2JWOA

A phd finger motif in the c-terminus of rag2 modulates recombination activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords V(D)J recombination-activating protein 2
publication title A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Recombination
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jwoA01
2V88A 2V85A 2V83A 2V87A 2V86A 2V89A 2JWOA
chains in the Genus database with same CATH superfamily
2ADRA 1T4LB 5AASA 2GPIA 4DV7E 3BBGA 2DB2A 1ZBQA 5A6BA 2EP3A 4JI4E 1HNXE 2EPKX 2EOSA 2WBTA 4MLQA 3JAMC 3ADLA 5LLQA 2EM7A 4I8OA 2J7JA 4F6NA 2YTIA 3KWRA 4LF8E 4DKKA 5LMNE 1T4OA 1EH6A 2EMXA 2IHR1 2L2MA 4DR7E 1O0WA 3JU0A 2LUPB 2NUEA 2EMZA 3P1XA 2ODRD 2E5LE 3HPSA 4X64E 5KL6A 4WX9A 1RMDA 3ZOQB 2R76A 3KZZA 3HTXA 2EOIA 2UXCE 5AE3A 2RS7A 1A1HA 2LMZA 4F54A 4OX9E 2VE7C 2F4VE 2FTXB 2CTDA 2EOMA 2JWOA 4KHPE 2MC6A 4DR2E 1PKPA 5AE2A 4DV3E 4BC9A 2UU9E 1UILA 1MGTA 4Q35B 5A2QC 2M7QA 2EOOA 4R2RA 1B69A 2N3GA 1I94E 2UUAE 1HNZE 2EPLX 2KONA 4RH8A 2K4VA 1AAYA 1GTKA 4LF9E 1QNTA 2WZOA 2YU5A 3VK6A 2EE8A 5T6JA 2EOJA 4KZSA 3BGHA 4NZVA 2NA2A 4JI3E 5F3WA 2UUBE 2EL5A 4DR6E 2HC5A 1WRJA 1XNRE 4GKKE 2BBGA 2B9DA 1HR0E 4DV0E 4AQYE 1TF6A 5TSEA 4NXME 4DR4E 1A1GA 4O24A 1DGCA 2MDGA 3IWDA 2JYAA 2LCEA 2EMHA 5A69A 1MEYC 3OMLA 4YY3E 4LFCE 2DLKA 2YTGA 2YTFA 2V8QB 1LLMC 1WJPA 2EN4A 2JVAA 1WHNA 4OOGC 5KL7A 1X6EA 4B3ME 4DV1E 4F9CB 4FK5C 4LF4E 2EPNA 4F2JC 4ZYDA 1YYKA 2YSPA 4DMIA 2EORA 2LO3A 1YUJA 2BB8A 2L92A 4BS9A 2FV4B 1PDAA 4DUYE 2UXDE 2EPAA 2GHFA 4R2EA 2RSMA 4DV2E 2EPRA 4JI8E 2F8BA 2V86A 2EMCA 2L6MA 2LVHA 4JI7E 2YTNA 2LTRA 1IBME 2ODRC 2A25A 1T38A 1ZR9A 2RQLA 2YRKA 2JPAA 2WBUA 2EPMX 2YWQA 1FKAE 2LTSA 2H36X 1YPNA 4P78A 1A1JA 4M30A 4F6MA 3THNA 2EMYA 3UK3C 3RMPA 3HPZA 1STUA 4HTGA 2L33A 1UN6B 2DIXA 4JV5E 4F9AB 3C6KA 5A6BD 4HEIA 5A6AA 2RPCA 2CT1A 2EN8A 1F2IG 4JI6E 2L3JA 2EQ1A 1J5EE 2YTQA 1A1FA 1JK1A 2LUQA 2CPNA 2EPUA 5IXMB 1N3GA 2YZTA 3LLHA 5IT9C 1TF3A 3IWCA 3T1HE 2V87A 4TUGA 1ZU1A 1ZBTA 2EOEA 2LBSB 2PRTA 3KZYA 1N33E 4IJDA 2L2KB 2WCC3 1SFEA 3JTZA 5KL4A 2V85A 2VF1A 2L2NA 4LTYA 2ENHA 5FLXC 3EQ1A 4DV6E 2N3HA 4X9JA 4O4KA 2M4IA 1YZ9A 2M9AA 1X49A 5LL6R 2EMIA 1JK2A 3ADGA 1Z1BA 1P47A 2YPNA 4L8NA 2NUFA 4MLVA 2N8XA 1UBDC 2K7IA 1X48A 2EN6A 3FIGA 1YUIA 2MDRA 1DQ3A 4R2CA 3J81C 1WHQA 5KL3A 2JOBA 1PJQA 2DRPA 2EL4A 1DI2A 2B7TA 2YU8A 4GZNC 1RQ0A 2LE2A 2EOXA 2ENCA 3EPKA 2EMGA 4DV5E 2G7HA 2EM9A 4R2PA 1NCSA 4BMJA 1IMUA 2EWLA 2VQEE 2B7VA 2EPZA 4R2AA 4R03A 1BBGA 4M9VC 1X47A 2VRDA 4WXCA 2YRHA 3HXLA 1X5WA 2EN1A 2MKDA 3F6GA 1WXRA 3EPHA 2LJHA 4IS1C 1N36E 2UUCE 2JR1A 2V88A 4ZYEA 4K0KE 2YTPA 2EM8A 1A1KA 3C4TA 2V89A 2EMKA 1BB8A 1NEIA 1KYQA 4X8WA 5A6KA 5IV8B 2EOZA 4B3SE 4B3TE 4JI1E 2EQ0A 3AV0A 4GEQB 2YTEA 5BR8E 3J80C 2DGCA 1HNWE 3QG5C 5CFFE 1KJKA 4LF6E 5AE1A 5LMUE 3T1YE 1IBLE 2EN7A 2EM0A 3DF6A 2JY9A 4JI2E 4GKJE 5A6JA 4BC7A 1QU6A 1IBKE 3C6MA 2EMAA 4Q28A 1SR9A 2D9HA 1X6FA 2ELZA 3ADIA 4LU9A 3EPJA 1T39A 3AUZA 3J7AG 5IWAE 4L5NC 1N34E 2ZM6E 4BBYA 3EPLA 2Q8UA 3VYXA 2L3CA 3M99B 1G2FC 4WXDA 2DMYA 2EMFA 2YTOA 1YFHA 3ADJA 1J26A 2EPXA 5AC4A 5KL5A 3BF2A 4LF7E 2ELYA 1EH8A 4DR1E 2HGHA 2V83A 4BHBA 4X66E 3OTOE 1BBOA 1UHZA 3ECRA 4F9BB 4WSPA 4WPYA 2E72A 1L4SA 3H09A 2DSYA 1IQSA 2I9IA 3C4BA 4WYQB 3F6HA 1FJGE 2EM6A 3MSWA 2EL6A 3IWBA 4J8ZA 2KOUA 1YSAC 4O43A 1A1LA 2ENAA 2E1MA 3VHTB 2NUGA 4RHBB 4M2ZA 4B3RE 2FGGA 3MHHC 1RC7A 1G2DC 1X3CA 1EH7A 1ZAAC 1GZ6A 2MKNA 4O5GA 5DNYA 1PJTA 1XNQE 2HJJA 3THOB 2GLIA 5AC5A 2YSOA 2DLQA 2EOQA 1YYWA 4X65E 3TQMA 3K6QA 4LF5E 2EPCA 2EMLA 5ADZA 2VQFE 1EKZA 5KL2A 2LV2A 2EM5A 4ZYGA 2EN2A 4WFTA 2RS6A 1YYOA 4TUIA 2YTJA 3J7Yp 2DMIA 2JXPA 4R2QA 3DJWA 1TN9A 1N32E 4DR5E 2LJUA 1AH5A 3VYYA 2UXBE 2LRSA 2EPOA 3L00A 4N4RB 3BIDA 2EM4A 1IQOA 2EMBA 4DUZE 2JOXA 4BCAA 2EOFA 2EN3A 2EOYA 1X6HA 4DV4E 2EM3A 2I13A 1XMQE 1T4NA 1XMOE 2NABA 2EJ4A 4YHHE 2RTXA 2EMWA 2L8TA 2CSHA 2YRMA 4BHCA 4P7DA 2EZ6A 4X62E 2KHXA 4JI0E 1PJSA 2M1SA 2YTDA 2B3TB 2LT7A 2HHHE 2JP9A 2RSIA 4JI5E 2EQ3A 4R2DA 4LFBE 4M0VA 4JYAE 1A1IA 4KWYA 2EM2A 2WBSA 4ZYHA 4NHRA 3MHSC 1GQEA 4NXNE 2EOHA 2MC5A 2R1FA 3LMLA 2EPPA 4LFAE 4R8OA 2YT4A 4R2SA 4DR3E 3HQ1A 4WSGA
chains in the Genus database with same CATH topology
3MSWA 3IWBA 1T4LB 4J8ZA 2KOUA 4DMIA 1YYKA 5AASA 4BMJA 2EWLA 4DV7E 2L92A 2VQEE 2E1MA 2B7VA 2DB2A 4BS9A 2FV4B 2NUGA 1ZBQA 4R03A 4DUYE 2UXDE 4M2ZA 4B3RE 2FGGA 1X47A 1RC7A 4JI4E 1HNXE 3HXLA 3JAMC 2RSMA 4DV2E 4JI8E 3ADLA 2F8BA 2V86A 1GZ6A 2F4VE 2L6MA 4JI7E 3F6GA 2LTRA 5DNYA 1XNQE 1WXRA 4I8OA 1IBME 2LJHA 2ODRC 1N36E 2UUCE 2JR1A 2UXBE 3KWRA 1YYWA 2V88A 4LF8E 4DKKA 4X65E 5LMNE 1FKAE 2LTSA 4K0KE 2H36X 1T4OA 4DR7E 2IHR1 2L2MA 2V89A 1O0WA 3C4TA 3K6QA 3JU0A 4P78A 2LUPB 4LF5E 4M30A 2NUEA 3P1XA 2ODRD 5ADZA 4X8WA 2E5LE 4B3SE 2VQFE 1EKZA 3RMPA 3HPZA 4B3TE 1STUA 3HPSA 2L33A 4JI1E 3AV0A 4GEQB 2DIXA 4JV5E 5BR8E 4F9AB 4X64E 3J80C 4WFTA 2RS6A 3ZOQB 5CFFE 1YYOA 3HTXA 4JI6E 1HNWE 4TUIA 2L3JA 1J5EE 4LF6E 5AE1A 3J7Yp 5LMUE 3T1YE 1IBLE 2UXCE 2LUQA 2CPNA 2RS7A 5AE3A 2LMZA 4F54A 3DJWA 2VE7C 3DF6A 2JY9A 2FTXB 4OX9E 1N32E 4JI2E 4GKJE 2YZTA 3VYYA 4DR5E 2JWOA 3LLHA 5IT9C 2MC6A 4KHPE 4BC7A 2LRSA 1QU6A 4DR2E 1IBKE 1PKPA 3IWCA 4Q28A 5AE2A 3T1HE 1SR9A 4BC9A 4DV3E 1UILA 2UU9E 2V87A 3ADIA 4TUGA 4LU9A 4DUZE 1ZBTA 5A2QC 2LBSB 2M7QA 2JOXA 4BCAA 2L2KB 1N33E 3AUZA 3J7AG 5IWAE 3JTZA 2N3GA 4L5NC 1I94E 2UUAE 1HNZE 2KONA 1N34E 2V85A 2VF1A 2K4VA 2ZM6E 2L2NA 4LTYA 4BBYA 4DV4E 1XMQE 3VYXA 1T4NA 2L3CA 4LF9E 1XMOE 2WZOA 5FLXC 3VK6A 5T6JA 4YHHE 4DV6E 2N3HA 4KZSA 2M4IA 2DMYA 1YZ9A 2RTXA 2NA2A 1X49A 2L8TA 3ADJA 5F3WA 5LL6R 4JI3E 1J26A 4P7DA 2EZ6A 4X62E 3ADGA 2UUBE 2KHXA 4DR6E 4GKKE 4JI0E 1XNRE 4L8NA 2NUFA 1HR0E 2B9DA 2M1SA 4LF7E 4DV0E 4DR1E 4AQYE 4NXME 4DR4E 2B3TB 2HHHE 4JI5E 2V83A 4X66E 3OTOE 4LFBE 1X48A 3IWDA 3FIGA 4M0VA 2MDRA 4JYAE 1DQ3A 1UHZA 3J81C 4F9BB 4WSPA 3OMLA 4YY3E 4LFCE 1WHQA 4WPYA 2V8QB 3H09A 4NXNE 2JOBA 1GQEA 2DSYA 1DI2A 2MC5A 3C4BA 2B7TA 2JVAA 3LMLA 1RQ0A 1WHNA 2LE2A 4WYQB 4OOGC 4LFAE 4B3ME 4R8OA 4DV1E 2YT4A 4F9CB 4DV5E 3F6HA 4LF4E 1FJGE 2G7HA 4DR3E 3HQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V88 A;  2V85 A;  2V83 A;  2V87 A;  2V86 A;  2V89 A;  2JWO A; 
#chains in the Genus database with same CATH topology
 2ADR A;  1T4L B;  5AAS A;  2GPI A;  4DV7 E;  3BBG A;  2DB2 A;  1ZBQ A;  5A6B A;  2EP3 A;  4JI4 E;  1HNX E;  2EPK X;  2EOS A;  2WBT A;  4MLQ A;  3JAM C;  3ADL A;  5LLQ A;  2EM7 A;  4I8O A;  2J7J A;  4F6N A;  2YTI A;  3KWR A;  4LF8 E;  4DKK A;  5LMN E;  1T4O A;  1EH6 A;  2EMX A;  2IHR 1;  2L2M A;  4DR7 E;  1O0W A;  3JU0 A;  2LUP B;  2NUE A;  2EMZ A;  3P1X A;  2ODR D;  2E5L E;  3HPS A;  4X64 E;  5KL6 A;  4WX9 A;  1RMD A;  3ZOQ B;  2R76 A;  3KZZ A;  3HTX A;  2EOI A;  2UXC E;  5AE3 A;  2RS7 A;  1A1H A;  2LMZ A;  4F54 A;  4OX9 E;  2VE7 C;  2F4V E;  2FTX B;  2CTD A;  2EOM A;  2JWO A;  4KHP E;  2MC6 A;  4DR2 E;  1PKP A;  5AE2 A;  4DV3 E;  4BC9 A;  2UU9 E;  1UIL A;  1MGT A;  4Q35 B;  5A2Q C;  2M7Q A;  2EOO A;  4R2R A;  1B69 A;  2N3G A;  1I94 E;  2UUA E;  1HNZ E;  2EPL X;  2KON A;  4RH8 A;  2K4V A;  1AAY A;  1GTK A;  4LF9 E;  1QNT A;  2WZO A;  2YU5 A;  3VK6 A;  2EE8 A;  5T6J A;  2EOJ A;  4KZS A;  3BGH A;  4NZV A;  2NA2 A;  4JI3 E;  5F3W A;  2UUB E;  2EL5 A;  4DR6 E;  2HC5 A;  1WRJ A;  1XNR E;  4GKK E;  2BBG A;  2B9D A;  1HR0 E;  4DV0 E;  4AQY E;  1TF6 A;  5TSE A;  4NXM E;  4DR4 E;  1A1G A;  4O24 A;  1DGC A;  2MDG A;  3IWD A;  2JYA A;  2LCE A;  2EMH A;  5A69 A;  1MEY C;  3OML A;  4YY3 E;  4LFC E;  2DLK A;  2YTG A;  2YTF A;  2V8Q B;  1LLM C;  1WJP A;  2EN4 A;  2JVA A;  1WHN A;  4OOG C;  5KL7 A;  1X6E A;  4B3M E;  4DV1 E;  4F9C B;  4FK5 C;  4LF4 E;  2EPN A;  4F2J C;  4ZYD A;  1YYK A;  2YSP A;  4DMI A;  2EOR A;  2LO3 A;  1YUJ A;  2BB8 A;  2L92 A;  4BS9 A;  2FV4 B;  1PDA A;  4DUY E;  2UXD E;  2EPA A;  2GHF A;  4R2E A;  2RSM A;  4DV2 E;  2EPR A;  4JI8 E;  2F8B A;  2V86 A;  2EMC A;  2L6M A;  2LVH A;  4JI7 E;  2YTN A;  2LTR A;  1IBM E;  2ODR C;  2A25 A;  1T38 A;  1ZR9 A;  2RQL A;  2YRK A;  2JPA A;  2WBU A;  2EPM X;  2YWQ A;  1FKA E;  2LTS A;  2H36 X;  1YPN A;  4P78 A;  1A1J A;  4M30 A;  4F6M A;  3THN A;  2EMY A;  3UK3 C;  3RMP A;  3HPZ A;  1STU A;  4HTG A;  2L33 A;  1UN6 B;  2DIX A;  4JV5 E;  4F9A B;  3C6K A;  5A6B D;  4HEI A;  5A6A A;  2RPC A;  2CT1 A;  2EN8 A;  1F2I G;  4JI6 E;  2L3J A;  2EQ1 A;  1J5E E;  2YTQ A;  1A1F A;  1JK1 A;  2LUQ A;  2CPN A;  2EPU A;  5IXM B;  1N3G A;  2YZT A;  3LLH A;  5IT9 C;  1TF3 A;  3IWC A;  3T1H E;  2V87 A;  4TUG A;  1ZU1 A;  1ZBT A;  2EOE A;  2LBS B;  2PRT A;  3KZY A;  1N33 E;  4IJD A;  2L2K B;  2WCC 3;  1SFE A;  3JTZ A;  5KL4 A;  2V85 A;  2VF1 A;  2L2N A;  4LTY A;  2ENH A;  5FLX C;  3EQ1 A;  4DV6 E;  2N3H A;  4X9J A;  4O4K A;  2M4I A;  1YZ9 A;  2M9A A;  1X49 A;  5LL6 R;  2EMI A;  1JK2 A;  3ADG A;  1Z1B A;  1P47 A;  2YPN A;  4L8N A;  2NUF A;  4MLV A;  2N8X A;  1UBD C;  2K7I A;  1X48 A;  2EN6 A;  3FIG A;  1YUI A;  2MDR A;  1DQ3 A;  4R2C A;  3J81 C;  1WHQ A;  5KL3 A;  2JOB A;  1PJQ A;  2DRP A;  2EL4 A;  1DI2 A;  2B7T A;  2YU8 A;  4GZN C;  1RQ0 A;  2LE2 A;  2EOX A;  2ENC A;  3EPK A;  2EMG A;  4DV5 E;  2G7H A;  2EM9 A;  4R2P A;  1NCS A;  4BMJ A;  1IMU A;  2EWL A;  2VQE E;  2B7V A;  2EPZ A;  4R2A A;  4R03 A;  1BBG A;  4M9V C;  1X47 A;  2VRD A;  4WXC A;  2YRH A;  3HXL A;  1X5W A;  2EN1 A;  2MKD A;  3F6G A;  1WXR A;  3EPH A;  2LJH A;  4IS1 C;  1N36 E;  2UUC E;  2JR1 A;  2V88 A;  4ZYE A;  4K0K E;  2YTP A;  2EM8 A;  1A1K A;  3C4T A;  2V89 A;  2EMK A;  1BB8 A;  1NEI A;  1KYQ A;  4X8W A;  5A6K A;  5IV8 B;  2EOZ A;  4B3S E;  4B3T E;  4JI1 E;  2EQ0 A;  3AV0 A;  4GEQ B;  2YTE A;  5BR8 E;  3J80 C;  2DGC A;  1HNW E;  3QG5 C;  5CFF E;  1KJK A;  4LF6 E;  5AE1 A;  5LMU E;  3T1Y E;  1IBL E;  2EN7 A;  2EM0 A;  3DF6 A;  2JY9 A;  4JI2 E;  4GKJ E;  5A6J A;  4BC7 A;  1QU6 A;  1IBK E;  3C6M A;  2EMA A;  4Q28 A;  1SR9 A;  2D9H A;  1X6F A;  2ELZ A;  3ADI A;  4LU9 A;  3EPJ A;  1T39 A;  3AUZ A;  3J7A G;  5IWA E;  4L5N C;  1N34 E;  2ZM6 E;  4BBY A;  3EPL A;  2Q8U A;  3VYX A;  2L3C A;  3M99 B;  1G2F C;  4WXD A;  2DMY A;  2EMF A;  2YTO A;  1YFH A;  3ADJ A;  1J26 A;  2EPX A;  5AC4 A;  5KL5 A;  3BF2 A;  4LF7 E;  2ELY A;  1EH8 A;  4DR1 E;  2HGH A;  2V83 A;  4BHB A;  4X66 E;  3OTO E;  1BBO A;  1UHZ A;  3ECR A;  4F9B B;  4WSP A;  4WPY A;  2E72 A;  1L4S A;  3H09 A;  2DSY A;  1IQS A;  2I9I A;  3C4B A;  4WYQ B;  3F6H A;  1FJG E;  2EM6 A;  3MSW A;  2EL6 A;  3IWB A;  4J8Z A;  2KOU A;  1YSA C;  4O43 A;  1A1L A;  2ENA A;  2E1M A;  3VHT B;  2NUG A;  4RHB B;  4M2Z A;  4B3R E;  2FGG A;  3MHH C;  1RC7 A;  1G2D C;  1X3C A;  1EH7 A;  1ZAA C;  1GZ6 A;  2MKN A;  4O5G A;  5DNY A;  1PJT A;  1XNQ E;  2HJJ A;  3THO B;  2GLI A;  5AC5 A;  2YSO A;  2DLQ A;  2EOQ A;  1YYW A;  4X65 E;  3TQM A;  3K6Q A;  4LF5 E;  2EPC A;  2EML A;  5ADZ A;  2VQF E;  1EKZ A;  5KL2 A;  2LV2 A;  2EM5 A;  4ZYG A;  2EN2 A;  4WFT A;  2RS6 A;  1YYO A;  4TUI A;  2YTJ A;  3J7Y p;  2DMI A;  2JXP A;  4R2Q A;  3DJW A;  1TN9 A;  1N32 E;  4DR5 E;  2LJU A;  1AH5 A;  3VYY A;  2UXB E;  2LRS A;  2EPO A;  3L00 A;  4N4R B;  3BID A;  2EM4 A;  1IQO A;  2EMB A;  4DUZ E;  2JOX A;  4BCA A;  2EOF A;  2EN3 A;  2EOY A;  1X6H A;  4DV4 E;  2EM3 A;  2I13 A;  1XMQ E;  1T4N A;  1XMO E;  2NAB A;  2EJ4 A;  4YHH E;  2RTX A;  2EMW A;  2L8T A;  2CSH A;  2YRM A;  4BHC A;  4P7D A;  2EZ6 A;  4X62 E;  2KHX A;  4JI0 E;  1PJS A;  2M1S A;  2YTD A;  2B3T B;  2LT7 A;  2HHH E;  2JP9 A;  2RSI A;  4JI5 E;  2EQ3 A;  4R2D A;  4LFB E;  4M0V A;  4JYA E;  1A1I A;  4KWY A;  2EM2 A;  2WBS A;  4ZYH A;  4NHR A;  3MHS C;  1GQE A;  4NXN E;  2EOH A;  2MC5 A;  2R1F A;  3LML A;  2EPP A;  4LFA E;  4R8O A;  2YT4 A;  4R2S A;  4DR3 E;  3HQ1 A;  4WSG A; 
#chains in the Genus database with same CATH homology
 3MSW A;  3IWB A;  1T4L B;  4J8Z A;  2KOU A;  4DMI A;  1YYK A;  5AAS A;  4BMJ A;  2EWL A;  4DV7 E;  2L92 A;  2VQE E;  2E1M A;  2B7V A;  2DB2 A;  4BS9 A;  2FV4 B;  2NUG A;  1ZBQ A;  4R03 A;  4DUY E;  2UXD E;  4M2Z A;  4B3R E;  2FGG A;  1X47 A;  1RC7 A;  4JI4 E;  1HNX E;  3HXL A;  3JAM C;  2RSM A;  4DV2 E;  4JI8 E;  3ADL A;  2F8B A;  2V86 A;  1GZ6 A;  2F4V E;  2L6M A;  4JI7 E;  3F6G A;  2LTR A;  5DNY A;  1XNQ E;  1WXR A;  4I8O A;  1IBM E;  2LJH A;  2ODR C;  1N36 E;  2UUC E;  2JR1 A;  2UXB E;  3KWR A;  1YYW A;  2V88 A;  4LF8 E;  4DKK A;  4X65 E;  5LMN E;  1FKA E;  2LTS A;  4K0K E;  2H36 X;  1T4O A;  4DR7 E;  2IHR 1;  2L2M A;  2V89 A;  1O0W A;  3C4T A;  3K6Q A;  3JU0 A;  4P78 A;  2LUP B;  4LF5 E;  4M30 A;  2NUE A;  3P1X A;  2ODR D;  5ADZ A;  4X8W A;  2E5L E;  4B3S E;  2VQF E;  1EKZ A;  3RMP A;  3HPZ A;  4B3T E;  1STU A;  3HPS A;  2L33 A;  4JI1 E;  3AV0 A;  4GEQ B;  2DIX A;  4JV5 E;  5BR8 E;  4F9A B;  4X64 E;  3J80 C;  4WFT A;  2RS6 A;  3ZOQ B;  5CFF E;  1YYO A;  3HTX A;  4JI6 E;  1HNW E;  4TUI A;  2L3J A;  1J5E E;  4LF6 E;  5AE1 A;  3J7Y p;  5LMU E;  3T1Y E;  1IBL E;  2UXC E;  2LUQ A;  2CPN A;  2RS7 A;  5AE3 A;  2LMZ A;  4F54 A;  3DJW A;  2VE7 C;  3DF6 A;  2JY9 A;  2FTX B;  4OX9 E;  1N32 E;  4JI2 E;  4GKJ E;  2YZT A;  3VYY A;  4DR5 E;  2JWO A;  3LLH A;  5IT9 C;  2MC6 A;  4KHP E;  4BC7 A;  2LRS A;  1QU6 A;  4DR2 E;  1IBK E;  1PKP A;  3IWC A;  4Q28 A;  5AE2 A;  3T1H E;  1SR9 A;  4BC9 A;  4DV3 E;  1UIL A;  2UU9 E;  2V87 A;  3ADI A;  4TUG A;  4LU9 A;  4DUZ E;  1ZBT A;  5A2Q C;  2LBS B;  2M7Q A;  2JOX A;  4BCA A;  2L2K B;  1N33 E;  3AUZ A;  3J7A G;  5IWA E;  3JTZ A;  2N3G A;  4L5N C;  1I94 E;  2UUA E;  1HNZ E;  2KON A;  1N34 E;  2V85 A;  2VF1 A;  2K4V A;  2ZM6 E;  2L2N A;  4LTY A;  4BBY A;  4DV4 E;  1XMQ E;  3VYX A;  1T4N A;  2L3C A;  4LF9 E;  1XMO E;  2WZO A;  5FLX C;  3VK6 A;  5T6J A;  4YHH E;  4DV6 E;  2N3H A;  4KZS A;  2M4I A;  2DMY A;  1YZ9 A;  2RTX A;  2NA2 A;  1X49 A;  2L8T A;  3ADJ A;  5F3W A;  5LL6 R;  4JI3 E;  1J26 A;  4P7D A;  2EZ6 A;  4X62 E;  3ADG A;  2UUB E;  2KHX A;  4DR6 E;  4GKK E;  4JI0 E;  1XNR E;  4L8N A;  2NUF A;  1HR0 E;  2B9D A;  2M1S A;  4LF7 E;  4DV0 E;  4DR1 E;  4AQY E;  4NXM E;  4DR4 E;  2B3T B;  2HHH E;  4JI5 E;  2V83 A;  4X66 E;  3OTO E;  4LFB E;  1X48 A;  3IWD A;  3FIG A;  4M0V A;  2MDR A;  4JYA E;  1DQ3 A;  1UHZ A;  3J81 C;  4F9B B;  4WSP A;  3OML A;  4YY3 E;  4LFC E;  1WHQ A;  4WPY A;  2V8Q B;  3H09 A;  4NXN E;  2JOB A;  1GQE A;  2DSY A;  1DI2 A;  2MC5 A;  3C4B A;  2B7T A;  2JVA A;  3LML A;  1RQ0 A;  1WHN A;  2LE2 A;  4WYQ B;  4OOG C;  4LFA E;  4B3M E;  4R8O A;  4DV1 E;  2YT4 A;  4F9C B;  4DV5 E;  3F6H A;  4LF4 E;  1FJG E;  2G7H A;  4DR3 E;  3HQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...