2JWOA

A phd finger motif in the c-terminus of rag2 modulates recombination activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Recombination
molecule keywords V(D)J recombination-activating protein 2
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jwoA01
2V85A 2V89A 2V86A 2JWOA 2V87A 2V83A 2V88A
chains in the Genus database with same CATH superfamily
1PJSA 2UUCE 3THNA 2EOHA 2V86A 1GZ6A 4HEIA 4MLVA 2EJ4A 1WJPA 2NUEA 4L5NC 2YTGA 2EM7A 2JVAA 4BS9A 2LVHA 4JYAE 2EN4A 2CT1A 4M30A 4DKKA 1YYOA 3J7AG 5IWAE 3JTZA 4BHCA 4R2DA 2V85A 2ELYA 4WFTA 3VK6A 3THOB 1DQ3A 5CFFE 1YYKA 1X47A 2LE2A 4R2QA 2YTFA 4DV6E 5KL7A 3VYXA 2EMCA 4M2ZA 4LF4E 2LT7A 2EPPA 2YTJA 4GZNC 1O0WA 1A1JA 5KL4A 1EKZA 1XNQE 1ZBTA 1T4NA 2EMXA 3BIDA 2F4VE 1Z1BA 1EH7A 4N4RB 1ZR9A 3MHSC 3KWRA 4WXCA 5A6AA 3RMPA 1YFHA 2LTRA 1KYQA 2V89A 3EPHA 1PKPA 2YTPA 3KZZA 2M9AA 1RC7A 4X65E 1DI2A 4BCAA 3C4BA 4FK5C 5A6BD 4BC9A 1PJTA 3ECRA 1YZ9A 1BB8A 5LLQA 1UN6B 2LUPB 2EMBA 2YTQA 1N32E 5TSEA 2EM8A 5KL3A 4WX9A 2EOEA 2EM6A 3UK3C 3KZYA 3LMLA 1EH6A 2EOJA 3ZOQB 2CTDA 3ADGA 5LMUE 2EL5A 2EPUA 1QNTA 3HPZA 4X64E 2B7VA 2LJHA 2G7HA 1XNRE 2EN6A 1IQOA 2H36X 1GQEA 4B3ME 2A25A 3MHHC 2WZOA 4R2AA 1X6HA 2HJJA 2V88A 3C6MA 4DMIA 2EMZA 2EM2A 3T1HE 3VYYA 2VQFE 1HNXE 1UHZA 4R03A 2JYAA 4X9JA 5AE2A 4B3RE 3QG5C 2EQ0A 2L2MA 2EPAA 1UBDC 1A1FA 2M7QA 1N3GA 2MDRA 4DV2E 2K4VA 4JI3E 2JOBA 2BB8A 2GHFA 2B9DA 2EL4A 2FV4B 2DMYA 2ZM6E 2EMYA 4Q28A 2B7TA 4F9CB 3BBGA 4IS1C 2UXDE 2YRMA 1A1KA 5KL2A 2EZ6A 2EN1A 1MGTA 3FIGA 4DR1E 4DUYE 2M1SA 2JP9A 4F6MA 1EH8A 1WHQA 3K6QA 2YTNA 4WSPA 2EOOA 1ZBQA 5A69A 5T6JA 3OMLA 2V83A 1HNZE 4BBYA 4X62E 1LLMC 3BGHA 5A6JA 4GEQB 1WHNA 2YU5A 2EOFA 5AC5A 1YSAC 2EM5A 4LFAE 2RS6A 1PDAA 2EMKA 3JAMC 1BBOA 2L2KB 2LTSA 1B69A 2EMGA 2LUQA 1GTKA 2EOZA 5BR8E 2LRSA 4LFCE 4OX9E 2N3HA 1ZU1A 2RSMA 2EPXA 1YYWA 1RMDA 4DUZE 2WCC3 1ZAAC 2ODRC 2EPCA 4JI7E 3TQMA 1JK1A 4JI0E 5A6KA 3J80C 4R2PA 1YUIA 2DSYA 5KL6A 4GKJE 2EM9A 5DNYA 1UILA 2EOIA 2NABA 4JI2E 1TF6A 2FTXB 4ZYEA 2YU8A 4AQYE 2EPNA 2GPIA 2ODRD 2EORA 4IJDA 4DR3E 2D9HA 2K7IA 2L2NA 1HNWE 2EWLA 2I13A 1IMUA 2KHXA 3JU0A 2PRTA 4M0VA 1T4LB 2JWOA 2YSOA 2LMZA 4DV5E 2DRPA 3F6GA 1A1HA 2ENCA 2VE7C 2EN3A 3DJWA 2MC5A 4I8OA 3IWBA 2I9IA 2B3TB 2EN7A 4WXDA 4F9AB 4BMJA 5AC4A 2MKNA 2L6MA 3IWCA 4M9VC 1IBLE 2IHR1 5LMNE 5AE3A 2KONA 1WXRA 2EMWA 2YT4A 4ZYDA 4NHRA 5F3WA 4LF7E 2FGGA 2UU9E 1AAYA 4L8NA 4JI5E 4JI6E 1N34E 3T1YE 2VQEE 2NUFA 2EPLX 4LFBE 1WRJA 2EQ3A 5KL5A 1J26A 2GLIA 4LF8E 4O5GA 2N3GA 1N36E 4TUIA 2EN8A 2UUAE 2ENAA 2V87A 2LBSB 4Q35B 2E5LE 1N33E 2MDGA 1IQSA 1STUA 4NZVA 3ADIA 1SR9A 1RQ0A 2EL6A 2JPAA 1HR0E 1X49A 4O24A 1IBKE 4DV3E 2L92A 1IBME 1BBGA 4R2EA 2EOMA 2RTXA 3C6KA 2ELZA 4NXME 4NXNE 4BC7A 4LTYA 2YTIA 3DF6A 2NA2A 2UXCE 4R2SA 2WBTA 4R8OA 3M99B 3J7Yp 2R1FA 2CSHA 2JR1A 2RSIA 4R2CA 4ZYGA 3ADJA 3P1XA 1T4OA 2E72A 2YRHA 2DMIA 4B3TE 2L33A 4TUGA 2EOSA 3VHTB 1FKAE 2YWQA 4LU9A 4R2RA 1X48A 4F54A 4DR2E 1T39A 2YTDA 1XMOE 4KHPE 4J8ZA 2UXBE 4WSGA 2EM4A 2DGCA 4YHHE 4LF6E 1X6EA 2YTOA 3AV0A 1JK2A 3HQ1A 4OOGC 2MKDA 2LCEA 2E1MA 2EPZA 2L8TA 2V8QB 4DV1E 5LL6R 1KJKA 5ADZA 4KZSA 2EMIA 2WBUA 2EE8A 2F8BA 2ENHA 2EPOA 1TN9A 3EQ1A 5AE1A 1FJGE 1G2FC 2VRDA 2RS7A 4JI4E 2DB2A 5FLXC 1G2DC 4DR6E 1L4SA 2EN2A 4RHBB 1AH5A 2EM3A 4YY3E 2LO3A 2RPCA 2EMFA 4X8WA 2MC6A 2DIXA 2L3JA 4X66E 2JY9A 4DR5E 5IXMB 3EPLA 3IWDA 2EPMX 5AASA 3BF2A 4DR4E 2JXPA 1I94E 4F9BB 4DR7E 2YZTA 2HC5A 4ZYHA 1YUJA 2EPKX 4RH8A 2N8XA 5IV8B 2JOXA 2RQLA 1SFEA 4P78A 1NCSA 2YTEA 2EMAA 1T38A 4JI8E 4B3SE 2EQ1A 5IT9C 2DLQA 2EOYA 1X3CA 3L00A 4DV0E 1F2IG 4JV5E 2J7JA 2UUBE 2R76A 5A6BA 2YRKA 1A1GA 2CPNA 2BBGA 1PJQA 1X5WA 4KWYA 3OTOE 3HTXA 2EOXA 1YPNA 1A1LA 3F6HA 4DV4E 1DGCA 4WPYA 1XMQE 2LV2A 2M4IA 4JI1E 4K0KE 4BHBA 4F6NA 2YPNA 2EM0A 2EOQA 2Q8UA 1NEIA 4MLQA 2WBSA 2ADRA 3ADLA 5A2QC 2L3CA 2KOUA 4LF5E 2DLKA 4P7DA 4HTGA 1X6FA 3LLHA 4F2JC 2EP3A 2EMLA 2HHHE 3EPKA 2LJUA 3AUZA 1P47A 1MEYC 2EPRA 2YSPA 3EPJA 4GKKE 3H09A 1J5EE 3HXLA 2VF1A 3MSWA 2EMHA 3HPSA 4WYQB 4LF9E 3J81C 4O4KA 4DV7E 2HGHA 1QU6A 3C4TA 1A1IA 2NUGA 4O43A 1TF3A
chains in the Genus database with same CATH topology
2MDRA 2UUCE 2KONA 1WXRA 2YT4A 4JI4E 2DB2A 2K4VA 5FLXC 4DV2E 4DR6E 2V86A 5F3WA 1GZ6A 4JI3E 2FGGA 2JOBA 2UU9E 4LF7E 4YY3E 4L8NA 2B9DA 4JI5E 4X8WA 4JI6E 1N34E 2NUEA 4L5NC 2FV4B 2DIXA 2MC6A 2L3JA 2DMYA 4X66E 3T1YE 2ZM6E 2VQEE 4Q28A 2NUFA 2JVAA 4LFBE 2B7TA 2JY9A 4BS9A 4F9CB 4DR5E 2UXDE 1J26A 3IWDA 4LF8E 4JYAE 2EZ6A 4M30A 4DKKA 2N3GA 1YYOA 3FIGA 4DR1E 5AASA 5IWAE 3JTZA 4DUYE 3J7AG 4DR4E 2M1SA 1N36E 1I94E 4F9BB 4DR7E 2V85A 2YZTA 4TUIA 4WFTA 3VK6A 2UUAE 1DQ3A 5CFFE 2V87A 1YYKA 2LBSB 2E5LE 1WHQA 1X47A 2LE2A 3K6QA 4WSPA 4DV6E 1N33E 2JOXA 1ZBQA 3VYXA 5T6JA 1STUA 4LF4E 4M2ZA 4P78A 3ADIA 1O0WA 3OMLA 2V83A 1EKZA 1SR9A 1RQ0A 4JI8E 1ZBTA 1T4NA 1HNZE 4B3SE 1HR0E 5IT9C 1XNQE 2F4VE 4BBYA 1X49A 1IBKE 4X62E 4DV3E 2L92A 4GEQB 4DV0E 1WHNA 1IBME 3KWRA 4JV5E 2RTXA 2UUBE 3RMPA 4LFAE 4NXME 2LTRA 4NXNE 2RS6A 2V89A 4BC7A 4LTYA 3DF6A 3JAMC 2L2KB 2CPNA 2LTSA 2NA2A 2UXCE 1PKPA 2LUQA 1RC7A 4R8OA 3HTXA 3OTOE 4X65E 5BR8E 3J7Yp 1DI2A 2LRSA 3F6HA 4BCAA 2JR1A 4DV4E 3C4BA 4LFCE 4OX9E 4WPYA 2N3HA 4BC9A 3ADJA 3P1XA 1XMQE 2M4IA 2RSMA 4JI1E 1T4OA 1YYWA 4DUZE 1YZ9A 4K0KE 4B3TE 2LUPB 2ODRC 4JI7E 4JI0E 1N32E 2L33A 4TUGA 1FKAE 3ADLA 3J80C 4LU9A 5A2QC 1X48A 2DSYA 4F54A 2L3CA 4DR2E 4DV1E 4GKJE 3LMLA 5DNYA 1UILA 4JI2E 2KOUA 4LF5E 2FTXB 3ZOQB 4P7DA 5LMUE 3ADGA 4AQYE 1XMOE 4KHPE 2ODRD 4J8ZA 3HPZA 4X64E 4DR3E 2B7VA 2UXBE 2LJHA 2L2NA 3LLHA 2G7HA 4YHHE 4LF6E 1HNWE 1XNRE 2H36X 2EWLA 2KHXA 1GQEA 3AV0A 3JU0A 4M0VA 1T4LB 2JWOA 2HHHE 4B3ME 3HQ1A 3AUZA 4OOGC 2LMZA 2WZOA 4DV5E 2V88A 4DMIA 3F6GA 2E1MA 4GKKE 2L8TA 3H09A 3T1HE 2V8QB 3VYYA 1J5EE 2VE7C 3HXLA 2VF1A 3DJWA 3MSWA 2VQFE 2MC5A 4I8OA 3IWBA 3HPSA 1UHZA 5LL6R 2B3TB 1HNXE 4R03A 4WYQB 4F9AB 5ADZA 4LF9E 4KZSA 3J81C 5AE2A 2F8BA 4B3RE 4BMJA 2L2MA 2L6MA 4DV7E 3IWCA 5AE1A 1QU6A 1FJGE 3C4TA 1IBLE 2IHR1 2M7QA 5AE3A 5LMNE 2NUGA 2RS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V85 A;  2V89 A;  2V86 A;  2JWO A;  2V87 A;  2V83 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 1PJS A;  2UUC E;  3THN A;  2EOH A;  2V86 A;  1GZ6 A;  4HEI A;  4MLV A;  2EJ4 A;  1WJP A;  2NUE A;  4L5N C;  2YTG A;  2EM7 A;  2JVA A;  4BS9 A;  2LVH A;  4JYA E;  2EN4 A;  2CT1 A;  4M30 A;  4DKK A;  1YYO A;  3J7A G;  5IWA E;  3JTZ A;  4BHC A;  4R2D A;  2V85 A;  2ELY A;  4WFT A;  3VK6 A;  3THO B;  1DQ3 A;  5CFF E;  1YYK A;  1X47 A;  2LE2 A;  4R2Q A;  2YTF A;  4DV6 E;  5KL7 A;  3VYX A;  2EMC A;  4M2Z A;  4LF4 E;  2LT7 A;  2EPP A;  2YTJ A;  4GZN C;  1O0W A;  1A1J A;  5KL4 A;  1EKZ A;  1XNQ E;  1ZBT A;  1T4N A;  2EMX A;  3BID A;  2F4V E;  1Z1B A;  1EH7 A;  4N4R B;  1ZR9 A;  3MHS C;  3KWR A;  4WXC A;  5A6A A;  3RMP A;  1YFH A;  2LTR A;  1KYQ A;  2V89 A;  3EPH A;  1PKP A;  2YTP A;  3KZZ A;  2M9A A;  1RC7 A;  4X65 E;  1DI2 A;  4BCA A;  3C4B A;  4FK5 C;  5A6B D;  4BC9 A;  1PJT A;  3ECR A;  1YZ9 A;  1BB8 A;  5LLQ A;  1UN6 B;  2LUP B;  2EMB A;  2YTQ A;  1N32 E;  5TSE A;  2EM8 A;  5KL3 A;  4WX9 A;  2EOE A;  2EM6 A;  3UK3 C;  3KZY A;  3LML A;  1EH6 A;  2EOJ A;  3ZOQ B;  2CTD A;  3ADG A;  5LMU E;  2EL5 A;  2EPU A;  1QNT A;  3HPZ A;  4X64 E;  2B7V A;  2LJH A;  2G7H A;  1XNR E;  2EN6 A;  1IQO A;  2H36 X;  1GQE A;  4B3M E;  2A25 A;  3MHH C;  2WZO A;  4R2A A;  1X6H A;  2HJJ A;  2V88 A;  3C6M A;  4DMI A;  2EMZ A;  2EM2 A;  3T1H E;  3VYY A;  2VQF E;  1HNX E;  1UHZ A;  4R03 A;  2JYA A;  4X9J A;  5AE2 A;  4B3R E;  3QG5 C;  2EQ0 A;  2L2M A;  2EPA A;  1UBD C;  1A1F A;  2M7Q A;  1N3G A;  2MDR A;  4DV2 E;  2K4V A;  4JI3 E;  2JOB A;  2BB8 A;  2GHF A;  2B9D A;  2EL4 A;  2FV4 B;  2DMY A;  2ZM6 E;  2EMY A;  4Q28 A;  2B7T A;  4F9C B;  3BBG A;  4IS1 C;  2UXD E;  2YRM A;  1A1K A;  5KL2 A;  2EZ6 A;  2EN1 A;  1MGT A;  3FIG A;  4DR1 E;  4DUY E;  2M1S A;  2JP9 A;  4F6M A;  1EH8 A;  1WHQ A;  3K6Q A;  2YTN A;  4WSP A;  2EOO A;  1ZBQ A;  5A69 A;  5T6J A;  3OML A;  2V83 A;  1HNZ E;  4BBY A;  4X62 E;  1LLM C;  3BGH A;  5A6J A;  4GEQ B;  1WHN A;  2YU5 A;  2EOF A;  5AC5 A;  1YSA C;  2EM5 A;  4LFA E;  2RS6 A;  1PDA A;  2EMK A;  3JAM C;  1BBO A;  2L2K B;  2LTS A;  1B69 A;  2EMG A;  2LUQ A;  1GTK A;  2EOZ A;  5BR8 E;  2LRS A;  4LFC E;  4OX9 E;  2N3H A;  1ZU1 A;  2RSM A;  2EPX A;  1YYW A;  1RMD A;  4DUZ E;  2WCC 3;  1ZAA C;  2ODR C;  2EPC A;  4JI7 E;  3TQM A;  1JK1 A;  4JI0 E;  5A6K A;  3J80 C;  4R2P A;  1YUI A;  2DSY A;  5KL6 A;  4GKJ E;  2EM9 A;  5DNY A;  1UIL A;  2EOI A;  2NAB A;  4JI2 E;  1TF6 A;  2FTX B;  4ZYE A;  2YU8 A;  4AQY E;  2EPN A;  2GPI A;  2ODR D;  2EOR A;  4IJD A;  4DR3 E;  2D9H A;  2K7I A;  2L2N A;  1HNW E;  2EWL A;  2I13 A;  1IMU A;  2KHX A;  3JU0 A;  2PRT A;  4M0V A;  1T4L B;  2JWO A;  2YSO A;  2LMZ A;  4DV5 E;  2DRP A;  3F6G A;  1A1H A;  2ENC A;  2VE7 C;  2EN3 A;  3DJW A;  2MC5 A;  4I8O A;  3IWB A;  2I9I A;  2B3T B;  2EN7 A;  4WXD A;  4F9A B;  4BMJ A;  5AC4 A;  2MKN A;  2L6M A;  3IWC A;  4M9V C;  1IBL E;  2IHR 1;  5LMN E;  5AE3 A;  2KON A;  1WXR A;  2EMW A;  2YT4 A;  4ZYD A;  4NHR A;  5F3W A;  4LF7 E;  2FGG A;  2UU9 E;  1AAY A;  4L8N A;  4JI5 E;  4JI6 E;  1N34 E;  3T1Y E;  2VQE E;  2NUF A;  2EPL X;  4LFB E;  1WRJ A;  2EQ3 A;  5KL5 A;  1J26 A;  2GLI A;  4LF8 E;  4O5G A;  2N3G A;  1N36 E;  4TUI A;  2EN8 A;  2UUA E;  2ENA A;  2V87 A;  2LBS B;  4Q35 B;  2E5L E;  1N33 E;  2MDG A;  1IQS A;  1STU A;  4NZV A;  3ADI A;  1SR9 A;  1RQ0 A;  2EL6 A;  2JPA A;  1HR0 E;  1X49 A;  4O24 A;  1IBK E;  4DV3 E;  2L92 A;  1IBM E;  1BBG A;  4R2E A;  2EOM A;  2RTX A;  3C6K A;  2ELZ A;  4NXM E;  4NXN E;  4BC7 A;  4LTY A;  2YTI A;  3DF6 A;  2NA2 A;  2UXC E;  4R2S A;  2WBT A;  4R8O A;  3M99 B;  3J7Y p;  2R1F A;  2CSH A;  2JR1 A;  2RSI A;  4R2C A;  4ZYG A;  3ADJ A;  3P1X A;  1T4O A;  2E72 A;  2YRH A;  2DMI A;  4B3T E;  2L33 A;  4TUG A;  2EOS A;  3VHT B;  1FKA E;  2YWQ A;  4LU9 A;  4R2R A;  1X48 A;  4F54 A;  4DR2 E;  1T39 A;  2YTD A;  1XMO E;  4KHP E;  4J8Z A;  2UXB E;  4WSG A;  2EM4 A;  2DGC A;  4YHH E;  4LF6 E;  1X6E A;  2YTO A;  3AV0 A;  1JK2 A;  3HQ1 A;  4OOG C;  2MKD A;  2LCE A;  2E1M A;  2EPZ A;  2L8T A;  2V8Q B;  4DV1 E;  5LL6 R;  1KJK A;  5ADZ A;  4KZS A;  2EMI A;  2WBU A;  2EE8 A;  2F8B A;  2ENH A;  2EPO A;  1TN9 A;  3EQ1 A;  5AE1 A;  1FJG E;  1G2F C;  2VRD A;  2RS7 A;  4JI4 E;  2DB2 A;  5FLX C;  1G2D C;  4DR6 E;  1L4S A;  2EN2 A;  4RHB B;  1AH5 A;  2EM3 A;  4YY3 E;  2LO3 A;  2RPC A;  2EMF A;  4X8W A;  2MC6 A;  2DIX A;  2L3J A;  4X66 E;  2JY9 A;  4DR5 E;  5IXM B;  3EPL A;  3IWD A;  2EPM X;  5AAS A;  3BF2 A;  4DR4 E;  2JXP A;  1I94 E;  4F9B B;  4DR7 E;  2YZT A;  2HC5 A;  4ZYH A;  1YUJ A;  2EPK X;  4RH8 A;  2N8X A;  5IV8 B;  2JOX A;  2RQL A;  1SFE A;  4P78 A;  1NCS A;  2YTE A;  2EMA A;  1T38 A;  4JI8 E;  4B3S E;  2EQ1 A;  5IT9 C;  2DLQ A;  2EOY A;  1X3C A;  3L00 A;  4DV0 E;  1F2I G;  4JV5 E;  2J7J A;  2UUB E;  2R76 A;  5A6B A;  2YRK A;  1A1G A;  2CPN A;  2BBG A;  1PJQ A;  1X5W A;  4KWY A;  3OTO E;  3HTX A;  2EOX A;  1YPN A;  1A1L A;  3F6H A;  4DV4 E;  1DGC A;  4WPY A;  1XMQ E;  2LV2 A;  2M4I A;  4JI1 E;  4K0K E;  4BHB A;  4F6N A;  2YPN A;  2EM0 A;  2EOQ A;  2Q8U A;  1NEI A;  4MLQ A;  2WBS A;  2ADR A;  3ADL A;  5A2Q C;  2L3C A;  2KOU A;  4LF5 E;  2DLK A;  4P7D A;  4HTG A;  1X6F A;  3LLH A;  4F2J C;  2EP3 A;  2EML A;  2HHH E;  3EPK A;  2LJU A;  3AUZ A;  1P47 A;  1MEY C;  2EPR A;  2YSP A;  3EPJ A;  4GKK E;  3H09 A;  1J5E E;  3HXL A;  2VF1 A;  3MSW A;  2EMH A;  3HPS A;  4WYQ B;  4LF9 E;  3J81 C;  4O4K A;  4DV7 E;  2HGH A;  1QU6 A;  3C4T A;  1A1I A;  2NUG A;  4O43 A;  1TF3 A; 
#chains in the Genus database with same CATH homology
 2MDR A;  2UUC E;  2KON A;  1WXR A;  2YT4 A;  4JI4 E;  2DB2 A;  2K4V A;  5FLX C;  4DV2 E;  4DR6 E;  2V86 A;  5F3W A;  1GZ6 A;  4JI3 E;  2FGG A;  2JOB A;  2UU9 E;  4LF7 E;  4YY3 E;  4L8N A;  2B9D A;  4JI5 E;  4X8W A;  4JI6 E;  1N34 E;  2NUE A;  4L5N C;  2FV4 B;  2DIX A;  2MC6 A;  2L3J A;  2DMY A;  4X66 E;  3T1Y E;  2ZM6 E;  2VQE E;  4Q28 A;  2NUF A;  2JVA A;  4LFB E;  2B7T A;  2JY9 A;  4BS9 A;  4F9C B;  4DR5 E;  2UXD E;  1J26 A;  3IWD A;  4LF8 E;  4JYA E;  2EZ6 A;  4M30 A;  4DKK A;  2N3G A;  1YYO A;  3FIG A;  4DR1 E;  5AAS A;  5IWA E;  3JTZ A;  4DUY E;  3J7A G;  4DR4 E;  2M1S A;  1N36 E;  1I94 E;  4F9B B;  4DR7 E;  2V85 A;  2YZT A;  4TUI A;  4WFT A;  3VK6 A;  2UUA E;  1DQ3 A;  5CFF E;  2V87 A;  1YYK A;  2LBS B;  2E5L E;  1WHQ A;  1X47 A;  2LE2 A;  3K6Q A;  4WSP A;  4DV6 E;  1N33 E;  2JOX A;  1ZBQ A;  3VYX A;  5T6J A;  1STU A;  4LF4 E;  4M2Z A;  4P78 A;  3ADI A;  1O0W A;  3OML A;  2V83 A;  1EKZ A;  1SR9 A;  1RQ0 A;  4JI8 E;  1ZBT A;  1T4N A;  1HNZ E;  4B3S E;  1HR0 E;  5IT9 C;  1XNQ E;  2F4V E;  4BBY A;  1X49 A;  1IBK E;  4X62 E;  4DV3 E;  2L92 A;  4GEQ B;  4DV0 E;  1WHN A;  1IBM E;  3KWR A;  4JV5 E;  2RTX A;  2UUB E;  3RMP A;  4LFA E;  4NXM E;  2LTR A;  4NXN E;  2RS6 A;  2V89 A;  4BC7 A;  4LTY A;  3DF6 A;  3JAM C;  2L2K B;  2CPN A;  2LTS A;  2NA2 A;  2UXC E;  1PKP A;  2LUQ A;  1RC7 A;  4R8O A;  3HTX A;  3OTO E;  4X65 E;  5BR8 E;  3J7Y p;  1DI2 A;  2LRS A;  3F6H A;  4BCA A;  2JR1 A;  4DV4 E;  3C4B A;  4LFC E;  4OX9 E;  4WPY A;  2N3H A;  4BC9 A;  3ADJ A;  3P1X A;  1XMQ E;  2M4I A;  2RSM A;  4JI1 E;  1T4O A;  1YYW A;  4DUZ E;  1YZ9 A;  4K0K E;  4B3T E;  2LUP B;  2ODR C;  4JI7 E;  4JI0 E;  1N32 E;  2L33 A;  4TUG A;  1FKA E;  3ADL A;  3J80 C;  4LU9 A;  5A2Q C;  1X48 A;  2DSY A;  4F54 A;  2L3C A;  4DR2 E;  4DV1 E;  4GKJ E;  3LML A;  5DNY A;  1UIL A;  4JI2 E;  2KOU A;  4LF5 E;  2FTX B;  3ZOQ B;  4P7D A;  5LMU E;  3ADG A;  4AQY E;  1XMO E;  4KHP E;  2ODR D;  4J8Z A;  3HPZ A;  4X64 E;  4DR3 E;  2B7V A;  2UXB E;  2LJH A;  2L2N A;  3LLH A;  2G7H A;  4YHH E;  4LF6 E;  1HNW E;  1XNR E;  2H36 X;  2EWL A;  2KHX A;  1GQE A;  3AV0 A;  3JU0 A;  4M0V A;  1T4L B;  2JWO A;  2HHH E;  4B3M E;  3HQ1 A;  3AUZ A;  4OOG C;  2LMZ A;  2WZO A;  4DV5 E;  2V88 A;  4DMI A;  3F6G A;  2E1M A;  4GKK E;  2L8T A;  3H09 A;  3T1H E;  2V8Q B;  3VYY A;  1J5E E;  2VE7 C;  3HXL A;  2VF1 A;  3DJW A;  3MSW A;  2VQF E;  2MC5 A;  4I8O A;  3IWB A;  3HPS A;  1UHZ A;  5LL6 R;  2B3T B;  1HNX E;  4R03 A;  4WYQ B;  4F9A B;  5ADZ A;  4LF9 E;  4KZS A;  3J81 C;  5AE2 A;  2F8B A;  4B3R E;  4BMJ A;  2L2M A;  2L6M A;  4DV7 E;  3IWC A;  5AE1 A;  1QU6 A;  1FJG E;  3C4T A;  1IBL E;  2IHR 1;  2M7Q A;  5AE3 A;  5LMN E;  2NUG A;  2RS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...