4IS1C

Crystal structure of znf217 bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*TP*TP*TP*GP*CP*AP*GP*AP*AP*TP*CP*GP*AP*TP*TP*CP*TP*GP*
publication title New insights into DNA recognition by zinc fingers revealed by structural analysis of ZNF217
doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/dna
total genus 16
structure length 52
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 4is1C00
2EPZA 1A1KA 1YSAC 2R1FA 2EPAA 2YTDA 2LT7A 2NABA 2EM4A 2DRPA 4FK5C 2MKNA 2EOQA 2LVHA 5KL3A 2EN3A 2EM5A 2WBTA 3MHSC 2M9AA 4M9VC 1P47A 1TF6A 1TN9A 1RMDA 2EN1A 2EPPA 1NCSA 2A25A 2DLQA 2BB8A 4GZNC 3EPHA 2EMFA 2DGCA 3EPLA 2EM9A 2EM6A 2EOIA 2ADRA 1A1FA 2EL5A 2RPCA 2YU8A 2D9HA 2EMCA 1WJPA 2WBUA 1A1LA 2ENAA 2EMWA 2EQ1A 3EPJA 2EM8A 1X5WA 2ENHA 2MDGA 4R2RA 2YRKA 1BB8A 2EQ0A 2DMIA 2EOFA 3UK3C 2E72A 1A1GA 2J7JA 2WBSA 5KL6A 2EMZA 2EN6A 2EQ3A 4F6MA 2WCC3 2EOMA 4IS1C 2EOOA 1UN6B 2EOSA 5KL2A 2EL4A 4WSGA 2LV2A 2EJ4A 2I13A 2EN2A 2EPUA 4R2QA 2EM7A 1ZAAC 2EMGA 1B69A 4F2JC 4R2SA 2YTEA 3M99B 2PRTA 1JK1A 1ZU1A 1BBOA 1X6EA 2EN4A 2YTIA 2EOYA 2YSOA 2EORA 5KL5A 1X6FA 1F2IG 2JPAA 1YUIA 2EOEA 1G2DC 2CSHA 1X3CA 4R2PA 2EP3A 2EN7A 2YTJA 1MEYC 2DLKA 2EM2A 4IJDA 2JP9A 2EPRA 2YSPA 1ZR9A 2EMHA 4R2CA 1X6HA 2YRHA 1DGCA 2EMKA 1G2FC 2YTQA 4X9JA 2ELYA 2LO3A 4F6NA 2RSIA 1A1IA 1A1JA 2EOXA 2YTGA 1LLMC 2YTFA 1AAYA 2EE8A 2YTOA 2GHFA 2EL6A 2EM0A 2EMLA 2EMYA 2YTPA 3EPKA 5KL4A 2HGHA 2EMAA 2EOJA 2YU5A 1UBDC 2EMBA 2LCEA 3VHTB 2ELZA 4R2EA 3MHHC 1KJKA 2EM3A 2EN8A 1JK2A 2CT1A 2YTNA 2YRMA 5KL7A 2EPXA 2MKDA 4R2DA 2EMXA 1YUJA 2EMIA 2GLIA 2EPCA 1TF3A 1Z1BA 2VRDA 1A1HA 2EOHA 2CTDA 2ENCA 2EOZA 4R2AA
chains in the Genus database with same CATH superfamily
1N33E 3MSWA 4L8NA 5LL6R 3T1YE 3HPZA 2EPZA 2UUBE 4B3ME 4DV2E 2NABA 3ADGA 4DMIA 2MC6A 2M9AA 4ZYEA 4NHRA 4WFTA 2EPPA 4O43A 5AE2A 4GZNC 1IQSA 4M0VA 4RH8A 2EMFA 2B3TB 3KZYA 4Q35B 4TUGA 4DR1E 4LF5E 2WBUA 2JR1A 2N3HA 4JI7E 2VF1A 1A1LA 2L92A 2LBSB 4JI1E 2EM8A 2ODRD 3F6GA 4LF8E 4JI4E 2WZOA 1KYQA 2DMIA 1PKPA 4DV3E 2E72A 2GPIA 5KL6A 2EMZA 2EN6A 3OMLA 4LFCE 5IXMB 2FV4B 3IWDA 2LRSA 5A6AA 1NEIA 4WSGA 2LV2A 2EJ4A 3AV0A 3EQ1A 4X65E 2LUQA 3KWRA 2I13A 2UXDE 2EPMX 2EM7A 4Q28A 1B69A 2JOXA 4JI6E 2NUGA 2PRTA 4JI2E 3P1XA 2L6MA 2YTIA 5LMUE 2EORA 2HC5A 4BHCA 4ZYGA 2RTXA 2RQLA 2EN7A 1MEYC 3JU0A 1MGTA 1N36E 3VYXA 3JTZA 1G2FC 1PDAA 2ELYA 2LO3A 3QG5C 2RSIA 1A1IA 2EOXA 4DV6E 1UILA 4LTYA 4B3SE 1T38A 4JI0E 2EWLA 2NA2A 1WHQA 4NXME 4R2EA 3IWBA 2UUAE 4LU9A 4LFBE 4DV1E 1YUJA 2L3JA 2GLIA 2EPCA 2LJUA 4LF7E 1X49A 4NZVA 2VRDA 4WX9A 2NUEA 1N3GA 4L5NC 2ENCA 4BBYA 4GKJE 2E1MA 1IBLE 2LTSA 1YSAC 2R1FA 4GEQB 1GTKA 1HNZE 4M2ZA 3ADLA 5KL3A 2LVHA 4B3TE 2DMYA 2UXBE 1TF6A 1YYKA 4TUIA 4DV4E 1NCSA 2A25A 3EPHA 2DGCA 4DR3E 2EPNA 1A1FA 2ADRA 2RSMA 2EPKX 2LJHA 2RPCA 3H09A 2YU8A 2EMCA 1WJPA 5T6JA 2Q8UA 1L4SA 2EMWA 2UUCE 1X5WA 2ENHA 2CPNA 4R2RA 2YRKA 2L2KB 3ADIA 4GKKE 3UK3C 4BC9A 5A69A 1A1GA 2LE2A 3L00A 5AASA 1PJTA 4M30A 4F6MA 2WCC3 1UN6B 4YY3E 4LFAE 4DUYE 2NUFA 4WXDA 5AE1A 4X8WA 1O0WA 4DV5E 4F2JC 2YTEA 4F9BB 3IWCA 1ZU1A 3AUZA 5A2QC 2IHR1 5A6BA 2YSOA 5A6JA 5KL5A 1RC7A 4HTGA 1YUIA 2JOBA 1BBGA 2EPLX 2EOEA 2L2NA 2JY9A 2HJJA 1X3CA 2EP3A 4WXCA 4N4RB 1DI2A 2EM2A 1DQ3A 4IJDA 4R2CA 4DV7E 4X9JA 1XMQE 4ZYDA 3DF6A 2L3CA 3TQMA 4ZYHA 2YTGA 2YTFA 2YTOA 2DSYA 2GHFA 2L33A 1IMUA 3ZOQB 1IBKE 1HR0E 3J7Yp 1X47A 2YPNA 3EPKA 4JI5E 2MC5A 5KL4A 2EMAA 2EOJA 1UBDC 3VHTB 2JWOA 1N34E 1KJKA 2EN8A 3HQ1A 2CT1A 5F3WA 2MKDA 4DKKA 2VE7C 2V86A 1FJGE 2UU9E 1YFHA 1Z1BA 1A1HA 1SFEA 2EOHA 1HNWE 4P78A 2VQFE 2G7HA 3OTOE 4J8ZA 5LMNE 2LUPB 1A1KA 2JXPA 2EPAA 2LT7A 2EM4A 3VK6A 4R8OA 2N8XA 1YYOA 2DRPA 4BC7A 2EOQA 2JYAA 3BIDA 2EN3A 2EM5A 4YHHE 4JI8E 1X48A 1QNTA 1P47A 4HEIA 2K4VA 1YPNA 2EN1A 2DLQA 5BR8E 5AC5A 1WXRA 4X66E 4BMJA 2EM9A 2EM6A 2EOIA 3VYYA 2EL5A 2D9HA 1GZ6A 3BBGA 2E5LE 5AC4A 4DR2E 1BB8A 2KONA 2EQ0A 2B7TA 4B3RE 2LMZA 1AH5A 2YT4A 2EQ3A 2EOMA 4IS1C 2EOOA 2UXCE 3C4TA 5KL2A 4DR4E 2EL4A 2ODRC 4X64E 4DR5E 2EN2A 2EPUA 2EZ6A 4BS9A 1IBME 1ZAAC 1XNQE 2EMGA 2LTRA 4F9AB 3M99B 2K7IA 1JK1A 2RS6A 1J5EE 1X6EA 2EN4A 2V85A 1PJQA 2EOYA 1HNXE 2JPAA 1X6FA 4O4KA 4F54A 1EH7A 3ECRA 4MLVA 3HTXA 4R2PA 1YZ9A 1ZBQA 4OX9E 3J7AG 4JI3E 2JP9A 4R03A 2JVAA 1X6HA 2YRHA 2YZTA 1T4LB 3LLHA 4F6NA 1YYWA 1AAYA 1LLMC 2EE8A 4WPYA 3BF2A 2M4IA 4MLQA 2EL6A 2V88A 2EM0A 3J81C 2EMLA 2EMYA 2YTPA 4F9CB 4WYQB 2YU5A 2EMBA 2LCEA 2KOUA 2VQEE 2M1SA 4P7DA 3MHHC 1GQEA 2EM3A 1JK2A 5KL7A 2EPXA 2N3GA 4R2DA 2EMXA 4O5GA 5IT9C 1XMOE 2V8QB 2YWQA 4KWYA 1EKZA 2CTDA 4R2AA 2I9IA 3F6HA 1EH6A 4JYAE 4DR6E 4NXNE 2FGGA 2V87A 2YTDA 2EPOA 4KHPE 4BCAA 1STUA 4FK5C 2MKNA 2RS7A 1XNRE 4I8OA 2WBTA 3MHSC 4M9VC 1RQ0A 1TN9A 4DUZE 1RMDA 2V89A 4X62E 2BB8A 3HPSA 1N32E 5FLXC 4AQYE 3EPLA 4WSPA 2F4VE 4LF4E 2L2MA 1IQOA 2ENAA 1T39A 3EPJA 2EQ1A 4OOGC 2V83A 5A6KA 2MDGA 3ADJA 5CFFE 3THNA 2FTXB 5ADZA 3THOB 2EOFA 2J7JA 2WBSA 3C4BA 5IV8B 3LMLA 4DR7E 3BGHA 1T4OA 2EOSA 2ZM6E 5IWAE 3T1HE 5LLQA 4R2QA 1J26A 1PJSA 3J80C 4R2SA 2DIXA 4K0KE 2B7VA 1BBOA 2R76A 3C6MA 1ZBTA 1F2IG 1G2DC 3DJWA 2CSHA 1SR9A 3C6KA 2YTJA 4JV5E 2DLKA 4KZSA 5DNYA 2EPRA 2YSPA 1ZR9A 2EMHA 4LF6E 1DGCA 2EMKA 2YTQA 5TSEA 1T4NA 1A1JA 2L8TA 3FIGA 2B9DA 5A6BD 4DV0E 2HHHE 4BHBA 1WHNA 2DB2A 4RHBB 1UHZA 1WRJA 2MDRA 2HGHA 3K6QA 2BBGA 3JAMC 2ELZA 3RMPA 3HXLA 1QU6A 4O24A 1EH8A 2F8BA 2YTNA 2YRMA 2H36X 4LF9E 2EMIA 1I94E 2KHXA 1TF3A 2M7QA 5AE3A 1FKAE 2EOZA 3KZZA
chains in the Genus database with same CATH topology
2EPZA 1A1KA 1YSAC 2R1FA 2EPAA 2YTDA 2LT7A 2NABA 2EM4A 2DRPA 4FK5C 2MKNA 2EOQA 2LVHA 5KL3A 2EN3A 2EM5A 2WBTA 3MHSC 2M9AA 4M9VC 1P47A 1TF6A 1TN9A 1RMDA 2EN1A 2EPPA 1NCSA 2A25A 2DLQA 2BB8A 4GZNC 3EPHA 2EMFA 2DGCA 3EPLA 2EM9A 2EM6A 2EOIA 2ADRA 1A1FA 2EL5A 2RPCA 2YU8A 2D9HA 2EMCA 1WJPA 2WBUA 1A1LA 2ENAA 2EMWA 2EQ1A 3EPJA 2EM8A 1X5WA 2ENHA 2MDGA 4R2RA 2YRKA 1BB8A 2EQ0A 2DMIA 2EOFA 3UK3C 2E72A 1A1GA 2J7JA 2WBSA 5KL6A 2EMZA 2EN6A 2EQ3A 4F6MA 2WCC3 2EOMA 4IS1C 2EOOA 1UN6B 2EOSA 5KL2A 2EL4A 4WSGA 2LV2A 2EJ4A 2I13A 2EN2A 2EPUA 4R2QA 2EM7A 1ZAAC 2EMGA 1B69A 4F2JC 4R2SA 2YTEA 3M99B 2PRTA 1JK1A 1ZU1A 1BBOA 1X6EA 2EN4A 2YTIA 2EOYA 2YSOA 2EORA 5KL5A 1X6FA 1F2IG 2JPAA 1YUIA 2EOEA 1G2DC 2CSHA 1X3CA 4R2PA 2EP3A 2EN7A 2YTJA 1MEYC 2DLKA 2EM2A 4IJDA 2JP9A 2EPRA 2YSPA 1ZR9A 2EMHA 4R2CA 1X6HA 2YRHA 1DGCA 2EMKA 1G2FC 2YTQA 4X9JA 2ELYA 2LO3A 4F6NA 2RSIA 1A1IA 1A1JA 2EOXA 2YTGA 1LLMC 2YTFA 1AAYA 2EE8A 2YTOA 2GHFA 2EL6A 2EM0A 2EMLA 2EMYA 2YTPA 3EPKA 5KL4A 2HGHA 2EMAA 2EOJA 2YU5A 1UBDC 2EMBA 2LCEA 3VHTB 2ELZA 4R2EA 3MHHC 1KJKA 2EM3A 2EN8A 1JK2A 2CT1A 2YTNA 2YRMA 5KL7A 2EPXA 2MKDA 4R2DA 2EMXA 1YUJA 2EMIA 2GLIA 2EPCA 1TF3A 1Z1BA 2VRDA 1A1HA 2EOHA 2CTDA 2ENCA 2EOZA 4R2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPZ A;  1A1K A;  1YSA C;  2R1F A;  2EPA A;  2YTD A;  2LT7 A;  2NAB A;  2EM4 A;  2DRP A;  4FK5 C;  2MKN A;  2EOQ A;  2LVH A;  5KL3 A;  2EN3 A;  2EM5 A;  2WBT A;  3MHS C;  2M9A A;  4M9V C;  1P47 A;  1TF6 A;  1TN9 A;  1RMD A;  2EN1 A;  2EPP A;  1NCS A;  2A25 A;  2DLQ A;  2BB8 A;  4GZN C;  3EPH A;  2EMF A;  2DGC A;  3EPL A;  2EM9 A;  2EM6 A;  2EOI A;  2ADR A;  1A1F A;  2EL5 A;  2RPC A;  2YU8 A;  2D9H A;  2EMC A;  1WJP A;  2WBU A;  1A1L A;  2ENA A;  2EMW A;  2EQ1 A;  3EPJ A;  2EM8 A;  1X5W A;  2ENH A;  2MDG A;  4R2R A;  2YRK A;  1BB8 A;  2EQ0 A;  2DMI A;  2EOF A;  3UK3 C;  2E72 A;  1A1G A;  2J7J A;  2WBS A;  5KL6 A;  2EMZ A;  2EN6 A;  2EQ3 A;  4F6M A;  2WCC 3;  2EOM A;  4IS1 C;  2EOO A;  1UN6 B;  2EOS A;  5KL2 A;  2EL4 A;  4WSG A;  2LV2 A;  2EJ4 A;  2I13 A;  2EN2 A;  2EPU A;  4R2Q A;  2EM7 A;  1ZAA C;  2EMG A;  1B69 A;  4F2J C;  4R2S A;  2YTE A;  3M99 B;  2PRT A;  1JK1 A;  1ZU1 A;  1BBO A;  1X6E A;  2EN4 A;  2YTI A;  2EOY A;  2YSO A;  2EOR A;  5KL5 A;  1X6F A;  1F2I G;  2JPA A;  1YUI A;  2EOE A;  1G2D C;  2CSH A;  1X3C A;  4R2P A;  2EP3 A;  2EN7 A;  2YTJ A;  1MEY C;  2DLK A;  2EM2 A;  4IJD A;  2JP9 A;  2EPR A;  2YSP A;  1ZR9 A;  2EMH A;  4R2C A;  1X6H A;  2YRH A;  1DGC A;  2EMK A;  1G2F C;  2YTQ A;  4X9J A;  2ELY A;  2LO3 A;  4F6N A;  2RSI A;  1A1I A;  1A1J A;  2EOX A;  2YTG A;  1LLM C;  2YTF A;  1AAY A;  2EE8 A;  2YTO A;  2GHF A;  2EL6 A;  2EM0 A;  2EML A;  2EMY A;  2YTP A;  3EPK A;  5KL4 A;  2HGH A;  2EMA A;  2EOJ A;  2YU5 A;  1UBD C;  2EMB A;  2LCE A;  3VHT B;  2ELZ A;  4R2E A;  3MHH C;  1KJK A;  2EM3 A;  2EN8 A;  1JK2 A;  2CT1 A;  2YTN A;  2YRM A;  5KL7 A;  2EPX A;  2MKD A;  4R2D A;  2EMX A;  1YUJ A;  2EMI A;  2GLI A;  2EPC A;  1TF3 A;  1Z1B A;  2VRD A;  1A1H A;  2EOH A;  2CTD A;  2ENC A;  2EOZ A;  4R2A A; 
#chains in the Genus database with same CATH topology
 1N33 E;  3MSW A;  4L8N A;  5LL6 R;  3T1Y E;  3HPZ A;  2EPZ A;  2UUB E;  4B3M E;  4DV2 E;  2NAB A;  3ADG A;  4DMI A;  2MC6 A;  2M9A A;  4ZYE A;  4NHR A;  4WFT A;  2EPP A;  4O43 A;  5AE2 A;  4GZN C;  1IQS A;  4M0V A;  4RH8 A;  2EMF A;  2B3T B;  3KZY A;  4Q35 B;  4TUG A;  4DR1 E;  4LF5 E;  2WBU A;  2JR1 A;  2N3H A;  4JI7 E;  2VF1 A;  1A1L A;  2L92 A;  2LBS B;  4JI1 E;  2EM8 A;  2ODR D;  3F6G A;  4LF8 E;  4JI4 E;  2WZO A;  1KYQ A;  2DMI A;  1PKP A;  4DV3 E;  2E72 A;  2GPI A;  5KL6 A;  2EMZ A;  2EN6 A;  3OML A;  4LFC E;  5IXM B;  2FV4 B;  3IWD A;  2LRS A;  5A6A A;  1NEI A;  4WSG A;  2LV2 A;  2EJ4 A;  3AV0 A;  3EQ1 A;  4X65 E;  2LUQ A;  3KWR A;  2I13 A;  2UXD E;  2EPM X;  2EM7 A;  4Q28 A;  1B69 A;  2JOX A;  4JI6 E;  2NUG A;  2PRT A;  4JI2 E;  3P1X A;  2L6M A;  2YTI A;  5LMU E;  2EOR A;  2HC5 A;  4BHC A;  4ZYG A;  2RTX A;  2RQL A;  2EN7 A;  1MEY C;  3JU0 A;  1MGT A;  1N36 E;  3VYX A;  3JTZ A;  1G2F C;  1PDA A;  2ELY A;  2LO3 A;  3QG5 C;  2RSI A;  1A1I A;  2EOX A;  4DV6 E;  1UIL A;  4LTY A;  4B3S E;  1T38 A;  4JI0 E;  2EWL A;  2NA2 A;  1WHQ A;  4NXM E;  4R2E A;  3IWB A;  2UUA E;  4LU9 A;  4LFB E;  4DV1 E;  1YUJ A;  2L3J A;  2GLI A;  2EPC A;  2LJU A;  4LF7 E;  1X49 A;  4NZV A;  2VRD A;  4WX9 A;  2NUE A;  1N3G A;  4L5N C;  2ENC A;  4BBY A;  4GKJ E;  2E1M A;  1IBL E;  2LTS A;  1YSA C;  2R1F A;  4GEQ B;  1GTK A;  1HNZ E;  4M2Z A;  3ADL A;  5KL3 A;  2LVH A;  4B3T E;  2DMY A;  2UXB E;  1TF6 A;  1YYK A;  4TUI A;  4DV4 E;  1NCS A;  2A25 A;  3EPH A;  2DGC A;  4DR3 E;  2EPN A;  1A1F A;  2ADR A;  2RSM A;  2EPK X;  2LJH A;  2RPC A;  3H09 A;  2YU8 A;  2EMC A;  1WJP A;  5T6J A;  2Q8U A;  1L4S A;  2EMW A;  2UUC E;  1X5W A;  2ENH A;  2CPN A;  4R2R A;  2YRK A;  2L2K B;  3ADI A;  4GKK E;  3UK3 C;  4BC9 A;  5A69 A;  1A1G A;  2LE2 A;  3L00 A;  5AAS A;  1PJT A;  4M30 A;  4F6M A;  2WCC 3;  1UN6 B;  4YY3 E;  4LFA E;  4DUY E;  2NUF A;  4WXD A;  5AE1 A;  4X8W A;  1O0W A;  4DV5 E;  4F2J C;  2YTE A;  4F9B B;  3IWC A;  1ZU1 A;  3AUZ A;  5A2Q C;  2IHR 1;  5A6B A;  2YSO A;  5A6J A;  5KL5 A;  1RC7 A;  4HTG A;  1YUI A;  2JOB A;  1BBG A;  2EPL X;  2EOE A;  2L2N A;  2JY9 A;  2HJJ A;  1X3C A;  2EP3 A;  4WXC A;  4N4R B;  1DI2 A;  2EM2 A;  1DQ3 A;  4IJD A;  4R2C A;  4DV7 E;  4X9J A;  1XMQ E;  4ZYD A;  3DF6 A;  2L3C A;  3TQM A;  4ZYH A;  2YTG A;  2YTF A;  2YTO A;  2DSY A;  2GHF A;  2L33 A;  1IMU A;  3ZOQ B;  1IBK E;  1HR0 E;  3J7Y p;  1X47 A;  2YPN A;  3EPK A;  4JI5 E;  2MC5 A;  5KL4 A;  2EMA A;  2EOJ A;  1UBD C;  3VHT B;  2JWO A;  1N34 E;  1KJK A;  2EN8 A;  3HQ1 A;  2CT1 A;  5F3W A;  2MKD A;  4DKK A;  2VE7 C;  2V86 A;  1FJG E;  2UU9 E;  1YFH A;  1Z1B A;  1A1H A;  1SFE A;  2EOH A;  1HNW E;  4P78 A;  2VQF E;  2G7H A;  3OTO E;  4J8Z A;  5LMN E;  2LUP B;  1A1K A;  2JXP A;  2EPA A;  2LT7 A;  2EM4 A;  3VK6 A;  4R8O A;  2N8X A;  1YYO A;  2DRP A;  4BC7 A;  2EOQ A;  2JYA A;  3BID A;  2EN3 A;  2EM5 A;  4YHH E;  4JI8 E;  1X48 A;  1QNT A;  1P47 A;  4HEI A;  2K4V A;  1YPN A;  2EN1 A;  2DLQ A;  5BR8 E;  5AC5 A;  1WXR A;  4X66 E;  4BMJ A;  2EM9 A;  2EM6 A;  2EOI A;  3VYY A;  2EL5 A;  2D9H A;  1GZ6 A;  3BBG A;  2E5L E;  5AC4 A;  4DR2 E;  1BB8 A;  2KON A;  2EQ0 A;  2B7T A;  4B3R E;  2LMZ A;  1AH5 A;  2YT4 A;  2EQ3 A;  2EOM A;  4IS1 C;  2EOO A;  2UXC E;  3C4T A;  5KL2 A;  4DR4 E;  2EL4 A;  2ODR C;  4X64 E;  4DR5 E;  2EN2 A;  2EPU A;  2EZ6 A;  4BS9 A;  1IBM E;  1ZAA C;  1XNQ E;  2EMG A;  2LTR A;  4F9A B;  3M99 B;  2K7I A;  1JK1 A;  2RS6 A;  1J5E E;  1X6E A;  2EN4 A;  2V85 A;  1PJQ A;  2EOY A;  1HNX E;  2JPA A;  1X6F A;  4O4K A;  4F54 A;  1EH7 A;  3ECR A;  4MLV A;  3HTX A;  4R2P A;  1YZ9 A;  1ZBQ A;  4OX9 E;  3J7A G;  4JI3 E;  2JP9 A;  4R03 A;  2JVA A;  1X6H A;  2YRH A;  2YZT A;  1T4L B;  3LLH A;  4F6N A;  1YYW A;  1AAY A;  1LLM C;  2EE8 A;  4WPY A;  3BF2 A;  2M4I A;  4MLQ A;  2EL6 A;  2V88 A;  2EM0 A;  3J81 C;  2EML A;  2EMY A;  2YTP A;  4F9C B;  4WYQ B;  2YU5 A;  2EMB A;  2LCE A;  2KOU A;  2VQE E;  2M1S A;  4P7D A;  3MHH C;  1GQE A;  2EM3 A;  1JK2 A;  5KL7 A;  2EPX A;  2N3G A;  4R2D A;  2EMX A;  4O5G A;  5IT9 C;  1XMO E;  2V8Q B;  2YWQ A;  4KWY A;  1EKZ A;  2CTD A;  4R2A A;  2I9I A;  3F6H A;  1EH6 A;  4JYA E;  4DR6 E;  4NXN E;  2FGG A;  2V87 A;  2YTD A;  2EPO A;  4KHP E;  4BCA A;  1STU A;  4FK5 C;  2MKN A;  2RS7 A;  1XNR E;  4I8O A;  2WBT A;  3MHS C;  4M9V C;  1RQ0 A;  1TN9 A;  4DUZ E;  1RMD A;  2V89 A;  4X62 E;  2BB8 A;  3HPS A;  1N32 E;  5FLX C;  4AQY E;  3EPL A;  4WSP A;  2F4V E;  4LF4 E;  2L2M A;  1IQO A;  2ENA A;  1T39 A;  3EPJ A;  2EQ1 A;  4OOG C;  2V83 A;  5A6K A;  2MDG A;  3ADJ A;  5CFF E;  3THN A;  2FTX B;  5ADZ A;  3THO B;  2EOF A;  2J7J A;  2WBS A;  3C4B A;  5IV8 B;  3LML A;  4DR7 E;  3BGH A;  1T4O A;  2EOS A;  2ZM6 E;  5IWA E;  3T1H E;  5LLQ A;  4R2Q A;  1J26 A;  1PJS A;  3J80 C;  4R2S A;  2DIX A;  4K0K E;  2B7V A;  1BBO A;  2R76 A;  3C6M A;  1ZBT A;  1F2I G;  1G2D C;  3DJW A;  2CSH A;  1SR9 A;  3C6K A;  2YTJ A;  4JV5 E;  2DLK A;  4KZS A;  5DNY A;  2EPR A;  2YSP A;  1ZR9 A;  2EMH A;  4LF6 E;  1DGC A;  2EMK A;  2YTQ A;  5TSE A;  1T4N A;  1A1J A;  2L8T A;  3FIG A;  2B9D A;  5A6B D;  4DV0 E;  2HHH E;  4BHB A;  1WHN A;  2DB2 A;  4RHB B;  1UHZ A;  1WRJ A;  2MDR A;  2HGH A;  3K6Q A;  2BBG A;  3JAM C;  2ELZ A;  3RMP A;  3HXL A;  1QU6 A;  4O24 A;  1EH8 A;  2F8B A;  2YTN A;  2YRM A;  2H36 X;  4LF9 E;  2EMI A;  1I94 E;  2KHX A;  1TF3 A;  2M7Q A;  5AE3 A;  1FKA E;  2EOZ A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 2EPZ A;  1A1K A;  1YSA C;  2R1F A;  2EPA A;  2YTD A;  2LT7 A;  2NAB A;  2EM4 A;  2DRP A;  4FK5 C;  2MKN A;  2EOQ A;  2LVH A;  5KL3 A;  2EN3 A;  2EM5 A;  2WBT A;  3MHS C;  2M9A A;  4M9V C;  1P47 A;  1TF6 A;  1TN9 A;  1RMD A;  2EN1 A;  2EPP A;  1NCS A;  2A25 A;  2DLQ A;  2BB8 A;  4GZN C;  3EPH A;  2EMF A;  2DGC A;  3EPL A;  2EM9 A;  2EM6 A;  2EOI A;  2ADR A;  1A1F A;  2EL5 A;  2RPC A;  2YU8 A;  2D9H A;  2EMC A;  1WJP A;  2WBU A;  1A1L A;  2ENA A;  2EMW A;  2EQ1 A;  3EPJ A;  2EM8 A;  1X5W A;  2ENH A;  2MDG A;  4R2R A;  2YRK A;  1BB8 A;  2EQ0 A;  2DMI A;  2EOF A;  3UK3 C;  2E72 A;  1A1G A;  2J7J A;  2WBS A;  5KL6 A;  2EMZ A;  2EN6 A;  2EQ3 A;  4F6M A;  2WCC 3;  2EOM A;  4IS1 C;  2EOO A;  1UN6 B;  2EOS A;  5KL2 A;  2EL4 A;  4WSG A;  2LV2 A;  2EJ4 A;  2I13 A;  2EN2 A;  2EPU A;  4R2Q A;  2EM7 A;  1ZAA C;  2EMG A;  1B69 A;  4F2J C;  4R2S A;  2YTE A;  3M99 B;  2PRT A;  1JK1 A;  1ZU1 A;  1BBO A;  1X6E A;  2EN4 A;  2YTI A;  2EOY A;  2YSO A;  2EOR A;  5KL5 A;  1X6F A;  1F2I G;  2JPA A;  1YUI A;  2EOE A;  1G2D C;  2CSH A;  1X3C A;  4R2P A;  2EP3 A;  2EN7 A;  2YTJ A;  1MEY C;  2DLK A;  2EM2 A;  4IJD A;  2JP9 A;  2EPR A;  2YSP A;  1ZR9 A;  2EMH A;  4R2C A;  1X6H A;  2YRH A;  1DGC A;  2EMK A;  1G2F C;  2YTQ A;  4X9J A;  2ELY A;  2LO3 A;  4F6N A;  2RSI A;  1A1I A;  1A1J A;  2EOX A;  2YTG A;  1LLM C;  2YTF A;  1AAY A;  2EE8 A;  2YTO A;  2GHF A;  2EL6 A;  2EM0 A;  2EML A;  2EMY A;  2YTP A;  3EPK A;  5KL4 A;  2HGH A;  2EMA A;  2EOJ A;  2YU5 A;  1UBD C;  2EMB A;  2LCE A;  3VHT B;  2ELZ A;  4R2E A;  3MHH C;  1KJK A;  2EM3 A;  2EN8 A;  1JK2 A;  2CT1 A;  2YTN A;  2YRM A;  5KL7 A;  2EPX A;  2MKD A;  4R2D A;  2EMX A;  1YUJ A;  2EMI A;  2GLI A;  2EPC A;  1TF3 A;  1Z1B A;  2VRD A;  1A1H A;  2EOH A;  2CTD A;  2ENC A;  2EOZ A;  4R2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...