4IS1C

Crystal structure of znf217 bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
b'RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of ZNF217
doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
total genus 16
structure length 52
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4is1C00
2EMZA 1X5WA 2BB8A 2RSIA 3EPJA 1TF6A 2EM3A 4WSGA 2YTFA 2JPAA 2CSHA 1A1LA 1YSAC 2EOJA 4F2JC 2EPXA 3EPLA 1ZU1A 2EQ1A 2EOQA 2M9AA 2CT1A 2ENHA 1A1GA 2EMAA 2YU5A 2MDGA 4FK5C 1G2FC 4F6NA 3EPHA 2EM7A 4R2PA 2DMIA 1X3CA 2YU8A 4F6MA 2EN8A 2DRPA 2RPCA 2EE8A 2LO3A 3VHTB 2YRKA 2EPRA 3MHHC 2EMHA 2YRMA 2EMXA 2EPAA 2YTEA 1A1KA 1JK2A 2A25A 1Z1BA 1MEYC 5KL7A 2ELZA 3M99B 2YTQA 1A1HA 2EOXA 2YTDA 1TN9A 4M9VC 2EQ3A 1F2IG 1A1JA 2EN6A 2EM9A 5KL6A 2EOSA 1G2DC 2EN2A 2CTDA 2EMKA 3EPKA 1UN6B 2GHFA 1TF3A 2LCEA 2EQ0A 2WBSA 2LV2A 2EOEA 2EOOA 1RMDA 2EOFA 2YTGA 2EJ4A 2YTJA 2EM6A 4X9JA 2EL6A 4GZNC 1NCSA 2EN7A 4R2DA 5KL5A 2EP3A 2MKNA 2EL4A 1X6EA 2YSOA 1A1FA 2EM8A 1JK1A 2I13A 2EPUA 2YTIA 2EPPA 1YUIA 1BB8A 2WBUA 2WCC3 1P47A 2ELYA 1YUJA 2EOYA 4R2SA 1X6FA 2E72A 2EOIA 5KL2A 4IJDA 2EPZA 5KL4A 2EMGA 2LVHA 1ZR9A 1ZAAC 1LLMC 2EOZA 4R2QA 2PRTA 1WJPA 2EMFA 2ENCA 3MHSC 2JP9A 1UBDC 1A1IA 4IS1C 2EMCA 1BBOA 2EOHA 1B69A 2ADRA 2GLIA 2EN3A 2R1FA 2NABA 1KJKA 2EM4A 2EM5A 2EOMA 2ENAA 2EMWA 2YRHA 2HGHA 1DGCA 1X6HA 2MKDA 2LT7A 2YSPA 2EMBA 2EL5A 2DLKA 2D9HA 2DLQA 2EMLA 2YTOA 2EN4A 2EMYA 5KL3A 2EMIA 4R2AA 2EORA 2YTNA 4R2RA 4R2CA 4R2EA 1AAYA 2WBTA 3UK3C 2DGCA 2EM2A 2YTPA 2EPCA 2VRDA 2EN1A 2J7JA 2EM0A
chains in the Genus database with same CATH superfamily
1YZ9A 2B3TB 2BB8A 1WHNA 1T39A 4MLQA 4WSGA 1YSAC 2EZ6A 1N3GA 1PJQA 1XNQE 4WFTA 4JI5E 4RH8A 2UUBE 2M9AA 1A1GA 2EMAA 4FK5C 2FTXB 1QNTA 4DR5E 2UXDE 4O24A 3VHTB 2H36X 4O5GA 2E1MA 4TUGA 2EPAA 2NUEA 5AE2A 2V85A 1T38A 4X66E 5KL7A 2YZTA 4JI3E 1A1HA 2EOXA 2YTDA 4GEQB 4DV3E 1PDAA 1ZBTA 2EQ3A 2JWOA 1F2IG 2MC5A 2EOSA 2CPNA 2EMKA 4LF9E 4LF8E 4BC7A 4DKKA 2LTSA 4KHPE 2L8TA 2EM6A 3OMLA 4F9CB 4LFAE 2K7IA 1N32E 4R2DA 2YPNA 4P7DA 2EL4A 1BBGA 1A1FA 3THNA 3FIGA 3ADGA 4DR2E 1JK1A 3ADLA 2FGGA 4BCAA 1EH6A 2EPPA 1MGTA 2F4VE 1BB8A 2K4VA 4HEIA 2LRSA 1X6FA 3BBGA 2B7VA 2JR1A 2M4IA 4LF7E 2V8QB 4NZVA 1ZAAC 4BC9A 1UHZA 3HPSA 4NXME 4DV5E 1WJPA 4DUYE 3MHSC 3J7AG 2EMCA 1BBOA 2N3HA 3OTOE 4ZYEA 2NABA 2V83A 3JU0A 2EM5A 2ENAA 5TSEA 2N3GA 1X6HA 2ODRD 3QG5C 4DUZE 2GPIA 2MKDA 1PKPA 3ADJA 2LT7A 1IBME 2D9HA 1YYOA 3AUZA 2NUGA 2V87A 2UU9E 3KZZA 4J8ZA 1EH7A 4DV1E 4R2EA 4K0KE 2EWLA 4BMJA 2DGCA 5A6BA 3DF6A 2EN1A 2UUAE 2EMZA 1X5WA 2G7HA 4LFCE 2YTFA 1A1LA 5IXMB 1N34E 1ZU1A 2EQ1A 4RHBB 1X49A 4F6NA 3VK6A 2N8XA 2DMIA 3RMPA 1X3CA 2YU8A 5FLXC 1IQSA 4F6MA 2LO3A 5LL6R 2EPRA 4JI8E 4BS9A 1YYWA 5DNYA 1A1KA 1UILA 1EH8A 1GTKA 2A25A 1MEYC 4GKKE 2ELZA 2YTQA 4WX9A 2VF1A 1TN9A 2EM9A 4HTGA 5AC5A 4JI2E 2WZOA 2RSMA 5F3WA 4B3SE 2LJHA 1X47A 2EOOA 1KYQA 2YTJA 2EJ4A 2L33A 4L5NC 2EL6A 2M7QA 1NCSA 5A6BD 3J81C 1XMOE 4JI1E 5KL5A 4NXNE 1T4LB 2YSOA 2NUFA 1DI2A 2LBSB 2YWQA 4WXDA 1IBLE 1YUIA 4JYAE 2UXBE 2KHXA 1J5EE 4F9AB 1YUJA 4LF6E 2EOYA 4R2SA 2EOIA 1WHQA 2I9IA 5KL2A 4TUIA 2BBGA 3IWCA 4Q35B 4IJDA 4LTYA 4JI6E 2EMGA 3C4BA 4X8WA 5CFFE 4LU9A 4X64E 4DV2E 5LMNE 4IS1C 2L2MA 1XMQE 2EN3A 4LFBE 2R1FA 3P1XA 4DR1E 2DB2A 2EM4A 1I94E 2HGHA 4N4RB 3ZOQB 1DGCA 5BR8E 2NA2A 2UXCE 5ADZA 2EL5A 4M0VA 2YTOA 2V86A 4BHCA 1IQOA 2B7TA 4Q28A 3T1HE 3BF2A 4LF5E 3JTZA 1RQ0A 1EKZA 2EPCA 4R03A 2EPKX 2JPAA 2CSHA 4JV5E 4F2JC 3EPLA 1T4NA 2EOQA 5IWAE 2CT1A 2MC6A 1G2FC 4ZYGA 2KOUA 1J26A 2EN8A 2M1SA 4P78A 2RPCA 2EE8A 2JOXA 2RS7A 3H09A 2EMXA 2VQFE 1Z1BA 3TQMA 2UUCE 1FKAE 1HNZE 3M99B 4AQYE 4O4KA 2EPLX 2RTXA 1IBKE 4M9VC 1A1JA 2EN6A 4I8OA 2CTDA 4GKJE 2GHFA 2LCEA 3BIDA 4F54A 2JYAA 2LV2A 1O0WA 2EOEA 1RMDA 2EOFA 3L00A 2Q8UA 1RC7A 3THOB 4GZNC 2EN7A 4ZYHA 1N36E 2EP3A 2DSYA 4JI7E 5A6JA 3ECRA 1X6EA 4DV0E 4WSPA 5AE3A 3ADIA 4M30A 2EPUA 2YTIA 2KONA 4R8OA 2L3JA 1STUA 2E72A 4KWYA 2LE2A 2EPZA 5A6KA 5KL4A 4B3RE 2EPNA 4DV4E 2EOZA 3C4TA 4BBYA 3K6QA 3HXLA 3LMLA 2R76A 2EMFA 1UBDC 1L4SA 3VYXA 2L2KB 4JI0E 2GLIA 2LTRA 2V89A 1KJKA 5AE1A 1AH5A 1PJTA 2EOMA 4B3ME 4OOGC 3JAMC 4ZYDA 2L6MA 3HQ1A 3KWRA 1HR0E 3EQ1A 2EMYA 4LF4E 5KL3A 4M2ZA 2EMIA 1N33E 3F6HA 5A6AA 3KZYA 3T1YE 1SFEA 2YTNA 5AASA 3C6KA 4R2CA 2JXPA 1HNXE 2E5LE 4WPYA 3UK3C 1T4OA 2LUQA 4WXCA 2VRDA 2EMWA 2VE7C 2RSIA 3EPJA 4DR6E 2VQEE 2RS6A 2EM3A 1TF6A 4KZSA 2EOJA 2EPXA 5A2QC 2B9DA 1XNRE 2ENHA 4L8NA 2JY9A 2YU5A 2HHHE 2MDGA 3EPHA 2EM7A 4R2PA 2MDRA 2DRPA 1FJGE 5IT9C 2YRKA 3MHHC 1GZ6A 5LMUE 2EMHA 2YRMA 2YTEA 4DV7E 2LUPB 1JK2A 4DR4E 3HPZA 2JVAA 4MLVA 3DJWA 2EPMX 3HTXA 2IHR1 4BHBA 5KL6A 1G2DC 2EN2A 1DQ3A 3J80C 3EPKA 1UN6B 1TF3A 4X65E 2EQ0A 2WBSA 1NEIA 2YTGA 4DR3E 4X9JA 2DIXA 1PJSA 4F9BB 2RQLA 2LMZA 3LLHA 4DMIA 5A69A 2MKNA 1YPNA 4YY3E 2EM8A 2L3CA 1SR9A 2L92A 5IV8B 4YHHE 2HC5A 2I13A 1X48A 1WXRA 2ODRC 2L2NA 2WBUA 2WCC3 4JI4E 2DMYA 1P47A 2ELYA 4DV6E 3IWDA 3AV0A 3MSWA 3C6MA 4NHRA 2HJJA 2LVHA 1ZR9A 1LLMC 2FV4B 4OX9E 4R2QA 3VYYA 2F8BA 3F6GA 4O43A 2PRTA 2ENCA 2JP9A 1YYKA 1A1IA 2EOHA 1B69A 2JOBA 2ADRA 4WYQB 1HNWE 2EPOA 1WRJA 2V88A 1ZBQA 2YRHA 3BGHA 1GQEA 2YSPA 2EMBA 1YFHA 3J7Yp 2DLKA 2DLQA 2EMLA 2EN4A 2LJUA 5AC4A 4X62E 2EORA 4R2AA 4DR7E 4B3TE 1QU6A 5T6JA 4R2RA 1AAYA 1IMUA 2YT4A 3IWBA 5LLQA 2WBTA 2EM2A 2YTPA 2ZM6E 2J7JA 2EM0A
chains in the Genus database with same CATH topology
2EMZA 1X5WA 2BB8A 2RSIA 3EPJA 1TF6A 2EM3A 4WSGA 2YTFA 2JPAA 2CSHA 1A1LA 1YSAC 2EOJA 4F2JC 2EPXA 3EPLA 1ZU1A 2EQ1A 2EOQA 2M9AA 2CT1A 2ENHA 1A1GA 2EMAA 2YU5A 2MDGA 4FK5C 1G2FC 4F6NA 3EPHA 2EM7A 4R2PA 2DMIA 1X3CA 2YU8A 4F6MA 2EN8A 2DRPA 2RPCA 2EE8A 2LO3A 3VHTB 2YRKA 2EPRA 3MHHC 2EMHA 2YRMA 2EMXA 2EPAA 2YTEA 1A1KA 1JK2A 2A25A 1Z1BA 1MEYC 5KL7A 2ELZA 3M99B 2YTQA 1A1HA 2EOXA 2YTDA 1TN9A 4M9VC 2EQ3A 1F2IG 1A1JA 2EN6A 2EM9A 5KL6A 2EOSA 1G2DC 2EN2A 2CTDA 2EMKA 3EPKA 1UN6B 2GHFA 1TF3A 2LCEA 2EQ0A 2WBSA 2LV2A 2EOEA 2EOOA 1RMDA 2EOFA 2YTGA 2EJ4A 2YTJA 2EM6A 4X9JA 2EL6A 4GZNC 1NCSA 2EN7A 4R2DA 5KL5A 2EP3A 2MKNA 2EL4A 1X6EA 2YSOA 1A1FA 2EM8A 1JK1A 2I13A 2EPUA 2YTIA 2EPPA 1YUIA 1BB8A 2WBUA 2WCC3 1P47A 2ELYA 1YUJA 2EOYA 4R2SA 1X6FA 2E72A 2EOIA 5KL2A 4IJDA 2EPZA 5KL4A 2EMGA 2LVHA 1ZR9A 1ZAAC 1LLMC 2EOZA 4R2QA 2PRTA 1WJPA 2EMFA 2ENCA 3MHSC 2JP9A 1UBDC 1A1IA 4IS1C 2EMCA 1BBOA 2EOHA 1B69A 2ADRA 2GLIA 2EN3A 2R1FA 2NABA 1KJKA 2EM4A 2EM5A 2EOMA 2ENAA 2EMWA 2YRHA 2HGHA 1DGCA 1X6HA 2MKDA 2LT7A 2YSPA 2EMBA 2EL5A 2DLKA 2D9HA 2DLQA 2EMLA 2YTOA 2EN4A 2EMYA 5KL3A 2EMIA 4R2AA 2EORA 2YTNA 4R2RA 4R2CA 4R2EA 1AAYA 2WBTA 3UK3C 2DGCA 2EM2A 2YTPA 2EPCA 2VRDA 2EN1A 2J7JA 2EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMZ A;  1X5W A;  2BB8 A;  2RSI A;  3EPJ A;  1TF6 A;  2EM3 A;  4WSG A;  2YTF A;  2JPA A;  2CSH A;  1A1L A;  1YSA C;  2EOJ A;  4F2J C;  2EPX A;  3EPL A;  1ZU1 A;  2EQ1 A;  2EOQ A;  2M9A A;  2CT1 A;  2ENH A;  1A1G A;  2EMA A;  2YU5 A;  2MDG A;  4FK5 C;  1G2F C;  4F6N A;  3EPH A;  2EM7 A;  4R2P A;  2DMI A;  1X3C A;  2YU8 A;  4F6M A;  2EN8 A;  2DRP A;  2RPC A;  2EE8 A;  2LO3 A;  3VHT B;  2YRK A;  2EPR A;  3MHH C;  2EMH A;  2YRM A;  2EMX A;  2EPA A;  2YTE A;  1A1K A;  1JK2 A;  2A25 A;  1Z1B A;  1MEY C;  5KL7 A;  2ELZ A;  3M99 B;  2YTQ A;  1A1H A;  2EOX A;  2YTD A;  1TN9 A;  4M9V C;  2EQ3 A;  1F2I G;  1A1J A;  2EN6 A;  2EM9 A;  5KL6 A;  2EOS A;  1G2D C;  2EN2 A;  2CTD A;  2EMK A;  3EPK A;  1UN6 B;  2GHF A;  1TF3 A;  2LCE A;  2EQ0 A;  2WBS A;  2LV2 A;  2EOE A;  2EOO A;  1RMD A;  2EOF A;  2YTG A;  2EJ4 A;  2YTJ A;  2EM6 A;  4X9J A;  2EL6 A;  4GZN C;  1NCS A;  2EN7 A;  4R2D A;  5KL5 A;  2EP3 A;  2MKN A;  2EL4 A;  1X6E A;  2YSO A;  1A1F A;  2EM8 A;  1JK1 A;  2I13 A;  2EPU A;  2YTI A;  2EPP A;  1YUI A;  1BB8 A;  2WBU A;  2WCC 3;  1P47 A;  2ELY A;  1YUJ A;  2EOY A;  4R2S A;  1X6F A;  2E72 A;  2EOI A;  5KL2 A;  4IJD A;  2EPZ A;  5KL4 A;  2EMG A;  2LVH A;  1ZR9 A;  1ZAA C;  1LLM C;  2EOZ A;  4R2Q A;  2PRT A;  1WJP A;  2EMF A;  2ENC A;  3MHS C;  2JP9 A;  1UBD C;  1A1I A;  4IS1 C;  2EMC A;  1BBO A;  2EOH A;  1B69 A;  2ADR A;  2GLI A;  2EN3 A;  2R1F A;  2NAB A;  1KJK A;  2EM4 A;  2EM5 A;  2EOM A;  2ENA A;  2EMW A;  2YRH A;  2HGH A;  1DGC A;  1X6H A;  2MKD A;  2LT7 A;  2YSP A;  2EMB A;  2EL5 A;  2DLK A;  2D9H A;  2DLQ A;  2EML A;  2YTO A;  2EN4 A;  2EMY A;  5KL3 A;  2EMI A;  4R2A A;  2EOR A;  2YTN A;  4R2R A;  4R2C A;  4R2E A;  1AAY A;  2WBT A;  3UK3 C;  2DGC A;  2EM2 A;  2YTP A;  2EPC A;  2VRD A;  2EN1 A;  2J7J A;  2EM0 A; 
#chains in the Genus database with same CATH topology
 1YZ9 A;  2B3T B;  2BB8 A;  1WHN A;  1T39 A;  4MLQ A;  4WSG A;  1YSA C;  2EZ6 A;  1N3G A;  1PJQ A;  1XNQ E;  4WFT A;  4JI5 E;  4RH8 A;  2UUB E;  2M9A A;  1A1G A;  2EMA A;  4FK5 C;  2FTX B;  1QNT A;  4DR5 E;  2UXD E;  4O24 A;  3VHT B;  2H36 X;  4O5G A;  2E1M A;  4TUG A;  2EPA A;  2NUE A;  5AE2 A;  2V85 A;  1T38 A;  4X66 E;  5KL7 A;  2YZT A;  4JI3 E;  1A1H A;  2EOX A;  2YTD A;  4GEQ B;  4DV3 E;  1PDA A;  1ZBT A;  2EQ3 A;  2JWO A;  1F2I G;  2MC5 A;  2EOS A;  2CPN A;  2EMK A;  4LF9 E;  4LF8 E;  4BC7 A;  4DKK A;  2LTS A;  4KHP E;  2L8T A;  2EM6 A;  3OML A;  4F9C B;  4LFA E;  2K7I A;  1N32 E;  4R2D A;  2YPN A;  4P7D A;  2EL4 A;  1BBG A;  1A1F A;  3THN A;  3FIG A;  3ADG A;  4DR2 E;  1JK1 A;  3ADL A;  2FGG A;  4BCA A;  1EH6 A;  2EPP A;  1MGT A;  2F4V E;  1BB8 A;  2K4V A;  4HEI A;  2LRS A;  1X6F A;  3BBG A;  2B7V A;  2JR1 A;  2M4I A;  4LF7 E;  2V8Q B;  4NZV A;  1ZAA C;  4BC9 A;  1UHZ A;  3HPS A;  4NXM E;  4DV5 E;  1WJP A;  4DUY E;  3MHS C;  3J7A G;  2EMC A;  1BBO A;  2N3H A;  3OTO E;  4ZYE A;  2NAB A;  2V83 A;  3JU0 A;  2EM5 A;  2ENA A;  5TSE A;  2N3G A;  1X6H A;  2ODR D;  3QG5 C;  4DUZ E;  2GPI A;  2MKD A;  1PKP A;  3ADJ A;  2LT7 A;  1IBM E;  2D9H A;  1YYO A;  3AUZ A;  2NUG A;  2V87 A;  2UU9 E;  3KZZ A;  4J8Z A;  1EH7 A;  4DV1 E;  4R2E A;  4K0K E;  2EWL A;  4BMJ A;  2DGC A;  5A6B A;  3DF6 A;  2EN1 A;  2UUA E;  2EMZ A;  1X5W A;  2G7H A;  4LFC E;  2YTF A;  1A1L A;  5IXM B;  1N34 E;  1ZU1 A;  2EQ1 A;  4RHB B;  1X49 A;  4F6N A;  3VK6 A;  2N8X A;  2DMI A;  3RMP A;  1X3C A;  2YU8 A;  5FLX C;  1IQS A;  4F6M A;  2LO3 A;  5LL6 R;  2EPR A;  4JI8 E;  4BS9 A;  1YYW A;  5DNY A;  1A1K A;  1UIL A;  1EH8 A;  1GTK A;  2A25 A;  1MEY C;  4GKK E;  2ELZ A;  2YTQ A;  4WX9 A;  2VF1 A;  1TN9 A;  2EM9 A;  4HTG A;  5AC5 A;  4JI2 E;  2WZO A;  2RSM A;  5F3W A;  4B3S E;  2LJH A;  1X47 A;  2EOO A;  1KYQ A;  2YTJ A;  2EJ4 A;  2L33 A;  4L5N C;  2EL6 A;  2M7Q A;  1NCS A;  5A6B D;  3J81 C;  1XMO E;  4JI1 E;  5KL5 A;  4NXN E;  1T4L B;  2YSO A;  2NUF A;  1DI2 A;  2LBS B;  2YWQ A;  4WXD A;  1IBL E;  1YUI A;  4JYA E;  2UXB E;  2KHX A;  1J5E E;  4F9A B;  1YUJ A;  4LF6 E;  2EOY A;  4R2S A;  2EOI A;  1WHQ A;  2I9I A;  5KL2 A;  4TUI A;  2BBG A;  3IWC A;  4Q35 B;  4IJD A;  4LTY A;  4JI6 E;  2EMG A;  3C4B A;  4X8W A;  5CFF E;  4LU9 A;  4X64 E;  4DV2 E;  5LMN E;  4IS1 C;  2L2M A;  1XMQ E;  2EN3 A;  4LFB E;  2R1F A;  3P1X A;  4DR1 E;  2DB2 A;  2EM4 A;  1I94 E;  2HGH A;  4N4R B;  3ZOQ B;  1DGC A;  5BR8 E;  2NA2 A;  2UXC E;  5ADZ A;  2EL5 A;  4M0V A;  2YTO A;  2V86 A;  4BHC A;  1IQO A;  2B7T A;  4Q28 A;  3T1H E;  3BF2 A;  4LF5 E;  3JTZ A;  1RQ0 A;  1EKZ A;  2EPC A;  4R03 A;  2EPK X;  2JPA A;  2CSH A;  4JV5 E;  4F2J C;  3EPL A;  1T4N A;  2EOQ A;  5IWA E;  2CT1 A;  2MC6 A;  1G2F C;  4ZYG A;  2KOU A;  1J26 A;  2EN8 A;  2M1S A;  4P78 A;  2RPC A;  2EE8 A;  2JOX A;  2RS7 A;  3H09 A;  2EMX A;  2VQF E;  1Z1B A;  3TQM A;  2UUC E;  1FKA E;  1HNZ E;  3M99 B;  4AQY E;  4O4K A;  2EPL X;  2RTX A;  1IBK E;  4M9V C;  1A1J A;  2EN6 A;  4I8O A;  2CTD A;  4GKJ E;  2GHF A;  2LCE A;  3BID A;  4F54 A;  2JYA A;  2LV2 A;  1O0W A;  2EOE A;  1RMD A;  2EOF A;  3L00 A;  2Q8U A;  1RC7 A;  3THO B;  4GZN C;  2EN7 A;  4ZYH A;  1N36 E;  2EP3 A;  2DSY A;  4JI7 E;  5A6J A;  3ECR A;  1X6E A;  4DV0 E;  4WSP A;  5AE3 A;  3ADI A;  4M30 A;  2EPU A;  2YTI A;  2KON A;  4R8O A;  2L3J A;  1STU A;  2E72 A;  4KWY A;  2LE2 A;  2EPZ A;  5A6K A;  5KL4 A;  4B3R E;  2EPN A;  4DV4 E;  2EOZ A;  3C4T A;  4BBY A;  3K6Q A;  3HXL A;  3LML A;  2R76 A;  2EMF A;  1UBD C;  1L4S A;  3VYX A;  2L2K B;  4JI0 E;  2GLI A;  2LTR A;  2V89 A;  1KJK A;  5AE1 A;  1AH5 A;  1PJT A;  2EOM A;  4B3M E;  4OOG C;  3JAM C;  4ZYD A;  2L6M A;  3HQ1 A;  3KWR A;  1HR0 E;  3EQ1 A;  2EMY A;  4LF4 E;  5KL3 A;  4M2Z A;  2EMI A;  1N33 E;  3F6H A;  5A6A A;  3KZY A;  3T1Y E;  1SFE A;  2YTN A;  5AAS A;  3C6K A;  4R2C A;  2JXP A;  1HNX E;  2E5L E;  4WPY A;  3UK3 C;  1T4O A;  2LUQ A;  4WXC A;  2VRD A;  2EMW A;  2VE7 C;  2RSI A;  3EPJ A;  4DR6 E;  2VQE E;  2RS6 A;  2EM3 A;  1TF6 A;  4KZS A;  2EOJ A;  2EPX A;  5A2Q C;  2B9D A;  1XNR E;  2ENH A;  4L8N A;  2JY9 A;  2YU5 A;  2HHH E;  2MDG A;  3EPH A;  2EM7 A;  4R2P A;  2MDR A;  2DRP A;  1FJG E;  5IT9 C;  2YRK A;  3MHH C;  1GZ6 A;  5LMU E;  2EMH A;  2YRM A;  2YTE A;  4DV7 E;  2LUP B;  1JK2 A;  4DR4 E;  3HPZ A;  2JVA A;  4MLV A;  3DJW A;  2EPM X;  3HTX A;  2IHR 1;  4BHB A;  5KL6 A;  1G2D C;  2EN2 A;  1DQ3 A;  3J80 C;  3EPK A;  1UN6 B;  1TF3 A;  4X65 E;  2EQ0 A;  2WBS A;  1NEI A;  2YTG A;  4DR3 E;  4X9J A;  2DIX A;  1PJS A;  4F9B B;  2RQL A;  2LMZ A;  3LLH A;  4DMI A;  5A69 A;  2MKN A;  1YPN A;  4YY3 E;  2EM8 A;  2L3C A;  1SR9 A;  2L92 A;  5IV8 B;  4YHH E;  2HC5 A;  2I13 A;  1X48 A;  1WXR A;  2ODR C;  2L2N A;  2WBU A;  2WCC 3;  4JI4 E;  2DMY A;  1P47 A;  2ELY A;  4DV6 E;  3IWD A;  3AV0 A;  3MSW A;  3C6M A;  4NHR A;  2HJJ A;  2LVH A;  1ZR9 A;  1LLM C;  2FV4 B;  4OX9 E;  4R2Q A;  3VYY A;  2F8B A;  3F6G A;  4O43 A;  2PRT A;  2ENC A;  2JP9 A;  1YYK A;  1A1I A;  2EOH A;  1B69 A;  2JOB A;  2ADR A;  4WYQ B;  1HNW E;  2EPO A;  1WRJ A;  2V88 A;  1ZBQ A;  2YRH A;  3BGH A;  1GQE A;  2YSP A;  2EMB A;  1YFH A;  3J7Y p;  2DLK A;  2DLQ A;  2EML A;  2EN4 A;  2LJU A;  5AC4 A;  4X62 E;  2EOR A;  4R2A A;  4DR7 E;  4B3T E;  1QU6 A;  5T6J A;  4R2R A;  1AAY A;  1IMU A;  2YT4 A;  3IWB A;  5LLQ A;  2WBT A;  2EM2 A;  2YTP A;  2ZM6 E;  2J7J A;  2EM0 A; 
#chains in the Genus database with same CATH homology
 2EMZ A;  1X5W A;  2BB8 A;  2RSI A;  3EPJ A;  1TF6 A;  2EM3 A;  4WSG A;  2YTF A;  2JPA A;  2CSH A;  1A1L A;  1YSA C;  2EOJ A;  4F2J C;  2EPX A;  3EPL A;  1ZU1 A;  2EQ1 A;  2EOQ A;  2M9A A;  2CT1 A;  2ENH A;  1A1G A;  2EMA A;  2YU5 A;  2MDG A;  4FK5 C;  1G2F C;  4F6N A;  3EPH A;  2EM7 A;  4R2P A;  2DMI A;  1X3C A;  2YU8 A;  4F6M A;  2EN8 A;  2DRP A;  2RPC A;  2EE8 A;  2LO3 A;  3VHT B;  2YRK A;  2EPR A;  3MHH C;  2EMH A;  2YRM A;  2EMX A;  2EPA A;  2YTE A;  1A1K A;  1JK2 A;  2A25 A;  1Z1B A;  1MEY C;  5KL7 A;  2ELZ A;  3M99 B;  2YTQ A;  1A1H A;  2EOX A;  2YTD A;  1TN9 A;  4M9V C;  2EQ3 A;  1F2I G;  1A1J A;  2EN6 A;  2EM9 A;  5KL6 A;  2EOS A;  1G2D C;  2EN2 A;  2CTD A;  2EMK A;  3EPK A;  1UN6 B;  2GHF A;  1TF3 A;  2LCE A;  2EQ0 A;  2WBS A;  2LV2 A;  2EOE A;  2EOO A;  1RMD A;  2EOF A;  2YTG A;  2EJ4 A;  2YTJ A;  2EM6 A;  4X9J A;  2EL6 A;  4GZN C;  1NCS A;  2EN7 A;  4R2D A;  5KL5 A;  2EP3 A;  2MKN A;  2EL4 A;  1X6E A;  2YSO A;  1A1F A;  2EM8 A;  1JK1 A;  2I13 A;  2EPU A;  2YTI A;  2EPP A;  1YUI A;  1BB8 A;  2WBU A;  2WCC 3;  1P47 A;  2ELY A;  1YUJ A;  2EOY A;  4R2S A;  1X6F A;  2E72 A;  2EOI A;  5KL2 A;  4IJD A;  2EPZ A;  5KL4 A;  2EMG A;  2LVH A;  1ZR9 A;  1ZAA C;  1LLM C;  2EOZ A;  4R2Q A;  2PRT A;  1WJP A;  2EMF A;  2ENC A;  3MHS C;  2JP9 A;  1UBD C;  1A1I A;  4IS1 C;  2EMC A;  1BBO A;  2EOH A;  1B69 A;  2ADR A;  2GLI A;  2EN3 A;  2R1F A;  2NAB A;  1KJK A;  2EM4 A;  2EM5 A;  2EOM A;  2ENA A;  2EMW A;  2YRH A;  2HGH A;  1DGC A;  1X6H A;  2MKD A;  2LT7 A;  2YSP A;  2EMB A;  2EL5 A;  2DLK A;  2D9H A;  2DLQ A;  2EML A;  2YTO A;  2EN4 A;  2EMY A;  5KL3 A;  2EMI A;  4R2A A;  2EOR A;  2YTN A;  4R2R A;  4R2C A;  4R2E A;  1AAY A;  2WBT A;  3UK3 C;  2DGC A;  2EM2 A;  2YTP A;  2EPC A;  2VRD A;  2EN1 A;  2J7J A;  2EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...