2JWOA

A phd finger motif in the c-terminus of rag2 modulates recombination activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Recombination
molecule keywords V(D)J recombination-activating protein 2
publication title A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
pubmed doi rcsb
source organism Mus musculus
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jwoA01
2V85A 2V87A 2JWOA 2V86A 2V89A 2V88A 2V83A
chains in the Genus database with same CATH superfamily
4WX9A 1PJQA 2YTIA 2UUCE 2EMYA 4DR1E 3EPLA 4B3ME 1F2IG 1WRJA 1XNRE 2EOQA 2EMHA 2EOOA 2EM2A 3THNA 2DRPA 2EWLA 3VYXA 2EPCA 1O0WA 4GKKE 1UILA 4X8WA 4MLVA 2FV4B 2GHFA 4JI7E 3C4BA 4B3TE 2WBSA 1ZAAC 3HPZA 2EL5A 3C6KA 4R2PA 2ENAA 4LTYA 3OTOE 1JK2A 3M99B 2EMXA 2YTFA 2B7TA 3BF2A 4DKKA 2LUPB 2N3HA 2NA2A 4R2SA 2RSIA 3P1XA 2M4IA 4WSGA 5A6AA 4TUGA 3ADIA 4YHHE 2CTDA 3T1HE 2JY9A 2LTSA 2ODRC 2EOZA 2YTOA 3DJWA 4WSPA 1FJGE 1GZ6A 2EM0A 3LLHA 4IJDA 5A6KA 1X3CA 5DNYA 2N3GA 1LLMC 2V86A 1PJTA 1FKAE 1N33E 2HJJA 2V89A 4WYQB 4ZYEA 2YPNA 2EN2A 2MC5A 2ZM6E 1ZR9A 2RQLA 2EMWA 3EPKA 2NUFA 4ZYDA 5F3WA 3C4TA 3OMLA 4DV2E 5A6JA 2L2MA 4DV0E 1SFEA 2EN7A 3DF6A 5AE3A 2F8BA 1A1HA 1JK1A 2E5LE 1GQEA 1TF6A 3IWBA 4X66E 4IS1C 4LF5E 2YTGA 2GLIA 2EMAA 2YZTA 4NXNE 4BHCA 4BCAA 1TN9A 4JI6E 1TF3A 5KL6A 4LFAE 4HEIA 2EMLA 1IBME 1YUIA 4BS9A 2JR1A 5LL6R 2M7QA 1GTKA 1A1FA 4JYAE 3MHHC 2YU5A 2WCC3 1X6EA 2EM6A 1PKPA 3FIGA 1I94E 1HNZE 5BR8E 5A2QC 4JI3E 3KZZA 2EPOA 4M30A 4R2AA 2YU8A 1A1JA 4F9BB 4BBYA 1A1KA 1IQSA 4F9AB 2DLQA 2EN4A 4LF7E 2K4VA 1AH5A 2DLKA 4OOGC 1QNTA 2DSYA 2VE7C 4BMJA 2EOJA 4DR6E 4K0KE 2MDGA 3HQ1A 2YTQA 4LF6E 4F2JC 4J8ZA 3BBGA 2JP9A 1A1LA 1X6HA 2JWOA 2EPXA 1YSAC 2RS7A 1RQ0A 2CSHA 3MSWA 4HTGA 2J7JA 2YTEA 5KL3A 1YUJA 1X5WA 2K7IA 3EPHA 4O5GA 3T1YE 4F6MA 2DMIA 3JAMC 2EMZA 4R2CA 3H09A 2ELZA 4DR7E 1XNQE 2EL4A 2EPUA 1BB8A 2ELYA 4RHBB 2L2NA 2Q8UA 5AC4A 4TUIA 2NUEA 5TSEA 5IT9C 2HC5A 4Q28A 2LTRA 4N4RB 2YSPA 2EPMX 4DR3E 1T39A 1HR0E 5LLQA 3J7AG 1KYQA 2LE2A 4M2ZA 2EJ4A 1T4OA 1PDAA 2YTDA 1MGTA 1UHZA 2EM9A 1YYKA 2EMFA 2L3JA 4JI5E 4M9VC 1ZBQA 1IBKE 2YTJA 2EPKX 2LVHA 1NCSA 3ADGA 1MEYC 3ADLA 2MDRA 1BBOA 1A1IA 2I9IA 2RTXA 3EQ1A 2JOXA 4GEQB 3LMLA 1IQOA 1G2DC 2UXCE 3HXLA 2NABA 1EH8A 2IHR1 2LRSA 1A1GA 4DUZE 1DI2A 1WHQA 3VYYA 5IXMB 2LMZA 4R2EA 2LJUA 2E72A 2YRKA 2RSMA 4JV5E 5IWAE 2VF1A 1SR9A 5T6JA 4LFCE 2EOMA 2JOBA 5A6BD 4JI0E 2EN6A 1N36E 1N32E 3IWDA 2EPLX 2L33A 2D9HA 2V85A 2EORA 1X6FA 1UN6B 4X65E 2RPCA 1B69A 2EN1A 4L8NA 2E1MA 3JTZA 4R2QA 2LT7A 2F4VE 4DV5E 2DIXA 3KWRA 4DUYE 1AAYA 4YY3E 2CPNA 2V87A 2YWQA 4O43A 1XMOE 3L00A 1STUA 1KJKA 2A25A 2MKDA 5IV8B 1YPNA 2DMYA 2JXPA 2EQ3A 4M0VA 5FLXC 2RS6A 2EMBA 3VHTB 2FGGA 5KL4A 4P78A 2EPZA 1G2FC 2EMKA 2ENCA 4KWYA 5AE2A 2EMIA 3VK6A 4JI8E 4GKJE 2YTNA 1X49A 4BC9A 2G7HA 3AUZA 2ENHA 4JI1E 1QU6A 1ZU1A 4GZNC 4MLQA 2B7VA 2EM5A 2JYAA 2EOHA 1X47A 2L6MA 2UUBE 2ADRA 4NHRA 2L2KB 2B3TB 5LMUE 1WXRA 3BIDA 5AC5A 3THOB 1IMUA 2EN8A 1X48A 2LJHA 2EOFA 4B3SE 2YSOA 3HTXA 5ADZA 4X62E 4DMIA 2B9DA 4DV7E 2KHXA 2LBSB 2YTPA 4R2DA 2M1SA 2DGCA 2EMGA 3F6HA 3TQMA 1RC7A 2GPIA 4O24A 1WJPA 2HHHE 2UXBE 2UUAE 2CT1A 2KOUA 2EM7A 1IBLE 3JU0A 2BB8A 2DB2A 4LF8E 3ECRA 1T38A 2EPAA 4R8OA 4P7DA 1N3GA 4DR5E 4DV3E 1UBDC 4WPYA 2N8XA 4DV4E 4DR2E 2EMCA 2EPPA 2EN3A 5A6BA 2EL6A 1DQ3A 2EOIA 4OX9E 2WBTA 3F6GA 2EPNA 2EQ1A 3EPJA 2M9AA 2HGHA 2EOEA 1BBGA 1EH6A 2EOYA 5KL2A 5LMNE 4ZYGA 4X64E 3K6QA 2EM3A 2YRHA 1YYWA 3UK3C 4F54A 2LUQA 2BBGA 2LV2A 1NEIA 3AV0A 1EKZA 3J7Yp 2L8TA 1XMQE 1J5EE 3KZYA 5CFFE 1Z1BA 2FTXB 4LF4E 2EE8A 4BC7A 4DR4E 1YZ9A 4DV6E 3HPSA 4B3RE 2MKNA 1T4LB 3QG5C 3J80C 2R76A 2LCEA 1L4SA 5KL5A 2EOXA 2VQFE 2MC6A 2UU9E 4F9CB 2VRDA 1DGCA 1YFHA 5KL7A 4WXDA 2NUGA 3J81C 4R2RA 3RMPA 4LF9E 2ODRD 4WFTA 5AASA 2PRTA 4WXCA 1ZBTA 2H36X 2EM4A 4LU9A 4NZVA 4KHPE 4X9JA 4KZSA 2JPAA 1T4NA 4O4KA 2KONA 1RMDA 2JVAA 3ZOQB 4BHBA 2WBUA 4FK5C 1YYOA 4L5NC 2EPRA 2V83A 5A69A 3ADJA 1HNXE 4F6NA 2EP3A 2VQEE 4JI2E 4JI4E 3MHSC 2L92A 2EM8A 4AQYE 1J26A 1EH7A 4Q35B 5AE1A 4NXME 1HNWE 2YRMA 2YT4A 3BGHA 2V8QB 2WZOA 2EOSA 4ZYHA 2UXDE 3IWCA 3C6MA 4DV1E 2EZ6A 4LFBE 2EQ0A 1PJSA 2I13A 1N34E 2LO3A 4I8OA 2L3CA 4RH8A 2R1FA 1P47A 1WHNA 4R03A 2V88A
chains in the Genus database with same CATH topology
2JOBA 1HNXE 3FIGA 1I94E 1PKPA 4JI0E 1HNZE 1N36E 1N32E 3IWDA 2UUCE 5BR8E 5A2QC 4JI3E 2L33A 5LMNE 4M30A 4DR1E 2V85A 4X64E 3K6QA 4F9BB 4B3ME 1XNRE 4X65E 4BBYA 4L8NA 1YYWA 2E1MA 4F54A 2LUQA 4F9AB 3JTZA 2EWLA 3VYXA 3AV0A 1EKZA 1O0WA 4DV5E 2DIXA 3KWRA 3J7Yp 2L8TA 2K4VA 4DUYE 1XMQE 1UILA 4X8WA 4OOGC 2CPNA 2DSYA 2V87A 2FV4B 2VE7C 4BMJA 5CFFE 4YY3E 2FTXB 1XMOE 4LF4E 4JI7E 1STUA 4DR6E 4K0KE 3C4BA 4BC7A 4B3TE 4DR4E 3HQ1A 4LF6E 1YZ9A 3HPZA 2DMYA 4J8ZA 3HPSA 4DV6E 4B3RE 2JWOA 4M0VA 4LTYA 2RS6A 5FLXC 3OTOE 1T4LB 2FGGA 2RS7A 1RQ0A 3J80C 3MSWA 4P78A 2B7TA 4DKKA 2LUPB 2N3HA 2NA2A 3T1YE 3P1XA 2VQFE 2MC6A 5AE2A 2UU9E 2M4IA 4F9CB 3JAMC 3VK6A 4JI8E 4GKJE 3H09A 4DR7E 1XNQE 4TUGA 3ADIA 1X49A 4YHHE 4BC9A 2G7HA 3T1HE 2JY9A 2NUGA 3AUZA 3J81C 4JI1E 1QU6A 2LTSA 2ODRC 2L2NA 3RMPA 4LF9E 2ODRD 3DJWA 4WSPA 1FJGE 1GZ6A 2B7VA 4WFTA 4TUIA 3LLHA 2NUEA 5AASA 1ZBTA 2H36X 1X47A 2L6MA 5IT9C 2UUBE 5DNYA 4Q28A 2LTRA 4LU9A 2L2KB 2B3TB 4KHPE 4KZSA 5LMUE 2N3GA 1WXRA 1T4NA 2KONA 1X48A 2LJHA 2V86A 1FKAE 1N33E 2JVAA 4B3SE 3ZOQB 2V89A 4WYQB 4DR3E 1YYOA 1HR0E 4L5NC 3J7AG 2MC5A 2V83A 2ZM6E 5T6JA 2LE2A 3HTXA 5ADZA 4M2ZA 2F4VE 3ADJA 4X62E 4DMIA 2NUFA 2B9DA 1T4OA 4DV7E 2KHXA 3C4TA 3OMLA 4DV2E 2VQEE 2LBSB 2L2MA 4DV0E 1UHZA 4JI2E 1YYKA 2M1SA 3DF6A 5AE3A 2F8BA 3F6HA 2L3JA 4JI5E 1RC7A 1ZBQA 1IBKE 2E5LE 1GQEA 4JI4E 2HHHE 3IWBA 2L92A 3ADGA 4X66E 3ADLA 2UUAE 4AQYE 2MDRA 2UXBE 1J26A 2KOUA 1IBLE 2RTXA 3JU0A 5AE1A 4LF5E 2JOXA 2DB2A 4GEQB 3LMLA 5F3WA 4LF8E 4NXME 1HNWE 2YZTA 4NXNE 2YT4A 2UXCE 4R8OA 4BCAA 4P7DA 3HXLA 4DR5E 4JI6E 2V8QB 2IHR1 2WZOA 4LFAE 2LRSA 4DV3E 4DUZE 1IBME 4LF7E 1DI2A 2UXDE 4WPYA 1WHQA 4LFCE 4BS9A 2JR1A 3VYYA 1J5EE 3IWCA 2LMZA 4DV1E 4DV4E 4DR2E 5LL6R 2EZ6A 4GKKE 4LFBE 2RSMA 2M7QA 1DQ3A 4JV5E 4OX9E 1N34E 4I8OA 2L3CA 4JYAE 5IWAE 2VF1A 3F6GA 1SR9A 1WHNA 4R03A 2V88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V85 A;  2V87 A;  2JWO A;  2V86 A;  2V89 A;  2V88 A;  2V83 A; 
#chains in the Genus database with same CATH topology
 4WX9 A;  1PJQ A;  2YTI A;  2UUC E;  2EMY A;  4DR1 E;  3EPL A;  4B3M E;  1F2I G;  1WRJ A;  1XNR E;  2EOQ A;  2EMH A;  2EOO A;  2EM2 A;  3THN A;  2DRP A;  2EWL A;  3VYX A;  2EPC A;  1O0W A;  4GKK E;  1UIL A;  4X8W A;  4MLV A;  2FV4 B;  2GHF A;  4JI7 E;  3C4B A;  4B3T E;  2WBS A;  1ZAA C;  3HPZ A;  2EL5 A;  3C6K A;  4R2P A;  2ENA A;  4LTY A;  3OTO E;  1JK2 A;  3M99 B;  2EMX A;  2YTF A;  2B7T A;  3BF2 A;  4DKK A;  2LUP B;  2N3H A;  2NA2 A;  4R2S A;  2RSI A;  3P1X A;  2M4I A;  4WSG A;  5A6A A;  4TUG A;  3ADI A;  4YHH E;  2CTD A;  3T1H E;  2JY9 A;  2LTS A;  2ODR C;  2EOZ A;  2YTO A;  3DJW A;  4WSP A;  1FJG E;  1GZ6 A;  2EM0 A;  3LLH A;  4IJD A;  5A6K A;  1X3C A;  5DNY A;  2N3G A;  1LLM C;  2V86 A;  1PJT A;  1FKA E;  1N33 E;  2HJJ A;  2V89 A;  4WYQ B;  4ZYE A;  2YPN A;  2EN2 A;  2MC5 A;  2ZM6 E;  1ZR9 A;  2RQL A;  2EMW A;  3EPK A;  2NUF A;  4ZYD A;  5F3W A;  3C4T A;  3OML A;  4DV2 E;  5A6J A;  2L2M A;  4DV0 E;  1SFE A;  2EN7 A;  3DF6 A;  5AE3 A;  2F8B A;  1A1H A;  1JK1 A;  2E5L E;  1GQE A;  1TF6 A;  3IWB A;  4X66 E;  4IS1 C;  4LF5 E;  2YTG A;  2GLI A;  2EMA A;  2YZT A;  4NXN E;  4BHC A;  4BCA A;  1TN9 A;  4JI6 E;  1TF3 A;  5KL6 A;  4LFA E;  4HEI A;  2EML A;  1IBM E;  1YUI A;  4BS9 A;  2JR1 A;  5LL6 R;  2M7Q A;  1GTK A;  1A1F A;  4JYA E;  3MHH C;  2YU5 A;  2WCC 3;  1X6E A;  2EM6 A;  1PKP A;  3FIG A;  1I94 E;  1HNZ E;  5BR8 E;  5A2Q C;  4JI3 E;  3KZZ A;  2EPO A;  4M30 A;  4R2A A;  2YU8 A;  1A1J A;  4F9B B;  4BBY A;  1A1K A;  1IQS A;  4F9A B;  2DLQ A;  2EN4 A;  4LF7 E;  2K4V A;  1AH5 A;  2DLK A;  4OOG C;  1QNT A;  2DSY A;  2VE7 C;  4BMJ A;  2EOJ A;  4DR6 E;  4K0K E;  2MDG A;  3HQ1 A;  2YTQ A;  4LF6 E;  4F2J C;  4J8Z A;  3BBG A;  2JP9 A;  1A1L A;  1X6H A;  2JWO A;  2EPX A;  1YSA C;  2RS7 A;  1RQ0 A;  2CSH A;  3MSW A;  4HTG A;  2J7J A;  2YTE A;  5KL3 A;  1YUJ A;  1X5W A;  2K7I A;  3EPH A;  4O5G A;  3T1Y E;  4F6M A;  2DMI A;  3JAM C;  2EMZ A;  4R2C A;  3H09 A;  2ELZ A;  4DR7 E;  1XNQ E;  2EL4 A;  2EPU A;  1BB8 A;  2ELY A;  4RHB B;  2L2N A;  2Q8U A;  5AC4 A;  4TUI A;  2NUE A;  5TSE A;  5IT9 C;  2HC5 A;  4Q28 A;  2LTR A;  4N4R B;  2YSP A;  2EPM X;  4DR3 E;  1T39 A;  1HR0 E;  5LLQ A;  3J7A G;  1KYQ A;  2LE2 A;  4M2Z A;  2EJ4 A;  1T4O A;  1PDA A;  2YTD A;  1MGT A;  1UHZ A;  2EM9 A;  1YYK A;  2EMF A;  2L3J A;  4JI5 E;  4M9V C;  1ZBQ A;  1IBK E;  2YTJ A;  2EPK X;  2LVH A;  1NCS A;  3ADG A;  1MEY C;  3ADL A;  2MDR A;  1BBO A;  1A1I A;  2I9I A;  2RTX A;  3EQ1 A;  2JOX A;  4GEQ B;  3LML A;  1IQO A;  1G2D C;  2UXC E;  3HXL A;  2NAB A;  1EH8 A;  2IHR 1;  2LRS A;  1A1G A;  4DUZ E;  1DI2 A;  1WHQ A;  3VYY A;  5IXM B;  2LMZ A;  4R2E A;  2LJU A;  2E72 A;  2YRK A;  2RSM A;  4JV5 E;  5IWA E;  2VF1 A;  1SR9 A;  5T6J A;  4LFC E;  2EOM A;  2JOB A;  5A6B D;  4JI0 E;  2EN6 A;  1N36 E;  1N32 E;  3IWD A;  2EPL X;  2L33 A;  2D9H A;  2V85 A;  2EOR A;  1X6F A;  1UN6 B;  4X65 E;  2RPC A;  1B69 A;  2EN1 A;  4L8N A;  2E1M A;  3JTZ A;  4R2Q A;  2LT7 A;  2F4V E;  4DV5 E;  2DIX A;  3KWR A;  4DUY E;  1AAY A;  4YY3 E;  2CPN A;  2V87 A;  2YWQ A;  4O43 A;  1XMO E;  3L00 A;  1STU A;  1KJK A;  2A25 A;  2MKD A;  5IV8 B;  1YPN A;  2DMY A;  2JXP A;  2EQ3 A;  4M0V A;  5FLX C;  2RS6 A;  2EMB A;  3VHT B;  2FGG A;  5KL4 A;  4P78 A;  2EPZ A;  1G2F C;  2EMK A;  2ENC A;  4KWY A;  5AE2 A;  2EMI A;  3VK6 A;  4JI8 E;  4GKJ E;  2YTN A;  1X49 A;  4BC9 A;  2G7H A;  3AUZ A;  2ENH A;  4JI1 E;  1QU6 A;  1ZU1 A;  4GZN C;  4MLQ A;  2B7V A;  2EM5 A;  2JYA A;  2EOH A;  1X47 A;  2L6M A;  2UUB E;  2ADR A;  4NHR A;  2L2K B;  2B3T B;  5LMU E;  1WXR A;  3BID A;  5AC5 A;  3THO B;  1IMU A;  2EN8 A;  1X48 A;  2LJH A;  2EOF A;  4B3S E;  2YSO A;  3HTX A;  5ADZ A;  4X62 E;  4DMI A;  2B9D A;  4DV7 E;  2KHX A;  2LBS B;  2YTP A;  4R2D A;  2M1S A;  2DGC A;  2EMG A;  3F6H A;  3TQM A;  1RC7 A;  2GPI A;  4O24 A;  1WJP A;  2HHH E;  2UXB E;  2UUA E;  2CT1 A;  2KOU A;  2EM7 A;  1IBL E;  3JU0 A;  2BB8 A;  2DB2 A;  4LF8 E;  3ECR A;  1T38 A;  2EPA A;  4R8O A;  4P7D A;  1N3G A;  4DR5 E;  4DV3 E;  1UBD C;  4WPY A;  2N8X A;  4DV4 E;  4DR2 E;  2EMC A;  2EPP A;  2EN3 A;  5A6B A;  2EL6 A;  1DQ3 A;  2EOI A;  4OX9 E;  2WBT A;  3F6G A;  2EPN A;  2EQ1 A;  3EPJ A;  2M9A A;  2HGH A;  2EOE A;  1BBG A;  1EH6 A;  2EOY A;  5KL2 A;  5LMN E;  4ZYG A;  4X64 E;  3K6Q A;  2EM3 A;  2YRH A;  1YYW A;  3UK3 C;  4F54 A;  2LUQ A;  2BBG A;  2LV2 A;  1NEI A;  3AV0 A;  1EKZ A;  3J7Y p;  2L8T A;  1XMQ E;  1J5E E;  3KZY A;  5CFF E;  1Z1B A;  2FTX B;  4LF4 E;  2EE8 A;  4BC7 A;  4DR4 E;  1YZ9 A;  4DV6 E;  3HPS A;  4B3R E;  2MKN A;  1T4L B;  3QG5 C;  3J80 C;  2R76 A;  2LCE A;  1L4S A;  5KL5 A;  2EOX A;  2VQF E;  2MC6 A;  2UU9 E;  4F9C B;  2VRD A;  1DGC A;  1YFH A;  5KL7 A;  4WXD A;  2NUG A;  3J81 C;  4R2R A;  3RMP A;  4LF9 E;  2ODR D;  4WFT A;  5AAS A;  2PRT A;  4WXC A;  1ZBT A;  2H36 X;  2EM4 A;  4LU9 A;  4NZV A;  4KHP E;  4X9J A;  4KZS A;  2JPA A;  1T4N A;  4O4K A;  2KON A;  1RMD A;  2JVA A;  3ZOQ B;  4BHB A;  2WBU A;  4FK5 C;  1YYO A;  4L5N C;  2EPR A;  2V83 A;  5A69 A;  3ADJ A;  1HNX E;  4F6N A;  2EP3 A;  2VQE E;  4JI2 E;  4JI4 E;  3MHS C;  2L92 A;  2EM8 A;  4AQY E;  1J26 A;  1EH7 A;  4Q35 B;  5AE1 A;  4NXM E;  1HNW E;  2YRM A;  2YT4 A;  3BGH A;  2V8Q B;  2WZO A;  2EOS A;  4ZYH A;  2UXD E;  3IWC A;  3C6M A;  4DV1 E;  2EZ6 A;  4LFB E;  2EQ0 A;  1PJS A;  2I13 A;  1N34 E;  2LO3 A;  4I8O A;  2L3C A;  4RH8 A;  2R1F A;  1P47 A;  1WHN A;  4R03 A;  2V88 A; 
#chains in the Genus database with same CATH homology
 2JOB A;  1HNX E;  3FIG A;  1I94 E;  1PKP A;  4JI0 E;  1HNZ E;  1N36 E;  1N32 E;  3IWD A;  2UUC E;  5BR8 E;  5A2Q C;  4JI3 E;  2L33 A;  5LMN E;  4M30 A;  4DR1 E;  2V85 A;  4X64 E;  3K6Q A;  4F9B B;  4B3M E;  1XNR E;  4X65 E;  4BBY A;  4L8N A;  1YYW A;  2E1M A;  4F54 A;  2LUQ A;  4F9A B;  3JTZ A;  2EWL A;  3VYX A;  3AV0 A;  1EKZ A;  1O0W A;  4DV5 E;  2DIX A;  3KWR A;  3J7Y p;  2L8T A;  2K4V A;  4DUY E;  1XMQ E;  1UIL A;  4X8W A;  4OOG C;  2CPN A;  2DSY A;  2V87 A;  2FV4 B;  2VE7 C;  4BMJ A;  5CFF E;  4YY3 E;  2FTX B;  1XMO E;  4LF4 E;  4JI7 E;  1STU A;  4DR6 E;  4K0K E;  3C4B A;  4BC7 A;  4B3T E;  4DR4 E;  3HQ1 A;  4LF6 E;  1YZ9 A;  3HPZ A;  2DMY A;  4J8Z A;  3HPS A;  4DV6 E;  4B3R E;  2JWO A;  4M0V A;  4LTY A;  2RS6 A;  5FLX C;  3OTO E;  1T4L B;  2FGG A;  2RS7 A;  1RQ0 A;  3J80 C;  3MSW A;  4P78 A;  2B7T A;  4DKK A;  2LUP B;  2N3H A;  2NA2 A;  3T1Y E;  3P1X A;  2VQF E;  2MC6 A;  5AE2 A;  2UU9 E;  2M4I A;  4F9C B;  3JAM C;  3VK6 A;  4JI8 E;  4GKJ E;  3H09 A;  4DR7 E;  1XNQ E;  4TUG A;  3ADI A;  1X49 A;  4YHH E;  4BC9 A;  2G7H A;  3T1H E;  2JY9 A;  2NUG A;  3AUZ A;  3J81 C;  4JI1 E;  1QU6 A;  2LTS A;  2ODR C;  2L2N A;  3RMP A;  4LF9 E;  2ODR D;  3DJW A;  4WSP A;  1FJG E;  1GZ6 A;  2B7V A;  4WFT A;  4TUI A;  3LLH A;  2NUE A;  5AAS A;  1ZBT A;  2H36 X;  1X47 A;  2L6M A;  5IT9 C;  2UUB E;  5DNY A;  4Q28 A;  2LTR A;  4LU9 A;  2L2K B;  2B3T B;  4KHP E;  4KZS A;  5LMU E;  2N3G A;  1WXR A;  1T4N A;  2KON A;  1X48 A;  2LJH A;  2V86 A;  1FKA E;  1N33 E;  2JVA A;  4B3S E;  3ZOQ B;  2V89 A;  4WYQ B;  4DR3 E;  1YYO A;  1HR0 E;  4L5N C;  3J7A G;  2MC5 A;  2V83 A;  2ZM6 E;  5T6J A;  2LE2 A;  3HTX A;  5ADZ A;  4M2Z A;  2F4V E;  3ADJ A;  4X62 E;  4DMI A;  2NUF A;  2B9D A;  1T4O A;  4DV7 E;  2KHX A;  3C4T A;  3OML A;  4DV2 E;  2VQE E;  2LBS B;  2L2M A;  4DV0 E;  1UHZ A;  4JI2 E;  1YYK A;  2M1S A;  3DF6 A;  5AE3 A;  2F8B A;  3F6H A;  2L3J A;  4JI5 E;  1RC7 A;  1ZBQ A;  1IBK E;  2E5L E;  1GQE A;  4JI4 E;  2HHH E;  3IWB A;  2L92 A;  3ADG A;  4X66 E;  3ADL A;  2UUA E;  4AQY E;  2MDR A;  2UXB E;  1J26 A;  2KOU A;  1IBL E;  2RTX A;  3JU0 A;  5AE1 A;  4LF5 E;  2JOX A;  2DB2 A;  4GEQ B;  3LML A;  5F3W A;  4LF8 E;  4NXM E;  1HNW E;  2YZT A;  4NXN E;  2YT4 A;  2UXC E;  4R8O A;  4BCA A;  4P7D A;  3HXL A;  4DR5 E;  4JI6 E;  2V8Q B;  2IHR 1;  2WZO A;  4LFA E;  2LRS A;  4DV3 E;  4DUZ E;  1IBM E;  4LF7 E;  1DI2 A;  2UXD E;  4WPY A;  1WHQ A;  4LFC E;  4BS9 A;  2JR1 A;  3VYY A;  1J5E E;  3IWC A;  2LMZ A;  4DV1 E;  4DV4 E;  4DR2 E;  5LL6 R;  2EZ6 A;  4GKK E;  4LFB E;  2RSM A;  2M7Q A;  1DQ3 A;  4JV5 E;  4OX9 E;  1N34 E;  4I8O A;  2L3C A;  4JYA E;  5IWA E;  2VF1 A;  3F6G A;  1SR9 A;  1WHN A;  4R03 A;  2V88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...