2JWOA

A phd finger motif in the c-terminus of rag2 modulates recombination activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Recombination
molecule keywords V(D)J recombination-activating protein 2
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jwoA01
2V88A 2V89A 2V85A 2JWOA 2V87A 2V83A 2V86A
chains in the Genus database with same CATH superfamily
2EM8A 3HXLA 2JOBA 2V89A 5AE3A 4TUIA 1T4LB 4DUZE 4R2PA 2EPAA 2M7QA 4R2DA 2YTFA 2A25A 4F2JC 2EM3A 2EOMA 4LF4E 3VYXA 2DB2A 2V87A 2EMZA 2EM5A 1IQSA 5TSEA 4WSGA 1KYQA 5A2QC 2YT4A 3EPLA 2EMGA 2EPKX 1A1IA 2GPIA 2YTEA 4JI1E 4BHCA 4ZYHA 1I94E 1X47A 1AH5A 4BC9A 2EPCA 4BHBA 2J7JA 1DGCA 2EWLA 2MKDA 1YYKA 1WHQA 1N33E 4N4RB 2VRDA 2YTGA 2GHFA 2MKNA 2FTXB 1WRJA 4LF7E 1BB8A 2DSYA 2YRMA 2YTIA 4WX9A 3RMPA 2RS6A 4DV6E 5AC5A 1YSAC 1EH6A 2EOJA 2LJUA 2M9AA 2ODRC 2L2NA 3OMLA 2B3TB 3JTZA 3EPJA 2L2MA 2LT7A 4I8OA 4DV1E 2I9IA 4DR3E 1A1HA 2Q8UA 4DKKA 4M2ZA 3HTXA 2HC5A 2KOUA 5DNYA 2EMAA 5A6JA 5IT9C 3KWRA 2E5LE 3HPSA 1GTKA 3J80C 3JU0A 4BS9A 2DRPA 4X9JA 2EL5A 4L5NC 4NXME 2DMYA 1A1LA 4B3RE 4BBYA 2VQFE 3MSWA 1LLMC 2EPZA 1ZBQA 2JY9A 2L2KB 1G2DC 3FIGA 2EE8A 2L3JA 3HQ1A 2EN4A 2UUCE 3ADIA 2L3CA 4DR5E 1XMQE 4DV5E 4O5GA 4JV5E 2JPAA 4BCAA 4LF8E 2EMBA 3BIDA 4YHHE 2N3GA 1WHNA 2L8TA 2YTJA 2YRKA 3DF6A 2HGHA 4DR2E 2EMFA 1IMUA 1MGTA 3QG5C 1PDAA 2FGGA 4DMIA 3THNA 1JK1A 4ZYEA 2EMCA 2YZTA 2EN7A 5KL6A 4O4KA 2EMXA 5A69A 2DIXA 4F6MA 2BB8A 2MC6A 2LMZA 2D9HA 2RQLA 2YTNA 1L4SA 2YU8A 2EMHA 2EL4A 2LUQA 2LVHA 2EPNA 2K4VA 2JR1A 5A6BA 5ADZA 1PJQA 2LE2A 1A1FA 1FKAE 4JI4E 2EPXA 4F9AB 1F2IG 2EOXA 1N34E 4B3ME 4DV7E 1NEIA 1UHZA 3OTOE 1EKZA 1X48A 2WZOA 1T38A 1RQ0A 4RHBB 2DLKA 5FLXC 3L00A 1PJSA 1A1GA 1PKPA 4F9CB 4R2AA 4B3SE 1T39A 1T4NA 2CPNA 4F54A 4X62E 1BBOA 2EMKA 3TQMA 4F9BB 2LRSA 2ELZA 4WXCA 3P1XA 2EOHA 2EM2A 4DV2E 3LMLA 2PRTA 2EPRA 1RC7A 2LBSB 2EMYA 1IBKE 1UN6B 4WXDA 4LU9A 1NCSA 2EOIA 2EMWA 1TF6A 1G2FC 5IXMB 1T4OA 1EH7A 2K7IA 3ADGA 2EOFA 1QNTA 3EPKA 2MDRA 2EN1A 4WYQB 2KONA 1WJPA 1GZ6A 3C6KA 2R76A 3IWDA 2VF1A 2EOOA 2EPOA 4JI2E 2VQEE 3BF2A 2HHHE 2EN2A 4KZSA 2YSPA 4DV3E 2NUGA 2LTRA 3MHSC 2DGCA 2R1FA 4NZVA 3DJWA 2IHR1 3THOB 1IBME 2EN6A 2WBTA 4HEIA 4KHPE 5LLQA 4X8WA 2RS7A 1RMDA 4J8ZA 4RH8A 2EPLX 4GKJE 2LCEA 3KZYA 3VHTB 4ZYGA 5AASA 4OOGC 4P7DA 3K6QA 1HR0E 3C4BA 1X6HA 5LMNE 2YTQA 4TUGA 2UUBE 1MEYC 2YU5A 3ADJA 3LLHA 2MC5A 1WXRA 3EPHA 2CTDA 2EN3A 2YSOA 4R8OA 1P47A 2CSHA 3J7Yp 2JOXA 4IS1C 2UUAE 2NUEA 3IWBA 2EQ1A 2EL6A 2RSMA 2EOYA 4WSPA 1BBGA 4LF6E 2CT1A 1YFHA 2LV2A 5AC4A 4M30A 1TN9A 5LMUE 1X6FA 4FK5C 1STUA 2E1MA 3AUZA 3F6HA 2UXDE 2UXCE 2ELYA 4Q35B 2EJ4A 2F8BA 3T1HE 2EQ3A 2NUFA 2EM7A 2EM9A 2V83A 4WPYA 3J7AG 4B3TE 5AE2A 2NABA 2EMIA 1DI2A 4YY3E 4JI5E 2RTXA 5IWAE 1UBDC 4DV0E 3M99B 1ZR9A 2EOSA 2L6MA 2BBGA 4WFTA 4DR6E 1J26A 4X66E 2B7VA 2JXPA 1B69A 2EM0A 5KL4A 4GEQB 2YPNA 4GZNC 1IQOA 4NHRA 4LFCE 4X65E 2M1SA 4LFBE 1SFEA 1ZAAC 5AE1A 3IWCA 4JYAE 2G7HA 3C6MA 4R2SA 4R2EA 5KL5A 1IBLE 1EH8A 1Z1BA 4JI3E 5F3WA 4R03A 5BR8E 4OX9E 1A1JA 2V88A 1XNQE 3ADLA 2MDGA 2YTPA 2LO3A 4LF5E 4JI6E 1YZ9A 2V8QB 5T6JA 4AQYE 2FV4B 4P78A 3VYYA 4O43A 2F4VE 2EOEA 2YTDA 2YTOA 3EQ1A 1YYOA 1TF3A 4HTGA 1UILA 4R2CA 3MHHC 4JI8E 1YUIA 1N3GA 2E72A 2JP9A 2JVAA 3F6GA 3J81C 1JK2A 2UXBE 2EOQA 5A6BD 2NA2A 2EZ6A 1KJKA 4DR7E 2EQ0A 4Q28A 3T1YE 1YPNA 3C4TA 4JI0E 4M9VC 2M4IA 1ZU1A 4MLQA 4KWYA 4DV4E 4K0KE 3AV0A 2LUPB 2VE7C 4IJDA 4LTYA 4R2QA 2ENAA 2EOZA 2RPCA 2ENHA 5CFFE 1X49A 4O24A 2ENCA 2V85A 1QU6A 2WCC3 2ZM6E 2WBUA 2H36X 2EN8A 1DQ3A 1ZBTA 5KL7A 1HNXE 1XNRE 2EMLA 2LJHA 1YYWA 4BMJA 3ECRA 1J5EE 3BGHA 1O0WA 1FJGE 1X3CA 2ADRA 2YRHA 3BBGA 1XMOE 1N32E 4ZYDA 4LF9E 5KL2A 2LTSA 2WBSA 2B9DA 2HJJA 5IV8B 2JWOA 2B7TA 3VK6A 4M0VA 4DR4E 1HNZE 1GQEA 4NXNE 4F6NA 1N36E 2UU9E 2L33A 2I13A 3KZZA 2V86A 2JYAA 2EORA 3HPZA 2RSIA 4BC7A 4R2RA 2GLIA 4LFAE 5A6AA 4L8NA 2DLQA 1PJTA 1AAYA 5LL6R 2KHXA 2EP3A 1X5WA 3H09A 2EM6A 4MLVA 4X64E 1YUJA 5KL3A 3ZOQB 3JAMC 2EPUA 5A6KA 2DMIA 2N3HA 2ODRD 3UK3C 4JI7E 1HNWE 1X6EA 4DR1E 2EPPA 2EPMX 1SR9A 1A1KA 2N8XA 4GKKE 4DUYE 2EM4A 2L92A 2YWQA
chains in the Genus database with same CATH topology
3HQ1A 3HXLA 1GZ6A 4JI6E 3IWDA 1YZ9A 2JOBA 2V8QB 2V89A 2VF1A 5T6JA 5AE3A 4TUIA 2VQEE 2FV4B 4P78A 3VYYA 4AQYE 4JI2E 1T4LB 4DUZE 2HHHE 2F4VE 2UUCE 3ADIA 4KZSA 4DV3E 1YYOA 2NUGA 2LTRA 1UILA 4JI8E 2L3CA 4DR5E 1XMQE 2M7QA 4DV5E 4JV5E 2JVAA 3DJWA 2IHR1 4BCAA 1IBME 3F6GA 3J81C 2DB2A 4LF4E 4LF8E 3VYXA 2UXBE 2V87A 4YHHE 4KHPE 2N3GA 2NA2A 1WHNA 2EZ6A 2L8TA 4X8WA 5A2QC 3DF6A 2YT4A 2RS7A 4DR7E 4J8ZA 4Q28A 3T1YE 3C4TA 4GKJE 4JI0E 5AASA 4DR2E 4OOGC 4DMIA 2FGGA 2M4IA 4JI1E 4P7DA 3K6QA 1HR0E 3C4BA 5LMNE 4DV4E 1I94E 1X47A 4K0KE 2YZTA 3AV0A 4TUGA 2LUPB 2UUBE 2VE7C 4LTYA 4BC9A 2DIXA 2MC6A 3ADJA 2MC5A 2LMZA 3LLHA 5CFFE 1X49A 1WXRA 2EWLA 2V85A 4R8OA 3J7Yp 1QU6A 2JOXA 2ZM6E 2UUAE 2NUEA 2LUQA 3IWBA 1WHQA 2K4VA 2RSMA 1YYKA 2JR1A 4WSPA 5ADZA 1N33E 2H36X 4LF6E 2LE2A 1DQ3A 2FTXB 1ZBTA 1HNXE 1XNRE 2LJHA 1FKAE 4BMJA 4JI4E 4LF7E 1YYWA 4M30A 1J5EE 2DSYA 1O0WA 5LMUE 4F9AB 1STUA 1FJGE 2E1MA 3AUZA 1N34E 3F6HA 3RMPA 4B3ME 1XMOE 1N32E 4DV7E 1UHZA 4LF9E 2RS6A 3OTOE 1EKZA 1X48A 2WZOA 2UXCE 2LTSA 2UXDE 4DV6E 2B9DA 2F8BA 2JWOA 1RQ0A 3T1HE 2B7TA 3VK6A 4M0VA 2NUFA 2V83A 2ODRC 4DR4E 5FLXC 2L2NA 3OMLA 2B3TB 1GQEA 3JTZA 2L2MA 4WPYA 1HNZE 4NXNE 3J7AG 4B3TE 1PKPA 4I8OA 4F9CB 5AE2A 4DV1E 1N36E 2UU9E 4B3SE 4DR3E 2L33A 1T4NA 1DI2A 4YY3E 4JI5E 2V86A 2RTXA 3HPZA 4BC7A 5IWAE 4DV0E 4LFAE 2CPNA 4L8NA 4F54A 4X62E 2L6MA 4WFTA 5LL6R 4DKKA 4DR6E 4M2ZA 2KHXA 3HTXA 1J26A 4F9BB 2KOUA 4X66E 2LRSA 5DNYA 2B7VA 3H09A 3P1XA 4DV2E 4X64E 3LMLA 4GEQB 3ZOQB 3JAMC 2LBSB 5IT9C 1RC7A 1IBKE 3KWRA 2E5LE 4LFCE 2N3HA 2M1SA 2ODRD 4LU9A 4X65E 4LFBE 3HPSA 3IWCA 5AE1A 4JYAE 2G7HA 1T4OA 3J80C 4JI7E 3JU0A 4BS9A 1HNWE 4DR1E 3ADGA 1IBLE 4L5NC 4NXME 2DMYA 4JI3E 4B3RE 5F3WA 1SR9A 4R03A 2MDRA 5BR8E 4BBYA 4OX9E 2V88A 2VQFE 3MSWA 1XNQE 3ADLA 4DUYE 4WYQB 4GKKE 2JY9A 1ZBQA 2L2KB 2KONA 3FIGA 2L92A 2L3JA 4LF5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V88 A;  2V89 A;  2V85 A;  2JWO A;  2V87 A;  2V83 A;  2V86 A; 
#chains in the Genus database with same CATH topology
 2EM8 A;  3HXL A;  2JOB A;  2V89 A;  5AE3 A;  4TUI A;  1T4L B;  4DUZ E;  4R2P A;  2EPA A;  2M7Q A;  4R2D A;  2YTF A;  2A25 A;  4F2J C;  2EM3 A;  2EOM A;  4LF4 E;  3VYX A;  2DB2 A;  2V87 A;  2EMZ A;  2EM5 A;  1IQS A;  5TSE A;  4WSG A;  1KYQ A;  5A2Q C;  2YT4 A;  3EPL A;  2EMG A;  2EPK X;  1A1I A;  2GPI A;  2YTE A;  4JI1 E;  4BHC A;  4ZYH A;  1I94 E;  1X47 A;  1AH5 A;  4BC9 A;  2EPC A;  4BHB A;  2J7J A;  1DGC A;  2EWL A;  2MKD A;  1YYK A;  1WHQ A;  1N33 E;  4N4R B;  2VRD A;  2YTG A;  2GHF A;  2MKN A;  2FTX B;  1WRJ A;  4LF7 E;  1BB8 A;  2DSY A;  2YRM A;  2YTI A;  4WX9 A;  3RMP A;  2RS6 A;  4DV6 E;  5AC5 A;  1YSA C;  1EH6 A;  2EOJ A;  2LJU A;  2M9A A;  2ODR C;  2L2N A;  3OML A;  2B3T B;  3JTZ A;  3EPJ A;  2L2M A;  2LT7 A;  4I8O A;  4DV1 E;  2I9I A;  4DR3 E;  1A1H A;  2Q8U A;  4DKK A;  4M2Z A;  3HTX A;  2HC5 A;  2KOU A;  5DNY A;  2EMA A;  5A6J A;  5IT9 C;  3KWR A;  2E5L E;  3HPS A;  1GTK A;  3J80 C;  3JU0 A;  4BS9 A;  2DRP A;  4X9J A;  2EL5 A;  4L5N C;  4NXM E;  2DMY A;  1A1L A;  4B3R E;  4BBY A;  2VQF E;  3MSW A;  1LLM C;  2EPZ A;  1ZBQ A;  2JY9 A;  2L2K B;  1G2D C;  3FIG A;  2EE8 A;  2L3J A;  3HQ1 A;  2EN4 A;  2UUC E;  3ADI A;  2L3C A;  4DR5 E;  1XMQ E;  4DV5 E;  4O5G A;  4JV5 E;  2JPA A;  4BCA A;  4LF8 E;  2EMB A;  3BID A;  4YHH E;  2N3G A;  1WHN A;  2L8T A;  2YTJ A;  2YRK A;  3DF6 A;  2HGH A;  4DR2 E;  2EMF A;  1IMU A;  1MGT A;  3QG5 C;  1PDA A;  2FGG A;  4DMI A;  3THN A;  1JK1 A;  4ZYE A;  2EMC A;  2YZT A;  2EN7 A;  5KL6 A;  4O4K A;  2EMX A;  5A69 A;  2DIX A;  4F6M A;  2BB8 A;  2MC6 A;  2LMZ A;  2D9H A;  2RQL A;  2YTN A;  1L4S A;  2YU8 A;  2EMH A;  2EL4 A;  2LUQ A;  2LVH A;  2EPN A;  2K4V A;  2JR1 A;  5A6B A;  5ADZ A;  1PJQ A;  2LE2 A;  1A1F A;  1FKA E;  4JI4 E;  2EPX A;  4F9A B;  1F2I G;  2EOX A;  1N34 E;  4B3M E;  4DV7 E;  1NEI A;  1UHZ A;  3OTO E;  1EKZ A;  1X48 A;  2WZO A;  1T38 A;  1RQ0 A;  4RHB B;  2DLK A;  5FLX C;  3L00 A;  1PJS A;  1A1G A;  1PKP A;  4F9C B;  4R2A A;  4B3S E;  1T39 A;  1T4N A;  2CPN A;  4F54 A;  4X62 E;  1BBO A;  2EMK A;  3TQM A;  4F9B B;  2LRS A;  2ELZ A;  4WXC A;  3P1X A;  2EOH A;  2EM2 A;  4DV2 E;  3LML A;  2PRT A;  2EPR A;  1RC7 A;  2LBS B;  2EMY A;  1IBK E;  1UN6 B;  4WXD A;  4LU9 A;  1NCS A;  2EOI A;  2EMW A;  1TF6 A;  1G2F C;  5IXM B;  1T4O A;  1EH7 A;  2K7I A;  3ADG A;  2EOF A;  1QNT A;  3EPK A;  2MDR A;  2EN1 A;  4WYQ B;  2KON A;  1WJP A;  1GZ6 A;  3C6K A;  2R76 A;  3IWD A;  2VF1 A;  2EOO A;  2EPO A;  4JI2 E;  2VQE E;  3BF2 A;  2HHH E;  2EN2 A;  4KZS A;  2YSP A;  4DV3 E;  2NUG A;  2LTR A;  3MHS C;  2DGC A;  2R1F A;  4NZV A;  3DJW A;  2IHR 1;  3THO B;  1IBM E;  2EN6 A;  2WBT A;  4HEI A;  4KHP E;  5LLQ A;  4X8W A;  2RS7 A;  1RMD A;  4J8Z A;  4RH8 A;  2EPL X;  4GKJ E;  2LCE A;  3KZY A;  3VHT B;  4ZYG A;  5AAS A;  4OOG C;  4P7D A;  3K6Q A;  1HR0 E;  3C4B A;  1X6H A;  5LMN E;  2YTQ A;  4TUG A;  2UUB E;  1MEY C;  2YU5 A;  3ADJ A;  3LLH A;  2MC5 A;  1WXR A;  3EPH A;  2CTD A;  2EN3 A;  2YSO A;  4R8O A;  1P47 A;  2CSH A;  3J7Y p;  2JOX A;  4IS1 C;  2UUA E;  2NUE A;  3IWB A;  2EQ1 A;  2EL6 A;  2RSM A;  2EOY A;  4WSP A;  1BBG A;  4LF6 E;  2CT1 A;  1YFH A;  2LV2 A;  5AC4 A;  4M30 A;  1TN9 A;  5LMU E;  1X6F A;  4FK5 C;  1STU A;  2E1M A;  3AUZ A;  3F6H A;  2UXD E;  2UXC E;  2ELY A;  4Q35 B;  2EJ4 A;  2F8B A;  3T1H E;  2EQ3 A;  2NUF A;  2EM7 A;  2EM9 A;  2V83 A;  4WPY A;  3J7A G;  4B3T E;  5AE2 A;  2NAB A;  2EMI A;  1DI2 A;  4YY3 E;  4JI5 E;  2RTX A;  5IWA E;  1UBD C;  4DV0 E;  3M99 B;  1ZR9 A;  2EOS A;  2L6M A;  2BBG A;  4WFT A;  4DR6 E;  1J26 A;  4X66 E;  2B7V A;  2JXP A;  1B69 A;  2EM0 A;  5KL4 A;  4GEQ B;  2YPN A;  4GZN C;  1IQO A;  4NHR A;  4LFC E;  4X65 E;  2M1S A;  4LFB E;  1SFE A;  1ZAA C;  5AE1 A;  3IWC A;  4JYA E;  2G7H A;  3C6M A;  4R2S A;  4R2E A;  5KL5 A;  1IBL E;  1EH8 A;  1Z1B A;  4JI3 E;  5F3W A;  4R03 A;  5BR8 E;  4OX9 E;  1A1J A;  2V88 A;  1XNQ E;  3ADL A;  2MDG A;  2YTP A;  2LO3 A;  4LF5 E;  4JI6 E;  1YZ9 A;  2V8Q B;  5T6J A;  4AQY E;  2FV4 B;  4P78 A;  3VYY A;  4O43 A;  2F4V E;  2EOE A;  2YTD A;  2YTO A;  3EQ1 A;  1YYO A;  1TF3 A;  4HTG A;  1UIL A;  4R2C A;  3MHH C;  4JI8 E;  1YUI A;  1N3G A;  2E72 A;  2JP9 A;  2JVA A;  3F6G A;  3J81 C;  1JK2 A;  2UXB E;  2EOQ A;  5A6B D;  2NA2 A;  2EZ6 A;  1KJK A;  4DR7 E;  2EQ0 A;  4Q28 A;  3T1Y E;  1YPN A;  3C4T A;  4JI0 E;  4M9V C;  2M4I A;  1ZU1 A;  4MLQ A;  4KWY A;  4DV4 E;  4K0K E;  3AV0 A;  2LUP B;  2VE7 C;  4IJD A;  4LTY A;  4R2Q A;  2ENA A;  2EOZ A;  2RPC A;  2ENH A;  5CFF E;  1X49 A;  4O24 A;  2ENC A;  2V85 A;  1QU6 A;  2WCC 3;  2ZM6 E;  2WBU A;  2H36 X;  2EN8 A;  1DQ3 A;  1ZBT A;  5KL7 A;  1HNX E;  1XNR E;  2EML A;  2LJH A;  1YYW A;  4BMJ A;  3ECR A;  1J5E E;  3BGH A;  1O0W A;  1FJG E;  1X3C A;  2ADR A;  2YRH A;  3BBG A;  1XMO E;  1N32 E;  4ZYD A;  4LF9 E;  5KL2 A;  2LTS A;  2WBS A;  2B9D A;  2HJJ A;  5IV8 B;  2JWO A;  2B7T A;  3VK6 A;  4M0V A;  4DR4 E;  1HNZ E;  1GQE A;  4NXN E;  4F6N A;  1N36 E;  2UU9 E;  2L33 A;  2I13 A;  3KZZ A;  2V86 A;  2JYA A;  2EOR A;  3HPZ A;  2RSI A;  4BC7 A;  4R2R A;  2GLI A;  4LFA E;  5A6A A;  4L8N A;  2DLQ A;  1PJT A;  1AAY A;  5LL6 R;  2KHX A;  2EP3 A;  1X5W A;  3H09 A;  2EM6 A;  4MLV A;  4X64 E;  1YUJ A;  5KL3 A;  3ZOQ B;  3JAM C;  2EPU A;  5A6K A;  2DMI A;  2N3H A;  2ODR D;  3UK3 C;  4JI7 E;  1HNW E;  1X6E A;  4DR1 E;  2EPP A;  2EPM X;  1SR9 A;  1A1K A;  2N8X A;  4GKK E;  4DUY E;  2EM4 A;  2L92 A;  2YWQ A; 
#chains in the Genus database with same CATH homology
 3HQ1 A;  3HXL A;  1GZ6 A;  4JI6 E;  3IWD A;  1YZ9 A;  2JOB A;  2V8Q B;  2V89 A;  2VF1 A;  5T6J A;  5AE3 A;  4TUI A;  2VQE E;  2FV4 B;  4P78 A;  3VYY A;  4AQY E;  4JI2 E;  1T4L B;  4DUZ E;  2HHH E;  2F4V E;  2UUC E;  3ADI A;  4KZS A;  4DV3 E;  1YYO A;  2NUG A;  2LTR A;  1UIL A;  4JI8 E;  2L3C A;  4DR5 E;  1XMQ E;  2M7Q A;  4DV5 E;  4JV5 E;  2JVA A;  3DJW A;  2IHR 1;  4BCA A;  1IBM E;  3F6G A;  3J81 C;  2DB2 A;  4LF4 E;  4LF8 E;  3VYX A;  2UXB E;  2V87 A;  4YHH E;  4KHP E;  2N3G A;  2NA2 A;  1WHN A;  2EZ6 A;  2L8T A;  4X8W A;  5A2Q C;  3DF6 A;  2YT4 A;  2RS7 A;  4DR7 E;  4J8Z A;  4Q28 A;  3T1Y E;  3C4T A;  4GKJ E;  4JI0 E;  5AAS A;  4DR2 E;  4OOG C;  4DMI A;  2FGG A;  2M4I A;  4JI1 E;  4P7D A;  3K6Q A;  1HR0 E;  3C4B A;  5LMN E;  4DV4 E;  1I94 E;  1X47 A;  4K0K E;  2YZT A;  3AV0 A;  4TUG A;  2LUP B;  2UUB E;  2VE7 C;  4LTY A;  4BC9 A;  2DIX A;  2MC6 A;  3ADJ A;  2MC5 A;  2LMZ A;  3LLH A;  5CFF E;  1X49 A;  1WXR A;  2EWL A;  2V85 A;  4R8O A;  3J7Y p;  1QU6 A;  2JOX A;  2ZM6 E;  2UUA E;  2NUE A;  2LUQ A;  3IWB A;  1WHQ A;  2K4V A;  2RSM A;  1YYK A;  2JR1 A;  4WSP A;  5ADZ A;  1N33 E;  2H36 X;  4LF6 E;  2LE2 A;  1DQ3 A;  2FTX B;  1ZBT A;  1HNX E;  1XNR E;  2LJH A;  1FKA E;  4BMJ A;  4JI4 E;  4LF7 E;  1YYW A;  4M30 A;  1J5E E;  2DSY A;  1O0W A;  5LMU E;  4F9A B;  1STU A;  1FJG E;  2E1M A;  3AUZ A;  1N34 E;  3F6H A;  3RMP A;  4B3M E;  1XMO E;  1N32 E;  4DV7 E;  1UHZ A;  4LF9 E;  2RS6 A;  3OTO E;  1EKZ A;  1X48 A;  2WZO A;  2UXC E;  2LTS A;  2UXD E;  4DV6 E;  2B9D A;  2F8B A;  2JWO A;  1RQ0 A;  3T1H E;  2B7T A;  3VK6 A;  4M0V A;  2NUF A;  2V83 A;  2ODR C;  4DR4 E;  5FLX C;  2L2N A;  3OML A;  2B3T B;  1GQE A;  3JTZ A;  2L2M A;  4WPY A;  1HNZ E;  4NXN E;  3J7A G;  4B3T E;  1PKP A;  4I8O A;  4F9C B;  5AE2 A;  4DV1 E;  1N36 E;  2UU9 E;  4B3S E;  4DR3 E;  2L33 A;  1T4N A;  1DI2 A;  4YY3 E;  4JI5 E;  2V86 A;  2RTX A;  3HPZ A;  4BC7 A;  5IWA E;  4DV0 E;  4LFA E;  2CPN A;  4L8N A;  4F54 A;  4X62 E;  2L6M A;  4WFT A;  5LL6 R;  4DKK A;  4DR6 E;  4M2Z A;  2KHX A;  3HTX A;  1J26 A;  4F9B B;  2KOU A;  4X66 E;  2LRS A;  5DNY A;  2B7V A;  3H09 A;  3P1X A;  4DV2 E;  4X64 E;  3LML A;  4GEQ B;  3ZOQ B;  3JAM C;  2LBS B;  5IT9 C;  1RC7 A;  1IBK E;  3KWR A;  2E5L E;  4LFC E;  2N3H A;  2M1S A;  2ODR D;  4LU9 A;  4X65 E;  4LFB E;  3HPS A;  3IWC A;  5AE1 A;  4JYA E;  2G7H A;  1T4O A;  3J80 C;  4JI7 E;  3JU0 A;  4BS9 A;  1HNW E;  4DR1 E;  3ADG A;  1IBL E;  4L5N C;  4NXM E;  2DMY A;  4JI3 E;  4B3R E;  5F3W A;  1SR9 A;  4R03 A;  2MDR A;  5BR8 E;  4BBY A;  4OX9 E;  2V88 A;  2VQF E;  3MSW A;  1XNQ E;  3ADL A;  4DUY E;  4WYQ B;  4GKK E;  2JY9 A;  1ZBQ A;  2L2K B;  2KON A;  3FIG A;  2L92 A;  2L3J A;  4LF5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...