4IS1C

Crystal structure of znf217 bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein/dna
molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of ZNF217
doi rcsb
source organism Homo sapiens
total genus 16
structure length 52
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4is1C00
3EPJA 2EOIA 2JP9A 2YTGA 1A1GA 2EMYA 1YSAC 5KL3A 1A1FA 2EMBA 1KJKA 2EMFA 2DLQA 2YTQA 2EORA 2ELZA 4IS1C 1F2IG 2VRDA 2EL5A 1TF3A 4F6MA 2GHFA 2EOFA 2EM3A 2EOYA 1JK2A 1X6FA 2ENCA 2EOMA 2LT7A 2EL4A 2EOXA 2JPAA 2YSOA 2EN4A 2WBSA 2YTPA 2I13A 1ZR9A 2RPCA 4FK5C 1B69A 4R2PA 1TN9A 2CTDA 2EM0A 2EMGA 2MKNA 2YTIA 2YTEA 1A1IA 2ENHA 1AAYA 1WJPA 4M9VC 5KL4A 4R2RA 2PRTA 1A1JA 1JK1A 2YRMA 4R2DA 1P47A 1ZU1A 2EPXA 1BB8A 2LVHA 3M99B 2ENAA 1A1HA 2YRHA 5KL6A 2YSPA 2EQ0A 3MHSC 1UBDC 1X5WA 2M9AA 2EOJA 2HGHA 2LCEA 2WBTA 1LLMC 2EM9A 2MDGA 1X6EA 2EM6A 2EMHA 2EOHA 2EPAA 3EPKA 2EPZA 2ELYA 2EOSA 1YUJA 2EMWA 2EPCA 1YUIA 1NCSA 2D9HA 4R2QA 2RSIA 2EN2A 2EM5A 1RMDA 2EN3A 2EMCA 2EOZA 2EOOA 4IJDA 5KL7A 2EL6A 2NABA 2YTOA 1BBOA 1A1KA 2EOQA 2R1FA 1TF6A 2DGCA 2J7JA 5KL5A 2YU5A 3MHHC 3UK3C 4WSGA 2EN6A 2EM2A 1X6HA 4F2JC 2YU8A 4GZNC 1MEYC 4R2AA 2E72A 2EPUA 2EN7A 2ADRA 2DLKA 2EOEA 1G2FC 2EMIA 2EMLA 2YTFA 1Z1BA 2EQ3A 2LV2A 2EM8A 1UN6B 2LO3A 1X3CA 4R2SA 3VHTB 4F6NA 2YRKA 2BB8A 2CT1A 2DRPA 2YTJA 2EJ4A 4R2EA 2YTDA 2CSHA 2EM4A 3EPLA 2EN8A 2EMXA 4X9JA 2EMAA 2EMKA 1A1LA 2EPRA 3EPHA 2WCC3 2MKDA 1G2DC 2EE8A 2EP3A 2YTNA 2DMIA 4R2CA 2GLIA 2EPPA 5KL2A 2A25A 2WBUA 2EMZA 1ZAAC 2EQ1A 2EM7A 2EN1A 1DGCA
chains in the Genus database with same CATH superfamily
3EPJA 4BS9A 2EMBA 2EMFA 2YTQA 1X48A 2JXPA 3K6QA 3H09A 2VRDA 2N8XA 3OMLA 1STUA 4X65E 2EOMA 3THNA 2LT7A 2JY9A 4L8NA 4BHCA 4MLQA 4NHRA 1N32E 4WPYA 2I13A 1ZR9A 2EZ6A 4FK5C 2EPLX 1B69A 1TN9A 3F6HA 2UUCE 2CTDA 2EM0A 4DV7E 4DV4E 5KL4A 4R2RA 1JK1A 2LMZA 2L2MA 1P47A 1NEIA 3ADIA 1DQ3A 1HNXE 1YFHA 3MHSC 1X5WA 2M9AA 2B7TA 4F54A 2HGHA 3HPSA 4B3ME 2KOUA 2DIXA 2UU9E 4GKJE 2EM9A 1X6EA 4DUZE 5LMUE 2L6MA 4X62E 2EPCA 4N4RB 4R2QA 2EM5A 3QG5C 2EMCA 2KONA 4M30A 4LFAE 2EOOA 2E5LE 2YPNA 1A1KA 2M1SA 2DGCA 2YU5A 2V86A 3MHHC 2I9IA 2RSMA 4DR5E 1PJQA 3P1XA 4BMJA 2E72A 2BBGA 2DLKA 1O0WA 2EMLA 2UUBE 4JI2E 2YTFA 4GEQB 4WXCA 1J26A 1UN6B 2LUQA 2K7IA 2YRKA 5CFFE 2JVAA 4ZYHA 4JV5E 3IWCA 2L3JA 4O4KA 2FV4B 5A6AA 3JU0A 2LE2A 1T39A 2EMKA 2L3CA 2RTXA 2DMIA 1EH8A 1N3GA 4O43A 2A25A 5KL2A 4B3SE 4DR7E 1QU6A 1DI2A 3AV0A 1HNWE 2EQ1A 2EM7A 2Q8UA 5A6JA 2NUEA 1L4SA 5IXMB 5AE1A 2JP9A 4DR1E 1ZBQA 1KJKA 4NXME 4JI5E 5FLXC 1RC7A 2ELZA 1YPNA 4IS1C 1N36E 3HPZA 2GHFA 2H36X 4WFTA 1X6FA 1EH6A 4DKKA 4WX9A 2EL4A 2EOXA 2JPAA 5LMNE 2B3TB 2YTPA 1XMOE 4OOGC 2RS7A 1IBLE 4BBYA 1T4NA 2EMGA 2MKNA 1A1IA 4JI6E 5TSEA 1N33E 2ENHA 4LF7E 3BBGA 2HC5A 1GZ6A 4R2DA 2EPXA 2E1MA 2LVHA 2L33A 2JWOA 1A1HA 4R03A 2YRHA 3TQMA 5KL6A 2EQ0A 4DR3E 1UBDC 5A2QC 2JOXA 2LCEA 3FIGA 4BC7A 1LLMC 1IQOA 3JTZA 4F9BB 3OTOE 4ZYGA 1XNQE 2EMHA 2RS6A 2ELYA 2EPZA 1ZBTA 2EN2A 2EN3A 2F4VE 4O24A 2MC6A 4NZVA 4F9AB 2ZM6E 1UHZA 4BHBA 2NUGA 4DR4E 2R1FA 4F9CB 3RMPA 4DV1E 2J7JA 5BR8E 4BCAA 5KL5A 3J80C 1T4OA 3UK3C 4WSGA 4KZSA 4LFCE 5AE3A 2L2NA 4F2JC 4JI4E 3BF2A 4Q35B 4YY3E 4O5GA 2NA2A 5DNYA 4BC9A 1Z1BA 2EQ3A 2EM8A 2DRPA 3VHTB 4F6NA 2BB8A 1MGTA 1WHQA 4DUYE 2YTJA 3VYYA 1T38A 2EJ4A 5AE2A 3VYXA 2LJUA 4R2EA 2K4VA 4DV3E 1HR0E 3J7AG 4NXNE 4X64E 4X9JA 1PKPA 1BBGA 2DSYA 2EMAA 1A1LA 4JI3E 2WCC3 2ODRC 2R76A 2EP3A 2YTNA 2ODRD 2B9DA 4P7DA 2YSPA 1EKZA 2EN1A 4WYQB 2VF1A 2EOIA 2YTGA 1A1GA 2EMYA 1YSAC 2UXBE 2N3GA 5A6BD 4ZYEA 3ADGA 3LLHA 1UILA 4F6MA 4DV5E 2HHHE 2EOYA 2B7VA 1KYQA 2MC5A 2UXDE 3EQ1A 2L8TA 4DV2E 2RPCA 1PJTA 4B3TE 5IWAE 4R2PA 1SR9A 1PDAA 2YTEA 4GKKE 4J8ZA 1AAYA 5T6JA 3KZZA 5LL6R 2PRTA 1T4LB 3THOB 3VK6A 4JI7E 3J81C 2WZOA 2EOJA 2N3HA 2WBTA 2M7QA 1QNTA 1AH5A 1J5EE 4K0KE 2MDGA 4RHBB 3KZYA 2V87A 4Q28A 2EM6A 2EPOA 4M2ZA 2EPAA 3EPKA 2EOSA 1YUJA 2EMWA 3T1HE 2D9HA 2L92A 1RMDA 4TUIA 2EOZA 4HEIA 2EPNA 4IJDA 2VE7C 2YTOA 4B3RE 1YYWA 1TF6A 1SFEA 2LRSA 3ECRA 5A6BA 1WRJA 3JAMC 4LF6E 2EM2A 4JI8E 5IT9C 2V8QB 4P78A 4GZNC 3C6MA 1MEYC 3HXLA 4R2AA 3ZOQB 3IWDA 2EPUA 2ADRA 2EMIA 1FKAE 4WSPA 4LU9A 1X49A 2VQFE 2LV2A 4DV0E 1X3CA 1YZ9A 4TUGA 2LUPB 2CT1A 2F8BA 5IV8B 2UUAE 5AC4A 3C4BA 1X47A 2EWLA 2YTDA 2EM4A 3EPLA 2EN8A 2MDRA 4YHHE 3EPHA 2EPRA 2MKDA 2YWQA 4RH8A 5ADZA 2WBUA 2EMZA 3KWRA 3J7Yp 2LBSB 1ZAAC 2YZTA 5A69A 2NUFA 3HTXA 4DR6E 3DJWA 2G7HA 3IWBA 5KL3A 1A1FA 3MSWA 1XNRE 3ADLA 2DLQA 5LLQA 1F2IG 2EL5A 3DF6A 5F3WA 2UXCE 1TF3A 4LTYA 4M0VA 2EOFA 2EM3A 4HTGA 1JK2A 2VQEE 2ENCA 4DR2E 3LMLA 4X66E 1PJSA 2YSOA 2EN4A 2WBSA 3L00A 4LF5E 4KHPE 4WXDA 1IBKE 2M4IA 4JI1E 1IQSA 1GQEA 2YTIA 3BGHA 1FJGE 4JYAE 4LF9E 1WJPA 4M9VC 1A1JA 3F6GA 2LTSA 2YRMA 1ZU1A 1BB8A 3M99B 2ENAA 1HNZE 1IMUA 2CPNA 2V85A 3BIDA 2EPKX 4LF4E 4ZYDA 2HJJA 3C4TA 2EOHA 1YUIA 2GPIA 1NCSA 2RSIA 4OX9E 2L2KB 4MLVA 4KWYA 5KL7A 2LTRA 2EL6A 3HQ1A 2NABA 2V88A 1BBOA 2JR1A 2FTXB 4I8OA 2EOQA 1WXRA 1XMQE 2V89A 2EN6A 4L5NC 4X8WA 1IBME 4R8OA 1X6HA 2KHXA 2YU8A 3ADJA 2RQLA 2EN7A 4LF8E 2EOEA 3T1YE 1G2FC 4LFBE 1YYOA 4DV6E 2JOBA 2LO3A 4R2SA 5A6KA 4AQYE 2JYAA 3AUZA 4DMIA 2EPMX 1EH7A 2CSHA 5AC5A 2EMXA 1N34E 1RQ0A 5AASA 2FGGA 2EE8A 1G2DC 1WHNA 4R2CA 1I94E 2GLIA 2DMYA 2V83A 2EPPA 2LJHA 2YT4A 1YYKA 2DB2A 2IHR1 4JI0E 2EORA 3C6KA 1GTKA 1DGCA
chains in the Genus database with same CATH topology
3EPJA 2EOIA 2JP9A 2YTGA 1A1GA 2EMYA 1YSAC 5KL3A 1A1FA 2EMBA 1KJKA 2EMFA 2DLQA 2YTQA 2EORA 2ELZA 4IS1C 1F2IG 2VRDA 2EL5A 1TF3A 4F6MA 2GHFA 2EOFA 2EM3A 2EOYA 1JK2A 1X6FA 2ENCA 2EOMA 2LT7A 2EL4A 2EOXA 2JPAA 2YSOA 2EN4A 2WBSA 2YTPA 2I13A 1ZR9A 2RPCA 4FK5C 1B69A 4R2PA 1TN9A 2CTDA 2EM0A 2EMGA 2MKNA 2YTIA 2YTEA 1A1IA 2ENHA 1AAYA 1WJPA 4M9VC 5KL4A 4R2RA 2PRTA 1A1JA 1JK1A 2YRMA 4R2DA 1P47A 1ZU1A 2EPXA 1BB8A 2LVHA 3M99B 2ENAA 1A1HA 2YRHA 5KL6A 2YSPA 2EQ0A 3MHSC 1UBDC 1X5WA 2M9AA 2EOJA 2HGHA 2LCEA 2WBTA 1LLMC 2EM9A 2MDGA 1X6EA 2EM6A 2EMHA 2EOHA 2EPAA 3EPKA 2EPZA 2ELYA 2EOSA 1YUJA 2EMWA 2EPCA 1YUIA 1NCSA 2D9HA 4R2QA 2RSIA 2EN2A 2EM5A 1RMDA 2EN3A 2EMCA 2EOZA 2EOOA 4IJDA 5KL7A 2EL6A 2NABA 2YTOA 1BBOA 1A1KA 2EOQA 2R1FA 1TF6A 2DGCA 2J7JA 5KL5A 2YU5A 3MHHC 3UK3C 4WSGA 2EN6A 2EM2A 1X6HA 4F2JC 2YU8A 4GZNC 1MEYC 4R2AA 2E72A 2EPUA 2EN7A 2ADRA 2DLKA 2EOEA 1G2FC 2EMIA 2EMLA 2YTFA 1Z1BA 2EQ3A 2LV2A 2EM8A 1UN6B 2LO3A 1X3CA 4R2SA 3VHTB 4F6NA 2YRKA 2BB8A 2CT1A 2DRPA 2YTJA 2EJ4A 4R2EA 2YTDA 2CSHA 2EM4A 3EPLA 2EN8A 2EMXA 4X9JA 2EMAA 2EMKA 1A1LA 2EPRA 3EPHA 2WCC3 2MKDA 1G2DC 2EE8A 2EP3A 2YTNA 2DMIA 4R2CA 2GLIA 2EPPA 5KL2A 2A25A 2WBUA 2EMZA 1ZAAC 2EQ1A 2EM7A 2EN1A 1DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  2EOI A;  2JP9 A;  2YTG A;  1A1G A;  2EMY A;  1YSA C;  5KL3 A;  1A1F A;  2EMB A;  1KJK A;  2EMF A;  2DLQ A;  2YTQ A;  2EOR A;  2ELZ A;  4IS1 C;  1F2I G;  2VRD A;  2EL5 A;  1TF3 A;  4F6M A;  2GHF A;  2EOF A;  2EM3 A;  2EOY A;  1JK2 A;  1X6F A;  2ENC A;  2EOM A;  2LT7 A;  2EL4 A;  2EOX A;  2JPA A;  2YSO A;  2EN4 A;  2WBS A;  2YTP A;  2I13 A;  1ZR9 A;  2RPC A;  4FK5 C;  1B69 A;  4R2P A;  1TN9 A;  2CTD A;  2EM0 A;  2EMG A;  2MKN A;  2YTI A;  2YTE A;  1A1I A;  2ENH A;  1AAY A;  1WJP A;  4M9V C;  5KL4 A;  4R2R A;  2PRT A;  1A1J A;  1JK1 A;  2YRM A;  4R2D A;  1P47 A;  1ZU1 A;  2EPX A;  1BB8 A;  2LVH A;  3M99 B;  2ENA A;  1A1H A;  2YRH A;  5KL6 A;  2YSP A;  2EQ0 A;  3MHS C;  1UBD C;  1X5W A;  2M9A A;  2EOJ A;  2HGH A;  2LCE A;  2WBT A;  1LLM C;  2EM9 A;  2MDG A;  1X6E A;  2EM6 A;  2EMH A;  2EOH A;  2EPA A;  3EPK A;  2EPZ A;  2ELY A;  2EOS A;  1YUJ A;  2EMW A;  2EPC A;  1YUI A;  1NCS A;  2D9H A;  4R2Q A;  2RSI A;  2EN2 A;  2EM5 A;  1RMD A;  2EN3 A;  2EMC A;  2EOZ A;  2EOO A;  4IJD A;  5KL7 A;  2EL6 A;  2NAB A;  2YTO A;  1BBO A;  1A1K A;  2EOQ A;  2R1F A;  1TF6 A;  2DGC A;  2J7J A;  5KL5 A;  2YU5 A;  3MHH C;  3UK3 C;  4WSG A;  2EN6 A;  2EM2 A;  1X6H A;  4F2J C;  2YU8 A;  4GZN C;  1MEY C;  4R2A A;  2E72 A;  2EPU A;  2EN7 A;  2ADR A;  2DLK A;  2EOE A;  1G2F C;  2EMI A;  2EML A;  2YTF A;  1Z1B A;  2EQ3 A;  2LV2 A;  2EM8 A;  1UN6 B;  2LO3 A;  1X3C A;  4R2S A;  3VHT B;  4F6N A;  2YRK A;  2BB8 A;  2CT1 A;  2DRP A;  2YTJ A;  2EJ4 A;  4R2E A;  2YTD A;  2CSH A;  2EM4 A;  3EPL A;  2EN8 A;  2EMX A;  4X9J A;  2EMA A;  2EMK A;  1A1L A;  2EPR A;  3EPH A;  2WCC 3;  2MKD A;  1G2D C;  2EE8 A;  2EP3 A;  2YTN A;  2DMI A;  4R2C A;  2GLI A;  2EPP A;  5KL2 A;  2A25 A;  2WBU A;  2EMZ A;  1ZAA C;  2EQ1 A;  2EM7 A;  2EN1 A;  1DGC A; 
#chains in the Genus database with same CATH topology
 3EPJ A;  4BS9 A;  2EMB A;  2EMF A;  2YTQ A;  1X48 A;  2JXP A;  3K6Q A;  3H09 A;  2VRD A;  2N8X A;  3OML A;  1STU A;  4X65 E;  2EOM A;  3THN A;  2LT7 A;  2JY9 A;  4L8N A;  4BHC A;  4MLQ A;  4NHR A;  1N32 E;  4WPY A;  2I13 A;  1ZR9 A;  2EZ6 A;  4FK5 C;  2EPL X;  1B69 A;  1TN9 A;  3F6H A;  2UUC E;  2CTD A;  2EM0 A;  4DV7 E;  4DV4 E;  5KL4 A;  4R2R A;  1JK1 A;  2LMZ A;  2L2M A;  1P47 A;  1NEI A;  3ADI A;  1DQ3 A;  1HNX E;  1YFH A;  3MHS C;  1X5W A;  2M9A A;  2B7T A;  4F54 A;  2HGH A;  3HPS A;  4B3M E;  2KOU A;  2DIX A;  2UU9 E;  4GKJ E;  2EM9 A;  1X6E A;  4DUZ E;  5LMU E;  2L6M A;  4X62 E;  2EPC A;  4N4R B;  4R2Q A;  2EM5 A;  3QG5 C;  2EMC A;  2KON A;  4M30 A;  4LFA E;  2EOO A;  2E5L E;  2YPN A;  1A1K A;  2M1S A;  2DGC A;  2YU5 A;  2V86 A;  3MHH C;  2I9I A;  2RSM A;  4DR5 E;  1PJQ A;  3P1X A;  4BMJ A;  2E72 A;  2BBG A;  2DLK A;  1O0W A;  2EML A;  2UUB E;  4JI2 E;  2YTF A;  4GEQ B;  4WXC A;  1J26 A;  1UN6 B;  2LUQ A;  2K7I A;  2YRK A;  5CFF E;  2JVA A;  4ZYH A;  4JV5 E;  3IWC A;  2L3J A;  4O4K A;  2FV4 B;  5A6A A;  3JU0 A;  2LE2 A;  1T39 A;  2EMK A;  2L3C A;  2RTX A;  2DMI A;  1EH8 A;  1N3G A;  4O43 A;  2A25 A;  5KL2 A;  4B3S E;  4DR7 E;  1QU6 A;  1DI2 A;  3AV0 A;  1HNW E;  2EQ1 A;  2EM7 A;  2Q8U A;  5A6J A;  2NUE A;  1L4S A;  5IXM B;  5AE1 A;  2JP9 A;  4DR1 E;  1ZBQ A;  1KJK A;  4NXM E;  4JI5 E;  5FLX C;  1RC7 A;  2ELZ A;  1YPN A;  4IS1 C;  1N36 E;  3HPZ A;  2GHF A;  2H36 X;  4WFT A;  1X6F A;  1EH6 A;  4DKK A;  4WX9 A;  2EL4 A;  2EOX A;  2JPA A;  5LMN E;  2B3T B;  2YTP A;  1XMO E;  4OOG C;  2RS7 A;  1IBL E;  4BBY A;  1T4N A;  2EMG A;  2MKN A;  1A1I A;  4JI6 E;  5TSE A;  1N33 E;  2ENH A;  4LF7 E;  3BBG A;  2HC5 A;  1GZ6 A;  4R2D A;  2EPX A;  2E1M A;  2LVH A;  2L33 A;  2JWO A;  1A1H A;  4R03 A;  2YRH A;  3TQM A;  5KL6 A;  2EQ0 A;  4DR3 E;  1UBD C;  5A2Q C;  2JOX A;  2LCE A;  3FIG A;  4BC7 A;  1LLM C;  1IQO A;  3JTZ A;  4F9B B;  3OTO E;  4ZYG A;  1XNQ E;  2EMH A;  2RS6 A;  2ELY A;  2EPZ A;  1ZBT A;  2EN2 A;  2EN3 A;  2F4V E;  4O24 A;  2MC6 A;  4NZV A;  4F9A B;  2ZM6 E;  1UHZ A;  4BHB A;  2NUG A;  4DR4 E;  2R1F A;  4F9C B;  3RMP A;  4DV1 E;  2J7J A;  5BR8 E;  4BCA A;  5KL5 A;  3J80 C;  1T4O A;  3UK3 C;  4WSG A;  4KZS A;  4LFC E;  5AE3 A;  2L2N A;  4F2J C;  4JI4 E;  3BF2 A;  4Q35 B;  4YY3 E;  4O5G A;  2NA2 A;  5DNY A;  4BC9 A;  1Z1B A;  2EQ3 A;  2EM8 A;  2DRP A;  3VHT B;  4F6N A;  2BB8 A;  1MGT A;  1WHQ A;  4DUY E;  2YTJ A;  3VYY A;  1T38 A;  2EJ4 A;  5AE2 A;  3VYX A;  2LJU A;  4R2E A;  2K4V A;  4DV3 E;  1HR0 E;  3J7A G;  4NXN E;  4X64 E;  4X9J A;  1PKP A;  1BBG A;  2DSY A;  2EMA A;  1A1L A;  4JI3 E;  2WCC 3;  2ODR C;  2R76 A;  2EP3 A;  2YTN A;  2ODR D;  2B9D A;  4P7D A;  2YSP A;  1EKZ A;  2EN1 A;  4WYQ B;  2VF1 A;  2EOI A;  2YTG A;  1A1G A;  2EMY A;  1YSA C;  2UXB E;  2N3G A;  5A6B D;  4ZYE A;  3ADG A;  3LLH A;  1UIL A;  4F6M A;  4DV5 E;  2HHH E;  2EOY A;  2B7V A;  1KYQ A;  2MC5 A;  2UXD E;  3EQ1 A;  2L8T A;  4DV2 E;  2RPC A;  1PJT A;  4B3T E;  5IWA E;  4R2P A;  1SR9 A;  1PDA A;  2YTE A;  4GKK E;  4J8Z A;  1AAY A;  5T6J A;  3KZZ A;  5LL6 R;  2PRT A;  1T4L B;  3THO B;  3VK6 A;  4JI7 E;  3J81 C;  2WZO A;  2EOJ A;  2N3H A;  2WBT A;  2M7Q A;  1QNT A;  1AH5 A;  1J5E E;  4K0K E;  2MDG A;  4RHB B;  3KZY A;  2V87 A;  4Q28 A;  2EM6 A;  2EPO A;  4M2Z A;  2EPA A;  3EPK A;  2EOS A;  1YUJ A;  2EMW A;  3T1H E;  2D9H A;  2L92 A;  1RMD A;  4TUI A;  2EOZ A;  4HEI A;  2EPN A;  4IJD A;  2VE7 C;  2YTO A;  4B3R E;  1YYW A;  1TF6 A;  1SFE A;  2LRS A;  3ECR A;  5A6B A;  1WRJ A;  3JAM C;  4LF6 E;  2EM2 A;  4JI8 E;  5IT9 C;  2V8Q B;  4P78 A;  4GZN C;  3C6M A;  1MEY C;  3HXL A;  4R2A A;  3ZOQ B;  3IWD A;  2EPU A;  2ADR A;  2EMI A;  1FKA E;  4WSP A;  4LU9 A;  1X49 A;  2VQF E;  2LV2 A;  4DV0 E;  1X3C A;  1YZ9 A;  4TUG A;  2LUP B;  2CT1 A;  2F8B A;  5IV8 B;  2UUA E;  5AC4 A;  3C4B A;  1X47 A;  2EWL A;  2YTD A;  2EM4 A;  3EPL A;  2EN8 A;  2MDR A;  4YHH E;  3EPH A;  2EPR A;  2MKD A;  2YWQ A;  4RH8 A;  5ADZ A;  2WBU A;  2EMZ A;  3KWR A;  3J7Y p;  2LBS B;  1ZAA C;  2YZT A;  5A69 A;  2NUF A;  3HTX A;  4DR6 E;  3DJW A;  2G7H A;  3IWB A;  5KL3 A;  1A1F A;  3MSW A;  1XNR E;  3ADL A;  2DLQ A;  5LLQ A;  1F2I G;  2EL5 A;  3DF6 A;  5F3W A;  2UXC E;  1TF3 A;  4LTY A;  4M0V A;  2EOF A;  2EM3 A;  4HTG A;  1JK2 A;  2VQE E;  2ENC A;  4DR2 E;  3LML A;  4X66 E;  1PJS A;  2YSO A;  2EN4 A;  2WBS A;  3L00 A;  4LF5 E;  4KHP E;  4WXD A;  1IBK E;  2M4I A;  4JI1 E;  1IQS A;  1GQE A;  2YTI A;  3BGH A;  1FJG E;  4JYA E;  4LF9 E;  1WJP A;  4M9V C;  1A1J A;  3F6G A;  2LTS A;  2YRM A;  1ZU1 A;  1BB8 A;  3M99 B;  2ENA A;  1HNZ E;  1IMU A;  2CPN A;  2V85 A;  3BID A;  2EPK X;  4LF4 E;  4ZYD A;  2HJJ A;  3C4T A;  2EOH A;  1YUI A;  2GPI A;  1NCS A;  2RSI A;  4OX9 E;  2L2K B;  4MLV A;  4KWY A;  5KL7 A;  2LTR A;  2EL6 A;  3HQ1 A;  2NAB A;  2V88 A;  1BBO A;  2JR1 A;  2FTX B;  4I8O A;  2EOQ A;  1WXR A;  1XMQ E;  2V89 A;  2EN6 A;  4L5N C;  4X8W A;  1IBM E;  4R8O A;  1X6H A;  2KHX A;  2YU8 A;  3ADJ A;  2RQL A;  2EN7 A;  4LF8 E;  2EOE A;  3T1Y E;  1G2F C;  4LFB E;  1YYO A;  4DV6 E;  2JOB A;  2LO3 A;  4R2S A;  5A6K A;  4AQY E;  2JYA A;  3AUZ A;  4DMI A;  2EPM X;  1EH7 A;  2CSH A;  5AC5 A;  2EMX A;  1N34 E;  1RQ0 A;  5AAS A;  2FGG A;  2EE8 A;  1G2D C;  1WHN A;  4R2C A;  1I94 E;  2GLI A;  2DMY A;  2V83 A;  2EPP A;  2LJH A;  2YT4 A;  1YYK A;  2DB2 A;  2IHR 1;  4JI0 E;  2EOR A;  3C6K A;  1GTK A;  1DGC A; 
#chains in the Genus database with same CATH homology
 3EPJ A;  2EOI A;  2JP9 A;  2YTG A;  1A1G A;  2EMY A;  1YSA C;  5KL3 A;  1A1F A;  2EMB A;  1KJK A;  2EMF A;  2DLQ A;  2YTQ A;  2EOR A;  2ELZ A;  4IS1 C;  1F2I G;  2VRD A;  2EL5 A;  1TF3 A;  4F6M A;  2GHF A;  2EOF A;  2EM3 A;  2EOY A;  1JK2 A;  1X6F A;  2ENC A;  2EOM A;  2LT7 A;  2EL4 A;  2EOX A;  2JPA A;  2YSO A;  2EN4 A;  2WBS A;  2YTP A;  2I13 A;  1ZR9 A;  2RPC A;  4FK5 C;  1B69 A;  4R2P A;  1TN9 A;  2CTD A;  2EM0 A;  2EMG A;  2MKN A;  2YTI A;  2YTE A;  1A1I A;  2ENH A;  1AAY A;  1WJP A;  4M9V C;  5KL4 A;  4R2R A;  2PRT A;  1A1J A;  1JK1 A;  2YRM A;  4R2D A;  1P47 A;  1ZU1 A;  2EPX A;  1BB8 A;  2LVH A;  3M99 B;  2ENA A;  1A1H A;  2YRH A;  5KL6 A;  2YSP A;  2EQ0 A;  3MHS C;  1UBD C;  1X5W A;  2M9A A;  2EOJ A;  2HGH A;  2LCE A;  2WBT A;  1LLM C;  2EM9 A;  2MDG A;  1X6E A;  2EM6 A;  2EMH A;  2EOH A;  2EPA A;  3EPK A;  2EPZ A;  2ELY A;  2EOS A;  1YUJ A;  2EMW A;  2EPC A;  1YUI A;  1NCS A;  2D9H A;  4R2Q A;  2RSI A;  2EN2 A;  2EM5 A;  1RMD A;  2EN3 A;  2EMC A;  2EOZ A;  2EOO A;  4IJD A;  5KL7 A;  2EL6 A;  2NAB A;  2YTO A;  1BBO A;  1A1K A;  2EOQ A;  2R1F A;  1TF6 A;  2DGC A;  2J7J A;  5KL5 A;  2YU5 A;  3MHH C;  3UK3 C;  4WSG A;  2EN6 A;  2EM2 A;  1X6H A;  4F2J C;  2YU8 A;  4GZN C;  1MEY C;  4R2A A;  2E72 A;  2EPU A;  2EN7 A;  2ADR A;  2DLK A;  2EOE A;  1G2F C;  2EMI A;  2EML A;  2YTF A;  1Z1B A;  2EQ3 A;  2LV2 A;  2EM8 A;  1UN6 B;  2LO3 A;  1X3C A;  4R2S A;  3VHT B;  4F6N A;  2YRK A;  2BB8 A;  2CT1 A;  2DRP A;  2YTJ A;  2EJ4 A;  4R2E A;  2YTD A;  2CSH A;  2EM4 A;  3EPL A;  2EN8 A;  2EMX A;  4X9J A;  2EMA A;  2EMK A;  1A1L A;  2EPR A;  3EPH A;  2WCC 3;  2MKD A;  1G2D C;  2EE8 A;  2EP3 A;  2YTN A;  2DMI A;  4R2C A;  2GLI A;  2EPP A;  5KL2 A;  2A25 A;  2WBU A;  2EMZ A;  1ZAA C;  2EQ1 A;  2EM7 A;  2EN1 A;  1DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...