4IS1C

Crystal structure of znf217 bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of ZNF217
doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
total genus 16
structure length 52
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4is1C00
2CT1A 2ELYA 2R1FA 2EOSA 2EN2A 2EPRA 1UN6B 1F2IG 2ENAA 1X3CA 2YU8A 2EM4A 2YTDA 4GZNC 1TN9A 2EORA 2YRKA 1A1JA 2ELZA 2ENHA 3VHTB 2EN4A 2EM7A 2EOMA 2EN7A 2EMCA 1UBDC 2EM3A 2EMGA 1G2FC 2EN1A 2D9HA 4R2QA 2EOOA 2EMLA 1JK2A 2EN8A 2EOHA 2WBSA 2CTDA 1A1FA 2CSHA 2JP9A 2LVHA 1A1KA 2YTGA 1Z1BA 2M9AA 2YTJA 2EJ4A 1A1HA 1TF6A 2VRDA 2EMBA 2EMHA 2PRTA 2DGCA 2EPXA 1A1LA 1YUIA 2EPAA 2EOIA 2EOXA 2LT7A 2DLKA 2EN6A 3EPJA 4M9VC 2EM0A 4F6NA 2YTNA 3EPHA 1DGCA 2EQ0A 2EN3A 2YTIA 1BBOA 1MEYC 4IJDA 2EMXA 1ZR9A 1P47A 1NCSA 2EMKA 2EMZA 2EQ1A 4R2EA 1X6HA 1RMDA 5KL5A 4R2PA 2HGHA 2EMWA 2YRHA 2YSPA 2YTFA 1BB8A 1ZU1A 5KL3A 3EPLA 5KL7A 3UK3C 4F2JC 4R2RA 1YSAC 5KL2A 3MHSC 2E72A 3MHHC 1WJPA 2EL6A 2YTOA 2EM5A 2WCC3 2EOEA 2A25A 2EM2A 2JPAA 2YTPA 2BB8A 2WBTA 2EOQA 2YSOA 2EOZA 4X9JA 4R2CA 2ADRA 1JK1A 1YUJA 1X6FA 2EQ3A 2LV2A 2RPCA 4R2DA 2MKNA 3M99B 2LO3A 2EM6A 2WBUA 2YU5A 2LCEA 2GLIA 2EMFA 2DLQA 2YTEA 2EP3A 1B69A 2DRPA 1G2DC 2EMYA 2GHFA 1X6EA 2EE8A 4WSGA 2EL5A 4F6MA 1A1GA 2YRMA 3EPKA 2MKDA 2EOYA 5KL4A 1KJKA 2EPZA 2EMIA 4IS1C 2EPUA 2NABA 4FK5C 4R2AA 2J7JA 5KL6A 2EM9A 1LLMC 1ZAAC 1TF3A 2ENCA 1AAYA 2EOFA 2EMAA 2DMIA 2RSIA 2EPCA 2YTQA 2MDGA 1X5WA 2EL4A 4R2SA 1A1IA 2EM8A 2I13A 2EPPA 2EOJA
chains in the Genus database with same CATH superfamily
2BBGA 2ELYA 1YYOA 3IWDA 1UILA 3FIGA 3T1HE 1HR0E 1UN6B 2L3JA 2YU8A 1T39A 1TN9A 2LTSA 3P1XA 1A1JA 1AH5A 4GKKE 3VHTB 1RQ0A 2L2NA 1IBLE 1PDAA 2EOMA 5A6JA 2V83A 4P7DA 3J7Yp 1G2FC 2HJJA 5CFFE 2D9HA 4R2QA 2EOOA 2EMLA 4O5GA 2H36X 2ODRD 2WBSA 2JWOA 2VF1A 4X8WA 3DJWA 4DV3E 4ZYHA 4DR2E 2UUAE 4JI3E 1TF6A 4Q35B 4LFCE 2DGCA 1A1LA 2NUGA 2LRSA 4TUIA 5LL6R 2YTNA 3J80C 4F9AB 2EQ0A 2YTIA 3KWRA 4LF7E 3AUZA 1SR9A 4IJDA 1YZ9A 1ZR9A 3OMLA 1P47A 3F6GA 4R2EA 4BHBA 4JI7E 2EPKX 2YTFA 3F6HA 5KL3A 3EPLA 2LUPB 4F2JC 5KL2A 1T4OA 2E72A 4NHRA 3MHHC 2EL6A 4JI0E 2FGGA 2EWLA 1MGTA 2EZ6A 2JOXA 1I94E 2LTRA 1GZ6A 2UU9E 2L8TA 4B3TE 1HNZE 2EPNA 2DLQA 2EP3A 4OOGC 2DRPA 3AV0A 2LJHA 1X6EA 4WSGA 4WSPA 1IMUA 2MKDA 2EOYA 2EPZA 2EPUA 3H09A 2NABA 5AC4A 4R2AA 4AQYE 1NEIA 1WXRA 4X65E 2EM9A 5AASA 4J8ZA 4BS9A 2ENCA 4TUGA 2EOFA 2EMAA 2M4IA 3C6KA 4JV5E 1X5WA 4DV6E 2EM8A 3C4BA 4KWYA 2R76A 1IQSA 3ADJA 2NUFA 2R1FA 2MDRA 4LF8E 1T4LB 5LMUE 4JYAE 3ADIA 1WHNA 1X3CA 3JAMC 5IWAE 3BBGA 1L4SA 4RH8A 2VQEE 2EN4A 1XMQE 2EN7A 1YYWA 2WZOA 4R03A 1XMOE 2DSYA 4DR1E 1KYQA 4GKJE 1QNTA 5ADZA 3KZZA 2EN8A 1PJQA 2ODRC 4M0VA 1PKPA 4DR6E 3KZYA 4YY3E 2YTJA 2B9DA 1A1HA 1FKAE 2VRDA 3ZOQB 2EMBA 3J81C 2V87A 2LT7A 2YWQA 2E1MA 4M9VC 2F8BA 5LLQA 4HEIA 2LMZA 2YPNA 1T4NA 2EMXA 2UXBE 1STUA 2EMKA 4JI1E 2EMZA 2KONA 4R2PA 2EMWA 1FJGE 2YSPA 4O43A 2K7IA 1UHZA 4HTGA 2NA2A 4R2RA 4BC7A 3L00A 4M30A 3MHSC 3HTXA 4R8OA 4BMJA 2EOEA 2A25A 2EM2A 2JPAA 2BB8A 1YFHA 5F3WA 2EOZA 4X9JA 1JK1A 1YUJA 2EQ3A 2RPCA 1SFEA 4R2DA 2MKNA 3OTOE 3M99B 2EM6A 2WBUA 2EMFA 3VYXA 2EMYA 2GHFA 1A1GA 2EE8A 5IV8B 1WRJA 2EL5A 4MLQA 3EPKA 4KZSA 2JOBA 2LBSB 4LFAE 3EQ1A 2UUBE 1O0WA 4WXCA 1YYKA 4DV2E 4DV7E 1ZBQA 4I8OA 1AAYA 4X64E 2I9IA 1PJTA 2DMIA 2RSIA 4DV4E 1XNQE 2YTQA 5AE2A 4R2SA 2DMYA 4YHHE 4BCAA 2EOSA 4X62E 4OX9E 2EN2A 2EPRA 2L92A 4WPYA 5A6AA 1F2IG 2ENAA 4JI4E 5LMNE 2EORA 2ELZA 2ENHA 3HPSA 2EM7A 2E5LE 2EMCA 1UBDC 2EMGA 3BGHA 1N36E 4LF6E 1DI2A 4L5NC 4F9CB 2EPOA 2CTDA 4JI2E 2M7QA 2DIXA 5FLXC 2M9AA 1N32E 2EJ4A 1EH6A 4B3RE 4MLVA 5A2QC 2EMHA 2EPXA 1HNXE 2EPAA 2EOXA 2DLKA 2EN6A 2G7HA 4F6NA 1T38A 1QU6A 2ZM6E 4F9BB 4DR5E 3QG5C 2M1SA 1NCSA 5TSEA 4NXNE 1WHQA 1HNWE 1X6HA 2L6MA 2LE2A 4B3ME 3J7AG 2RS7A 2HGHA 2YRHA 2Q8UA 2DB2A 2MC6A 3UK3C 2RSMA 3RMPA 1YSAC 3C4TA 5IXMB 1WJPA 2YTOA 4LTYA 5AE3A 2WCC3 3C6MA 1EH8A 2B3TB 2L2KB 4JI6E 2WBTA 2EOQA 3ECRA 1N33E 2ADRA 2RS6A 1EH7A 1X6FA 4P78A 4LFBE 4WYQB 2FTXB 2YU5A 1GQEA 2LCEA 2YZTA 3HQ1A 2YTEA 4RHBB 4DUYE 4LF9E 4N4RB 4NZVA 2EPMX 2V8QB 3VYYA 2YT4A 2HC5A 2V86A 2L3CA 1X48A 1KJKA 1IQOA 2EMIA 4DMIA 3JU0A 4FK5C 1N3GA 4JI8E 4KHPE 2GPIA 4M2ZA 5A69A 5KL6A 2LUQA 1EKZA 2VE7C 2RQLA 1TF3A 4DV1E 2N3HA 1GTKA 1RC7A 4X66E 4DV0E 3K6QA 2EL4A 3VK6A 4ZYGA 2I13A 2EPPA 2EOJA 2CT1A 3THOB 3ADLA 3DF6A 3ADGA 2NUEA 2N8XA 5A6KA 2LJUA 2EM4A 2YTDA 5IT9C 4BBYA 2YRKA 2B7TA 1J5EE 1BBGA 1DQ3A 2JY9A 5DNYA 3LLHA 2MC5A 2EM3A 2EN1A 4BC9A 2JVAA 4DR3E 4B3SE 1JK2A 5BR8E 2EOHA 2KOUA 1A1FA 2CSHA 2JP9A 2LVHA 1A1KA 2YTGA 2UXDE 3THNA 1Z1BA 1XNRE 4JI5E 2L2MA 2F4VE 4DR4E 4L8NA 1J26A 2PRTA 4LF4E 3BIDA 1YUIA 2CPNA 2EPLX 2EOIA 3EPJA 4NXME 2IHR1 2EM0A 1BBOA 3TQMA 1DGCA 1YPNA 2EN3A 3EPHA 1MEYC 2JXPA 5T6JA 2JR1A 2EQ1A 4O24A 2L33A 1RMDA 1IBKE 2K4VA 5KL5A 4ZYDA 2FV4B 1X49A 1X47A 4O4KA 1BB8A 1ZU1A 4F54A 5KL7A 2B7VA 2N3GA 4BHCA 4WX9A 2RTXA 2EM5A 2JYAA 5A6BA 3BF2A 2YTPA 2VQFE 4WXDA 2V85A 1PJSA 2YSOA 4DKKA 4R2CA 5A6BD 5AE1A 2LV2A 2LO3A 2GLIA 4ZYEA 3MSWA 1B69A 2KHXA 1G2DC 4Q28A 4F6MA 2UXCE 3HXLA 2YRMA 2V88A 5AC5A 3IWBA 4K0KE 4DV5E 5KL4A 3JTZA 4GEQB 4IS1C 1N34E 2UUCE 3LMLA 3IWCA 2J7JA 4WFTA 4LF5E 1LLMC 1ZAAC 4LU9A 3HPZA 2V89A 3T1YE 1IBME 4DR7E 2HHHE 2EPCA 4DUZE 2MDGA 1ZBTA 1A1IA 4GZNC
chains in the Genus database with same CATH topology
2CT1A 2ELYA 2R1FA 2EOSA 2EN2A 2EPRA 1UN6B 1F2IG 2ENAA 1X3CA 2YU8A 2EM4A 2YTDA 4GZNC 1TN9A 2EORA 2YRKA 1A1JA 2ELZA 2ENHA 3VHTB 2EN4A 2EM7A 2EOMA 2EN7A 2EMCA 1UBDC 2EM3A 2EMGA 1G2FC 2EN1A 2D9HA 4R2QA 2EOOA 2EMLA 1JK2A 2EN8A 2EOHA 2WBSA 2CTDA 1A1FA 2CSHA 2JP9A 2LVHA 1A1KA 2YTGA 1Z1BA 2M9AA 2YTJA 2EJ4A 1A1HA 1TF6A 2VRDA 2EMBA 2EMHA 2PRTA 2DGCA 2EPXA 1A1LA 1YUIA 2EPAA 2EOIA 2EOXA 2LT7A 2DLKA 2EN6A 3EPJA 4M9VC 2EM0A 4F6NA 2YTNA 3EPHA 1DGCA 2EQ0A 2EN3A 2YTIA 1BBOA 1MEYC 4IJDA 2EMXA 1ZR9A 1P47A 1NCSA 2EMKA 2EMZA 2EQ1A 4R2EA 1X6HA 1RMDA 5KL5A 4R2PA 2HGHA 2EMWA 2YRHA 2YSPA 2YTFA 1BB8A 1ZU1A 5KL3A 3EPLA 5KL7A 3UK3C 4F2JC 4R2RA 1YSAC 5KL2A 3MHSC 2E72A 3MHHC 1WJPA 2EL6A 2YTOA 2EM5A 2WCC3 2EOEA 2A25A 2EM2A 2JPAA 2YTPA 2BB8A 2WBTA 2EOQA 2YSOA 2EOZA 4X9JA 4R2CA 2ADRA 1JK1A 1YUJA 1X6FA 2EQ3A 2LV2A 2RPCA 4R2DA 2MKNA 3M99B 2LO3A 2EM6A 2WBUA 2YU5A 2LCEA 2GLIA 2EMFA 2DLQA 2YTEA 2EP3A 1B69A 2DRPA 1G2DC 2EMYA 2GHFA 1X6EA 2EE8A 4WSGA 2EL5A 4F6MA 1A1GA 2YRMA 3EPKA 2MKDA 2EOYA 5KL4A 1KJKA 2EPZA 2EMIA 4IS1C 2EPUA 2NABA 4FK5C 4R2AA 2J7JA 5KL6A 2EM9A 1LLMC 1ZAAC 1TF3A 2ENCA 1AAYA 2EOFA 2EMAA 2DMIA 2RSIA 2EPCA 2YTQA 2MDGA 1X5WA 2EL4A 4R2SA 1A1IA 2EM8A 2I13A 2EPPA 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT1 A;  2ELY A;  2R1F A;  2EOS A;  2EN2 A;  2EPR A;  1UN6 B;  1F2I G;  2ENA A;  1X3C A;  2YU8 A;  2EM4 A;  2YTD A;  4GZN C;  1TN9 A;  2EOR A;  2YRK A;  1A1J A;  2ELZ A;  2ENH A;  3VHT B;  2EN4 A;  2EM7 A;  2EOM A;  2EN7 A;  2EMC A;  1UBD C;  2EM3 A;  2EMG A;  1G2F C;  2EN1 A;  2D9H A;  4R2Q A;  2EOO A;  2EML A;  1JK2 A;  2EN8 A;  2EOH A;  2WBS A;  2CTD A;  1A1F A;  2CSH A;  2JP9 A;  2LVH A;  1A1K A;  2YTG A;  1Z1B A;  2M9A A;  2YTJ A;  2EJ4 A;  1A1H A;  1TF6 A;  2VRD A;  2EMB A;  2EMH A;  2PRT A;  2DGC A;  2EPX A;  1A1L A;  1YUI A;  2EPA A;  2EOI A;  2EOX A;  2LT7 A;  2DLK A;  2EN6 A;  3EPJ A;  4M9V C;  2EM0 A;  4F6N A;  2YTN A;  3EPH A;  1DGC A;  2EQ0 A;  2EN3 A;  2YTI A;  1BBO A;  1MEY C;  4IJD A;  2EMX A;  1ZR9 A;  1P47 A;  1NCS A;  2EMK A;  2EMZ A;  2EQ1 A;  4R2E A;  1X6H A;  1RMD A;  5KL5 A;  4R2P A;  2HGH A;  2EMW A;  2YRH A;  2YSP A;  2YTF A;  1BB8 A;  1ZU1 A;  5KL3 A;  3EPL A;  5KL7 A;  3UK3 C;  4F2J C;  4R2R A;  1YSA C;  5KL2 A;  3MHS C;  2E72 A;  3MHH C;  1WJP A;  2EL6 A;  2YTO A;  2EM5 A;  2WCC 3;  2EOE A;  2A25 A;  2EM2 A;  2JPA A;  2YTP A;  2BB8 A;  2WBT A;  2EOQ A;  2YSO A;  2EOZ A;  4X9J A;  4R2C A;  2ADR A;  1JK1 A;  1YUJ A;  1X6F A;  2EQ3 A;  2LV2 A;  2RPC A;  4R2D A;  2MKN A;  3M99 B;  2LO3 A;  2EM6 A;  2WBU A;  2YU5 A;  2LCE A;  2GLI A;  2EMF A;  2DLQ A;  2YTE A;  2EP3 A;  1B69 A;  2DRP A;  1G2D C;  2EMY A;  2GHF A;  1X6E A;  2EE8 A;  4WSG A;  2EL5 A;  4F6M A;  1A1G A;  2YRM A;  3EPK A;  2MKD A;  2EOY A;  5KL4 A;  1KJK A;  2EPZ A;  2EMI A;  4IS1 C;  2EPU A;  2NAB A;  4FK5 C;  4R2A A;  2J7J A;  5KL6 A;  2EM9 A;  1LLM C;  1ZAA C;  1TF3 A;  2ENC A;  1AAY A;  2EOF A;  2EMA A;  2DMI A;  2RSI A;  2EPC A;  2YTQ A;  2MDG A;  1X5W A;  2EL4 A;  4R2S A;  1A1I A;  2EM8 A;  2I13 A;  2EPP A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 2BBG A;  2ELY A;  1YYO A;  3IWD A;  1UIL A;  3FIG A;  3T1H E;  1HR0 E;  1UN6 B;  2L3J A;  2YU8 A;  1T39 A;  1TN9 A;  2LTS A;  3P1X A;  1A1J A;  1AH5 A;  4GKK E;  3VHT B;  1RQ0 A;  2L2N A;  1IBL E;  1PDA A;  2EOM A;  5A6J A;  2V83 A;  4P7D A;  3J7Y p;  1G2F C;  2HJJ A;  5CFF E;  2D9H A;  4R2Q A;  2EOO A;  2EML A;  4O5G A;  2H36 X;  2ODR D;  2WBS A;  2JWO A;  2VF1 A;  4X8W A;  3DJW A;  4DV3 E;  4ZYH A;  4DR2 E;  2UUA E;  4JI3 E;  1TF6 A;  4Q35 B;  4LFC E;  2DGC A;  1A1L A;  2NUG A;  2LRS A;  4TUI A;  5LL6 R;  2YTN A;  3J80 C;  4F9A B;  2EQ0 A;  2YTI A;  3KWR A;  4LF7 E;  3AUZ A;  1SR9 A;  4IJD A;  1YZ9 A;  1ZR9 A;  3OML A;  1P47 A;  3F6G A;  4R2E A;  4BHB A;  4JI7 E;  2EPK X;  2YTF A;  3F6H A;  5KL3 A;  3EPL A;  2LUP B;  4F2J C;  5KL2 A;  1T4O A;  2E72 A;  4NHR A;  3MHH C;  2EL6 A;  4JI0 E;  2FGG A;  2EWL A;  1MGT A;  2EZ6 A;  2JOX A;  1I94 E;  2LTR A;  1GZ6 A;  2UU9 E;  2L8T A;  4B3T E;  1HNZ E;  2EPN A;  2DLQ A;  2EP3 A;  4OOG C;  2DRP A;  3AV0 A;  2LJH A;  1X6E A;  4WSG A;  4WSP A;  1IMU A;  2MKD A;  2EOY A;  2EPZ A;  2EPU A;  3H09 A;  2NAB A;  5AC4 A;  4R2A A;  4AQY E;  1NEI A;  1WXR A;  4X65 E;  2EM9 A;  5AAS A;  4J8Z A;  4BS9 A;  2ENC A;  4TUG A;  2EOF A;  2EMA A;  2M4I A;  3C6K A;  4JV5 E;  1X5W A;  4DV6 E;  2EM8 A;  3C4B A;  4KWY A;  2R76 A;  1IQS A;  3ADJ A;  2NUF A;  2R1F A;  2MDR A;  4LF8 E;  1T4L B;  5LMU E;  4JYA E;  3ADI A;  1WHN A;  1X3C A;  3JAM C;  5IWA E;  3BBG A;  1L4S A;  4RH8 A;  2VQE E;  2EN4 A;  1XMQ E;  2EN7 A;  1YYW A;  2WZO A;  4R03 A;  1XMO E;  2DSY A;  4DR1 E;  1KYQ A;  4GKJ E;  1QNT A;  5ADZ A;  3KZZ A;  2EN8 A;  1PJQ A;  2ODR C;  4M0V A;  1PKP A;  4DR6 E;  3KZY A;  4YY3 E;  2YTJ A;  2B9D A;  1A1H A;  1FKA E;  2VRD A;  3ZOQ B;  2EMB A;  3J81 C;  2V87 A;  2LT7 A;  2YWQ A;  2E1M A;  4M9V C;  2F8B A;  5LLQ A;  4HEI A;  2LMZ A;  2YPN A;  1T4N A;  2EMX A;  2UXB E;  1STU A;  2EMK A;  4JI1 E;  2EMZ A;  2KON A;  4R2P A;  2EMW A;  1FJG E;  2YSP A;  4O43 A;  2K7I A;  1UHZ A;  4HTG A;  2NA2 A;  4R2R A;  4BC7 A;  3L00 A;  4M30 A;  3MHS C;  3HTX A;  4R8O A;  4BMJ A;  2EOE A;  2A25 A;  2EM2 A;  2JPA A;  2BB8 A;  1YFH A;  5F3W A;  2EOZ A;  4X9J A;  1JK1 A;  1YUJ A;  2EQ3 A;  2RPC A;  1SFE A;  4R2D A;  2MKN A;  3OTO E;  3M99 B;  2EM6 A;  2WBU A;  2EMF A;  3VYX A;  2EMY A;  2GHF A;  1A1G A;  2EE8 A;  5IV8 B;  1WRJ A;  2EL5 A;  4MLQ A;  3EPK A;  4KZS A;  2JOB A;  2LBS B;  4LFA E;  3EQ1 A;  2UUB E;  1O0W A;  4WXC A;  1YYK A;  4DV2 E;  4DV7 E;  1ZBQ A;  4I8O A;  1AAY A;  4X64 E;  2I9I A;  1PJT A;  2DMI A;  2RSI A;  4DV4 E;  1XNQ E;  2YTQ A;  5AE2 A;  4R2S A;  2DMY A;  4YHH E;  4BCA A;  2EOS A;  4X62 E;  4OX9 E;  2EN2 A;  2EPR A;  2L92 A;  4WPY A;  5A6A A;  1F2I G;  2ENA A;  4JI4 E;  5LMN E;  2EOR A;  2ELZ A;  2ENH A;  3HPS A;  2EM7 A;  2E5L E;  2EMC A;  1UBD C;  2EMG A;  3BGH A;  1N36 E;  4LF6 E;  1DI2 A;  4L5N C;  4F9C B;  2EPO A;  2CTD A;  4JI2 E;  2M7Q A;  2DIX A;  5FLX C;  2M9A A;  1N32 E;  2EJ4 A;  1EH6 A;  4B3R E;  4MLV A;  5A2Q C;  2EMH A;  2EPX A;  1HNX E;  2EPA A;  2EOX A;  2DLK A;  2EN6 A;  2G7H A;  4F6N A;  1T38 A;  1QU6 A;  2ZM6 E;  4F9B B;  4DR5 E;  3QG5 C;  2M1S A;  1NCS A;  5TSE A;  4NXN E;  1WHQ A;  1HNW E;  1X6H A;  2L6M A;  2LE2 A;  4B3M E;  3J7A G;  2RS7 A;  2HGH A;  2YRH A;  2Q8U A;  2DB2 A;  2MC6 A;  3UK3 C;  2RSM A;  3RMP A;  1YSA C;  3C4T A;  5IXM B;  1WJP A;  2YTO A;  4LTY A;  5AE3 A;  2WCC 3;  3C6M A;  1EH8 A;  2B3T B;  2L2K B;  4JI6 E;  2WBT A;  2EOQ A;  3ECR A;  1N33 E;  2ADR A;  2RS6 A;  1EH7 A;  1X6F A;  4P78 A;  4LFB E;  4WYQ B;  2FTX B;  2YU5 A;  1GQE A;  2LCE A;  2YZT A;  3HQ1 A;  2YTE A;  4RHB B;  4DUY E;  4LF9 E;  4N4R B;  4NZV A;  2EPM X;  2V8Q B;  3VYY A;  2YT4 A;  2HC5 A;  2V86 A;  2L3C A;  1X48 A;  1KJK A;  1IQO A;  2EMI A;  4DMI A;  3JU0 A;  4FK5 C;  1N3G A;  4JI8 E;  4KHP E;  2GPI A;  4M2Z A;  5A69 A;  5KL6 A;  2LUQ A;  1EKZ A;  2VE7 C;  2RQL A;  1TF3 A;  4DV1 E;  2N3H A;  1GTK A;  1RC7 A;  4X66 E;  4DV0 E;  3K6Q A;  2EL4 A;  3VK6 A;  4ZYG A;  2I13 A;  2EPP A;  2EOJ A;  2CT1 A;  3THO B;  3ADL A;  3DF6 A;  3ADG A;  2NUE A;  2N8X A;  5A6K A;  2LJU A;  2EM4 A;  2YTD A;  5IT9 C;  4BBY A;  2YRK A;  2B7T A;  1J5E E;  1BBG A;  1DQ3 A;  2JY9 A;  5DNY A;  3LLH A;  2MC5 A;  2EM3 A;  2EN1 A;  4BC9 A;  2JVA A;  4DR3 E;  4B3S E;  1JK2 A;  5BR8 E;  2EOH A;  2KOU A;  1A1F A;  2CSH A;  2JP9 A;  2LVH A;  1A1K A;  2YTG A;  2UXD E;  3THN A;  1Z1B A;  1XNR E;  4JI5 E;  2L2M A;  2F4V E;  4DR4 E;  4L8N A;  1J26 A;  2PRT A;  4LF4 E;  3BID A;  1YUI A;  2CPN A;  2EPL X;  2EOI A;  3EPJ A;  4NXM E;  2IHR 1;  2EM0 A;  1BBO A;  3TQM A;  1DGC A;  1YPN A;  2EN3 A;  3EPH A;  1MEY C;  2JXP A;  5T6J A;  2JR1 A;  2EQ1 A;  4O24 A;  2L33 A;  1RMD A;  1IBK E;  2K4V A;  5KL5 A;  4ZYD A;  2FV4 B;  1X49 A;  1X47 A;  4O4K A;  1BB8 A;  1ZU1 A;  4F54 A;  5KL7 A;  2B7V A;  2N3G A;  4BHC A;  4WX9 A;  2RTX A;  2EM5 A;  2JYA A;  5A6B A;  3BF2 A;  2YTP A;  2VQF E;  4WXD A;  2V85 A;  1PJS A;  2YSO A;  4DKK A;  4R2C A;  5A6B D;  5AE1 A;  2LV2 A;  2LO3 A;  2GLI A;  4ZYE A;  3MSW A;  1B69 A;  2KHX A;  1G2D C;  4Q28 A;  4F6M A;  2UXC E;  3HXL A;  2YRM A;  2V88 A;  5AC5 A;  3IWB A;  4K0K E;  4DV5 E;  5KL4 A;  3JTZ A;  4GEQ B;  4IS1 C;  1N34 E;  2UUC E;  3LML A;  3IWC A;  2J7J A;  4WFT A;  4LF5 E;  1LLM C;  1ZAA C;  4LU9 A;  3HPZ A;  2V89 A;  3T1Y E;  1IBM E;  4DR7 E;  2HHH E;  2EPC A;  4DUZ E;  2MDG A;  1ZBT A;  1A1I A;  4GZN C; 
#chains in the Genus database with same CATH homology
 2CT1 A;  2ELY A;  2R1F A;  2EOS A;  2EN2 A;  2EPR A;  1UN6 B;  1F2I G;  2ENA A;  1X3C A;  2YU8 A;  2EM4 A;  2YTD A;  4GZN C;  1TN9 A;  2EOR A;  2YRK A;  1A1J A;  2ELZ A;  2ENH A;  3VHT B;  2EN4 A;  2EM7 A;  2EOM A;  2EN7 A;  2EMC A;  1UBD C;  2EM3 A;  2EMG A;  1G2F C;  2EN1 A;  2D9H A;  4R2Q A;  2EOO A;  2EML A;  1JK2 A;  2EN8 A;  2EOH A;  2WBS A;  2CTD A;  1A1F A;  2CSH A;  2JP9 A;  2LVH A;  1A1K A;  2YTG A;  1Z1B A;  2M9A A;  2YTJ A;  2EJ4 A;  1A1H A;  1TF6 A;  2VRD A;  2EMB A;  2EMH A;  2PRT A;  2DGC A;  2EPX A;  1A1L A;  1YUI A;  2EPA A;  2EOI A;  2EOX A;  2LT7 A;  2DLK A;  2EN6 A;  3EPJ A;  4M9V C;  2EM0 A;  4F6N A;  2YTN A;  3EPH A;  1DGC A;  2EQ0 A;  2EN3 A;  2YTI A;  1BBO A;  1MEY C;  4IJD A;  2EMX A;  1ZR9 A;  1P47 A;  1NCS A;  2EMK A;  2EMZ A;  2EQ1 A;  4R2E A;  1X6H A;  1RMD A;  5KL5 A;  4R2P A;  2HGH A;  2EMW A;  2YRH A;  2YSP A;  2YTF A;  1BB8 A;  1ZU1 A;  5KL3 A;  3EPL A;  5KL7 A;  3UK3 C;  4F2J C;  4R2R A;  1YSA C;  5KL2 A;  3MHS C;  2E72 A;  3MHH C;  1WJP A;  2EL6 A;  2YTO A;  2EM5 A;  2WCC 3;  2EOE A;  2A25 A;  2EM2 A;  2JPA A;  2YTP A;  2BB8 A;  2WBT A;  2EOQ A;  2YSO A;  2EOZ A;  4X9J A;  4R2C A;  2ADR A;  1JK1 A;  1YUJ A;  1X6F A;  2EQ3 A;  2LV2 A;  2RPC A;  4R2D A;  2MKN A;  3M99 B;  2LO3 A;  2EM6 A;  2WBU A;  2YU5 A;  2LCE A;  2GLI A;  2EMF A;  2DLQ A;  2YTE A;  2EP3 A;  1B69 A;  2DRP A;  1G2D C;  2EMY A;  2GHF A;  1X6E A;  2EE8 A;  4WSG A;  2EL5 A;  4F6M A;  1A1G A;  2YRM A;  3EPK A;  2MKD A;  2EOY A;  5KL4 A;  1KJK A;  2EPZ A;  2EMI A;  4IS1 C;  2EPU A;  2NAB A;  4FK5 C;  4R2A A;  2J7J A;  5KL6 A;  2EM9 A;  1LLM C;  1ZAA C;  1TF3 A;  2ENC A;  1AAY A;  2EOF A;  2EMA A;  2DMI A;  2RSI A;  2EPC A;  2YTQ A;  2MDG A;  1X5W A;  2EL4 A;  4R2S A;  1A1I A;  2EM8 A;  2I13 A;  2EPP A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...