A;  2EL6 A;  2EPC A;  2YTF A;  2EM0 A;  2YTD A;  2EMZ A;  4M30 A;  1KYQ A;  4DV7 E;  4DR6 E;  4K0K E;  2YPN A;  2CSH A;  2L2M A;  2YTN A;  2LJU A;  4F9A B;  5AE3 A;  4DV6 E;  2VQE E;  5LL6 R;  2YU8 A;  5A69 A;  2G7H A;  1A1F A;  1YUJ A;  4MLQ A;  2V88 A;  4DR7 E;  2RPC A;  5KL3 A;  2EOS A;  1JK1 A;  2NUG A;  2EOJ A;  2EOQ A;  2LTS A;  2LVH A;  4O5G A;  2EJ4 A;  1BB8 A;  4R2Q A;  1TF6 A;  1FJG E;  2D9H A;  2EM4 A;  2EM8 A;  3J7A G;  2MDG A;  2JYA A;  2UUB E;  2ELY A;  2V86 A;  2F4V E;  4ZYH A;  2V83 A;  1UIL A;  2JPA A;  1WHN A;  2UXB E;  2GLI A;  4R2E A;  2YTE A;  4R2S A;  1PJT A;  2EMA A;  4LF9 E;  2EMB A;  1UBD C;  3HTX A;  4NXN E;  1ZBQ A;  3EPL A;  4JI6 E;  4L8N A;  1IQO A;  3HXL A;  4FK5 C;  2B3T B;  4O24 A;  2EOR A;  1YYO A;  4JI2 E;  4X66 E;  2DMY A;  2EM3 A;  2ENC A;  5LMU E;  3THN A;  3FIG A;  2EPZ A;  4M2Z A;  2WBS A;  1IQS A;  2YTJ A;  1G2F C;  2EN1 A;  2FV4 B;  2RSI A;  4LF8 E;  5IT9 C;  2EPO A;  1MGT A;  4DKK A;  1XNQ E;  1T39 A;  2EM2 A;  2JR1 A;  4WX9 A;  4B3T E;  1YZ9 A;  1N32 E;  4JI8 E;  2MKD A;  2RS6 A;  2EM5 A;  4WSP A;  4P7D A;  4X62 E;  3AUZ A;  3KZZ A;  2EWL A;  2J7J A;  1SFE A;  2YU5 A;  1QU6 A;  1SR9 A;  5TSE A;  3F6G A;  4ZYG A;  2ZM6 E;  4DR3 E;  2UUA E;  2VF1 A;  4X8W A;  4BC7 A;  1UN6 B;  1WJP A;  5AAS A;  2IHR 1;  1NEI A;  2KON A;  4HTG A;  4DV3 E;  1X48 A;  4GKJ E;  2EMG A;  1YYW A;  2GPI A;  2EP3 A;  4DUY E;  4AQY E;  3HQ1 A;  1PJS A;  1WRJ A;  4LTY A;  4LU9 A;  3L00 A;  2EOM A;  2MC6 A;  4TUI A;  1ZR9 A;  4TUG A;  3J80 C;  2JXP A;  3C4B A;  4B3M E;  2EOX A;  3UK3 C;  2NUF A;  4JI1 E;  3ZOQ B;  5A6A A;  2YWQ A;  4BBY A;  1EKZ A;  2EMC A;  5AC5 A;  2N8X A;  2EM6 A;  2EE8 A;  1A1G A;  2L2N A;  3J81 C;  4KHP E;  4Q28 A;  3M99 B;  2CPN A;  4LF6 E;  2LBS B;  2VRD A;  4LF4 E;  3BGH A;  4DR1 E;  4IJD A;  2YTQ A;  4HEI A;  4NXM E;  3JU0 A;  1RQ0 A;  5CFF E;  3HPS A;  3VYX A;  1GZ6 A;  2YZT A;  4LFC E;  2EPM X;  2ELZ A;  4X64 E;  2BBG A;  4JI7 E;  2EOY A;  4L5N C;  2EMI A;  4DUZ E;  2F8B A;  2GHF A;  4DR5 E;  3C6M A;  1J5E E;  1T4L B;  1BBG A;  1QNT A;  1WHQ A;  2K7I A;  4DV4 E;  1STU A;  2EML A;  2JY9 A;  4DV5 E;  1IBL E;  4R2C A;  3VYY A;  2EQ0 A;  2M4I A;  4WFT A;  4ZYE A;  2LO3 A;  2UU9 E;  4DV2 E;  1L4S A;  2EOZ A;  1EH8 A;  2EPX A;  4JV5 E;  4N4R B;  1B69 A;  1YYK A;  1JK2 A;  2V87 A;  4RHB B;  3TQM A;  5A6J A;  2ENA A;  2EN4 A;  2EN7 A;  3T1H E;  3VK6 A;  1NCS A;  2R1F A;  2WBT A;  3VHT B;  2DGC A;  1FKA E;  4JI5 E;  4R03 A;  1N34 E;  5AE1 A;  2H36 X;  2EOH A;  2EN2 A;  1TF3 A;  4B3S E;  3ADJ A;  4RH8 A;  3IWB A;  2I9I A;  2FTX B;  5KL5 A;  1HNX E;  2MDR A;  4F9C B;  2LT7 A;  1G2D C;  2YTP A;  4J8Z A;  2L3C A;  1F2I G;  4F54 A;  4YY3 E;  1PDA A;  1AH5 A;  5LMN E;  2PRT A;  2EPK X;  2ADR A;  4BCA A;  4X65 E;  1XMO E;  2LE2 A;  4JI0 E;  4Q35 B;  1MEY C;  1N3G A;  1A1L A;  4WYQ B;  2L8T A;  4X9J A;  4LFB E;  4BC9 A;  4B3R E;  3MHS C;  3BBG A;  3IWD A;  4IS1 C;  4O4K A;  5LLQ A;  4LF5 E;  2LUP B;  3C6K A;  1N36 E;  5DNY A;  1BBO A;  2YTO A;  1X3C A;  5AC4 A;  3KWR A;  5BR8 E;  2JP9 A;  4KWY A;  2B7V A;  3C4T A;  2M1S A;  1A1K A;  4O43 A;  5KL2 A;  2EN8 A;  2N3G A;  5AE2 A;  1YSA C;  5IWA E;  5IV8 B;  1T4O A;  2LCE A;  2NUE A;  1HNW E;  2Q8U A;  1A1J A;  2L6M A;  2UXD E;  1T4N A;  2RSM A;  4OX9 E;  2DRP A;  1EH7 A;  1O0W A;  2R76 A;  2YTI A;  2DB2 A;  1X6H A;  4F2J C;  2NA2 A;  5A6K A;  2K4V A;  2EPA A;  3JAM C;  1ZAA C;  1I94 E;  2RS7 A;  1Z1B A;  3F6H A;  3H09 A;  2V89 A;  4R2A A;  2CTD A;  3EQ1 A;  3T1Y E;  4R2R A;  3K6Q A;  4WXC A;  3IWC A;  1J26 A;  4DV0 E;  1YFH A;  1KJK A;  2ENH A;  2EL4 A;  5IXM B;  2CT1 A;  1AAY A;  2EMY A;  4M9V C;  5A6B D;  3OML A;  2V8Q B;  2JOX A;  2L92 A;  2HJJ A;  2EMH A;  4F9B B;  4JYA E;  2DIX A;  2KOU A;  4ZYD A;  2LRS A;  1IMU A;  1PJQ A;  1X6E A;  1GTK A;  1ZBT A;  4I8O A;  4P78 A;  2EM7 A;  1ZU1 A;  2B9D A;  2WBU A;  2EL5 A;  2DLQ A;  2EN6 A;  1P47 A;  2LMZ A;  2YTG A;  2YSP A;  1TN9 A;  2LJH A;  5F3W A;  2LTR A;  4OOG C;  4KZS A; 
#chains in the Genus database with same CATH homology
 2EL6 A;  2EPC A;  2PRT A;  2YTF A;  2EMX A;  2EM0 A;  2EMW A;  2WCC 3;  2YTD A;  2EOM A;  2EMZ A;  1ZR9 A;  2ADR A;  2EPR A;  1A1H A;  3EPJ A;  2EOX A;  3UK3 C;  1MEY C;  2I13 A;  2YSO A;  1YUI A;  2CSH A;  2YTN A;  1A1L A;  2EMC A;  4X9J A;  5KL7 A;  2EM6 A;  2YU8 A;  3MHS C;  2EE8 A;  1A1F A;  4IS1 C;  2EQ1 A;  1YUJ A;  1A1G A;  1RMD A;  3M99 B;  2LV2 A;  2RPC A;  5KL3 A;  2EOS A;  1BBO A;  1JK1 A;  2VRD A;  1X3C A;  2YTO A;  2JP9 A;  4IJD A;  2EQ3 A;  2EOJ A;  2EOQ A;  2LVH A;  4GZN C;  2EJ4 A;  2YTQ A;  1BB8 A;  1A1K A;  2NAB A;  5KL2 A;  2EN8 A;  4R2Q A;  1TF6 A;  2EOO A;  1YSA C;  2D9H A;  2EOI A;  2EM4 A;  2YRK A;  2LCE A;  2EM8 A;  2MDG A;  2ELY A;  1LLM C;  2JPA A;  1A1I A;  1A1J A;  2ELZ A;  2GLI A;  4R2E A;  2YTE A;  2EOY A;  2M9A A;  4R2S A;  2EMI A;  2GHF A;  2EMA A;  2EMB A;  2YRM A;  2EMF A;  1UBD C;  2DMI A;  2DRP A;  3EPL A;  2EMK A;  2EN3 A;  2YTI A;  2EML A;  1X5W A;  1X6H A;  4F2J C;  2EPU A;  4FK5 C;  3EPH A;  4R2C A;  2EOR A;  2EPA A;  2EQ0 A;  4WSG A;  1ZAA C;  2EM3 A;  2ENC A;  2LO3 A;  1Z1B A;  1X6F A;  2EOZ A;  2EPX A;  4R2A A;  2CTD A;  2EPZ A;  2WBS A;  2YTJ A;  1B69 A;  1G2F C;  4F6N A;  1JK2 A;  2EM9 A;  2EN1 A;  1DGC A;  5KL4 A;  4R2R A;  2RSI A;  2ENA A;  2EN4 A;  2ENH A;  2E72 A;  1KJK A;  2EL4 A;  2EN7 A;  2A25 A;  2CT1 A;  1AAY A;  2EMY A;  4M9V C;  2MKN A;  1NCS A;  2EM2 A;  5KL6 A;  2EPP A;  2R1F A;  2EMH A;  2WBT A;  3VHT B;  2DGC A;  2MKD A;  2HGH A;  2EM5 A;  3EPK A;  1X6E A;  2EOH A;  2EN2 A;  2J7J A;  1TF3 A;  4F6M A;  2YU5 A;  2BB8 A;  2EM7 A;  1ZU1 A;  3MHH C;  2DLK A;  2WBU A;  2EL5 A;  2DLQ A;  2EN6 A;  5KL5 A;  1P47 A;  2EOF A;  2YTG A;  2YSP A;  2EOE A;  4R2D A;  1WJP A;  1TN9 A;  2LT7 A;  1UN6 B;  1G2D C;  2YTP A;  4R2P A;  2EMG A;  2YRH A;  1F2I G;  2EP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...