2JWOA

A phd finger motif in the c-terminus of rag2 modulates recombination activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
b'GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords V(D)J recombination-activating protein 2
publication title A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Recombination
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jwoA01
2V86A 2V89A 2V87A 2V83A 2JWOA 2V85A 2V88A
chains in the Genus database with same CATH superfamily
2CT1A 1T38A 4IS1C 3VYXA 1JK2A 4BS9A 1DQ3A 2YTOA 4GKJE 2L2KB 2EMYA 4F2JC 2EOIA 4J8ZA 1N34E 1FKAE 4ZYEA 3IWCA 4P7DA 2LTRA 2LBSB 1YYKA 1X6EA 1A1GA 2MKDA 5KL2A 3EPKA 2EM4A 2GLIA 3P1XA 2EM8A 4LF5E 3KZZA 2A25A 2M9AA 2DSYA 3RMPA 2YTEA 3QG5C 1T4NA 4DUYE 4Q35B 4P78A 5IWAE 1RMDA 3LMLA 2EPLX 2RPCA 2JP9A 2YZTA 2RS6A 2VE7C 4M9VC 1A1KA 2RS7A 4RH8A 4JI2E 1N36E 2DGCA 2UUAE 2EPRA 3THNA 1BB8A 1WHQA 2YTPA 5A6KA 4LF4E 1IBLE 4X64E 5BR8E 2EOOA 2LE2A 2LO3A 2NUGA 2R1FA 2EMZA 5LL6R 5AE2A 4R2PA 2EOFA 1YPNA 4BHBA 5FLXC 1YFHA 3C6KA 2JYAA 2EOQA 2EMXA 2YRHA 2V89A 2DIXA 1UILA 1X6FA 2RSMA 5AE3A 5AC5A 2L2NA 1STUA 1EH8A 2ENHA 4L8NA 2EPMX 2V87A 2DLKA 2EM3A 3K6QA 3F6GA 5AASA 2EWLA 1X6HA 2L3CA 1A1IA 2K4VA 1Z1BA 2N3GA 3M99B 2VQEE 2JXPA 2LUPB 4DR3E 1KJKA 2YTQA 3JAMC 1YSAC 2N3HA 2LRSA 4R2QA 4GZNC 4LFCE 2JPAA 1AH5A 2EOSA 2LCEA 3J7Yp 2EMFA 2YTIA 1ZBQA 1AAYA 2YTNA 4ZYDA 2E1MA 2LVHA 4DKKA 4WX9A 2LJHA 2ELYA 2NA2A 5KL7A 2LT7A 1FJGE 2YPNA 4JV5E 1YYWA 5T6JA 3FIGA 1MGTA 2MDGA 5LLQA 2DMYA 4LU9A 2EM9A 1XMQE 2ODRD 2ENCA 2WCC3 1X49A 2UXBE 4R2CA 2JOXA 2V86A 2H36X 3DJWA 1HNWE 4DMIA 4ZYHA 2BBGA 5IXMB 1GQEA 2E72A 2EOYA 1WXRA 2DLQA 4F6MA 4BMJA 2EMWA 4DR2E 2EOEA 3C4BA 3ZOQB 5A69A 2PRTA 1SFEA 4TUGA 2EMAA 2N8XA 5A6AA 1MEYC 2EL4A 4JI3E 1UN6B 2V85A 1YZ9A 4DV5E 3ADGA 4OOGC 3TQMA 3VYYA 2DB2A 4JI7E 5DNYA 4I8OA 3BBGA 2L33A 4B3TE 1IMUA 2HC5A 4WYQB 1I94E 4RHBB 1NCSA 2CTDA 2EPKX 4B3RE 2EL6A 2ZM6E 4X9JA 4DR7E 4JI5E 1YUIA 2EN6A 2V8QB 1TF6A 2GPIA 4TUIA 2YSOA 2FV4B 1IQSA 1TF3A 2EN7A 5KL4A 4K0KE 1ZR9A 2EOJA 2EMLA 3EQ1A 3T1YE 1BBGA 2VF1A 1A1LA 2EMKA 2EQ0A 4X8WA 1EH6A 2EN2A 4Q28A 3F6HA 4KZSA 2EPZA 4WFTA 2L92A 4KHPE 2IHR1 1N33E 1IBKE 3VHTB 2HJJA 1UHZA 2RTXA 2V88A 3AV0A 1HNXE 2VRDA 4R8OA 2EPCA 3BGHA 1GTKA 4O24A 1F2IG 4JI6E 1L4SA 2EQ1A 1T4LB 1WRJA 1X3CA 2UXCE 2EPOA 3T1HE 1PKPA 2ELZA 4F6NA 2NUFA 4R2EA 3EPJA 4DR1E 2JOBA 4F9AB 4R2DA 1EKZA 4L5NC 1BBOA 4X62E 5CFFE 1ZU1A 4B3SE 3EPHA 2KONA 4LFAE 1KYQA 4BC7A 1NEIA 2DRPA 4MLQA 2M1SA 2HGHA 2KOUA 1X5WA 5LMUE 1N32E 2EM6A 2EN1A 4MLVA 2LTSA 2EORA 4JI4E 2EPUA 2YT4A 3OMLA 1PDAA 3ADJA 2YTFA 4LTYA 5LMNE 5AC4A 1WJPA 1QNTA 2EP3A 3H09A 3AUZA 2EQ3A 2L2MA 2EN3A 2CSHA 3IWBA 2RQLA 1P47A 1A1FA 4BCAA 4WSGA 4DR6E 1A1HA 2EPXA 1T4OA 2BB8A 4DV7E 2EE8A 2JWOA 4F9CB 2YU5A 3J7AG 2EZ6A 4HTGA 2EL5A 2YU8A 1J26A 4JI1E 2EM5A 4X65E 2V83A 4JI0E 1XMOE 2ADRA 2F8BA 5A2QC 5AE1A 4DUZE 2MDRA 2L3JA 1O0WA 2M4IA 2JVAA 2K7IA 2B7VA 2ENAA 4DR5E 2J7JA 2L8TA 2JY9A 4FK5C 1LLMC 4R2SA 2EOHA 2YTJA 4JI8E 2LUQA 2YSPA 3JU0A 4AQYE 2RSIA 2L6MA 2ODRC 2F4VE 2UXDE 1UBDC 2B7TA 1X48A 2NUEA 1HNZE 4NZVA 2EMHA 2B9DA 3J80C 2MC6A 2LMZA 3OTOE 4BBYA 1SR9A 3ADLA 1EH7A 3MHHC 1G2DC 4KWYA 5TSEA 4N4RB 2EPAA 1PJSA 3MHSC 3ADIA 5A6BD 2CPNA 3J81C 2EMCA 1B69A 4LF9E 2UUBE 3C6MA 4DV1E 1PJTA 5A6BA 4YY3E 2YRKA 4DV0E 2WBUA 3MSWA 1RQ0A 1HR0E 2FGGA 4R2RA 4M30A 5KL6A 4M2ZA 1DGCA 4ZYGA 4BHCA 2YTDA 3BF2A 3HXLA 4NXNE 2EN4A 2EOMA 5KL3A 1J5EE 1A1JA 1YUJA 4LF7E 2WZOA 2LV2A 3HPSA 4WXDA 5F3WA 4GKKE 2JR1A 3HQ1A 4YHHE 3KWRA 3L00A 4DV6E 2WBSA 4LF6E 4WSPA 2WBTA 4O4KA 4WXCA 1G2FC 2R76A 2I9IA 5KL5A 4R03A 2UUCE 4LF8E 2YTGA 3VK6A 4JYAE 2KHXA 2EOZA 4DV3E 4WPYA 1RC7A 1IBME 4F54A 1T39A 4F9BB 5IT9C 2HHHE 2MC5A 4O43A 2DMIA 3BIDA 2E5LE 2I13A 4X66E 1ZAAC 2YRMA 2FTXB 2MKNA 2VQFE 2G7HA 1XNQE 1XNRE 3LLHA 3HPZA 2EM7A 4OX9E 4B3ME 1ZBTA 2UU9E 5IV8B 2EPNA 2EJ4A 3KZYA 2EMGA 2YWQA 3IWDA 1TN9A 1YYOA 4HEIA 1QU6A 4O5GA 2EM0A 2EOXA 4M0VA 2NABA 3DF6A 3EPLA 3HTXA 1WHNA 3C4TA 3UK3C 4R2AA 4DR4E 1IQOA 2EMIA 4IJDA 2EM2A 3JTZA 2B3TB 3ECRA 1GZ6A 2EPPA 2EN8A 2Q8UA 4BC9A 3THOB 1PJQA 4GEQB 2D9HA 2GHFA 2M7QA 1X47A 4NXME 4NHRA 1N3GA 2LJUA 5ADZA 4DV4E 2EMBA 1DI2A 5A6JA 4LFBE 1JK1A 4DV2E
chains in the Genus database with same CATH topology
4B3SE 4KHPE 2DMYA 4M30A 4M2ZA 2KONA 4LU9A 4LFAE 3VYXA 1XMQE 4BS9A 1DQ3A 4BC7A 4GKJE 4NXNE 3HXLA 2ODRD 1J5EE 2M1SA 2L2KB 4DV2E 2KOUA 4J8ZA 4LF7E 2WZOA 1N34E 1X49A 1FKAE 5LMUE 2UXBE 3HPSA 3IWCA 5F3WA 2JOXA 2V86A 4P7DA 2LTRA 1N32E 2H36X 3DJWA 2LBSB 1HNWE 2LTSA 4GKKE 4JI4E 4DMIA 1YYKA 2JR1A 1WXRA 1GQEA 2YT4A 3HQ1A 4YHHE 3OMLA 3ADJA 4BMJA 4LTYA 3P1XA 4DR2E 3C4BA 3KWRA 3ZOQB 5LMNE 4LF5E 4DV6E 4TUGA 3H09A 4LF6E 4WSPA 2DSYA 3RMPA 3AUZA 4DUYE 1T4NA 4P78A 5IWAE 4JI3E 3LMLA 2L2MA 2V85A 1YZ9A 3IWBA 4DV5E 2YZTA 2RS6A 2VE7C 3ADGA 4R03A 4OOGC 2UUCE 4LF8E 4BCAA 2RS7A 3VYYA 2DB2A 4JI2E 3VK6A 4JI7E 5DNYA 1N36E 2UUAE 2KHXA 4DR6E 4I8OA 4JYAE 1T4OA 4DV3E 2L33A 4B3TE 4WPYA 4DV7E 1RC7A 1IBME 4WYQB 1WHQA 2JWOA 4F9CB 1I94E 4LF4E 1IBLE 4F54A 4X64E 4B3RE 5BR8E 4F9BB 5IT9C 3J7AG 2HHHE 2MC5A 2LE2A 2EZ6A 2ZM6E 2NUGA 2E5LE 5LL6R 5AE2A 1J26A 4JI1E 4X66E 4DR7E 4JI5E 2V8QB 2FTXB 4TUIA 4X65E 2FV4B 5FLXC 2V83A 2VQFE 2G7HA 4JI0E 1XNQE 1XNRE 2V89A 3LLHA 2DIXA 1XMOE 3HPZA 2F8BA 5A2QC 1UILA 5AE1A 4DUZE 4K0KE 2MDRA 2L3JA 4OX9E 2RSMA 5AE3A 4B3ME 1ZBTA 2UU9E 3T1YE 1O0WA 2L2NA 1STUA 2M4IA 2VF1A 2JVAA 2B7VA 4DR5E 4L8NA 2L8TA 2V87A 4X8WA 2JY9A 3IWDA 4Q28A 3F6HA 4KZSA 1YYOA 1QU6A 1HR0E 4JI8E 3K6QA 3F6GA 4WFTA 2EWLA 2L92A 2IHR1 5AASA 2K4VA 2L3CA 2LUQA 2N3GA 3JU0A 1IBKE 1N33E 4AQYE 4M0VA 3DF6A 1UHZA 2L6MA 2ODRC 2RTXA 2V88A 2VQEE 3AV0A 2LUPB 3HTXA 4DR3E 1HNXE 2F4VE 1WHNA 2B7TA 3C4TA 4DR4E 1X48A 2NUEA 1HNZE 4R8OA 3JAMC 3JTZA 2B9DA 2N3HA 3J80C 2B3TB 1GZ6A 2LMZA 2MC6A 3OTOE 4BBYA 1SR9A 4JI6E 2LRSA 3ADLA 4BC9A 4LFCE 1T4LB 2UXCE 3T1HE 1PKPA 3J7Yp 4GEQB 2M7QA 4NXME 3ADIA 1X47A 2NUFA 2UXDE 1ZBQA 2CPNA 3J81C 4DR1E 5ADZA 4DV4E 4LF9E 2UUBE 2JOBA 4F9AB 4DV1E 2E1MA 1DI2A 4DKKA 2LJHA 4YY3E 1FJGE 2NA2A 1EKZA 4JV5E 4L5NC 4DV0E 4LFBE 3MSWA 4X62E 1YYWA 5T6JA 3FIGA 1RQ0A 5CFFE 2FGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V86 A;  2V89 A;  2V87 A;  2V83 A;  2JWO A;  2V85 A;  2V88 A; 
#chains in the Genus database with same CATH topology
 2CT1 A;  1T38 A;  4IS1 C;  3VYX A;  1JK2 A;  4BS9 A;  1DQ3 A;  2YTO A;  4GKJ E;  2L2K B;  2EMY A;  4F2J C;  2EOI A;  4J8Z A;  1N34 E;  1FKA E;  4ZYE A;  3IWC A;  4P7D A;  2LTR A;  2LBS B;  1YYK A;  1X6E A;  1A1G A;  2MKD A;  5KL2 A;  3EPK A;  2EM4 A;  2GLI A;  3P1X A;  2EM8 A;  4LF5 E;  3KZZ A;  2A25 A;  2M9A A;  2DSY A;  3RMP A;  2YTE A;  3QG5 C;  1T4N A;  4DUY E;  4Q35 B;  4P78 A;  5IWA E;  1RMD A;  3LML A;  2EPL X;  2RPC A;  2JP9 A;  2YZT A;  2RS6 A;  2VE7 C;  4M9V C;  1A1K A;  2RS7 A;  4RH8 A;  4JI2 E;  1N36 E;  2DGC A;  2UUA E;  2EPR A;  3THN A;  1BB8 A;  1WHQ A;  2YTP A;  5A6K A;  4LF4 E;  1IBL E;  4X64 E;  5BR8 E;  2EOO A;  2LE2 A;  2LO3 A;  2NUG A;  2R1F A;  2EMZ A;  5LL6 R;  5AE2 A;  4R2P A;  2EOF A;  1YPN A;  4BHB A;  5FLX C;  1YFH A;  3C6K A;  2JYA A;  2EOQ A;  2EMX A;  2YRH A;  2V89 A;  2DIX A;  1UIL A;  1X6F A;  2RSM A;  5AE3 A;  5AC5 A;  2L2N A;  1STU A;  1EH8 A;  2ENH A;  4L8N A;  2EPM X;  2V87 A;  2DLK A;  2EM3 A;  3K6Q A;  3F6G A;  5AAS A;  2EWL A;  1X6H A;  2L3C A;  1A1I A;  2K4V A;  1Z1B A;  2N3G A;  3M99 B;  2VQE E;  2JXP A;  2LUP B;  4DR3 E;  1KJK A;  2YTQ A;  3JAM C;  1YSA C;  2N3H A;  2LRS A;  4R2Q A;  4GZN C;  4LFC E;  2JPA A;  1AH5 A;  2EOS A;  2LCE A;  3J7Y p;  2EMF A;  2YTI A;  1ZBQ A;  1AAY A;  2YTN A;  4ZYD A;  2E1M A;  2LVH A;  4DKK A;  4WX9 A;  2LJH A;  2ELY A;  2NA2 A;  5KL7 A;  2LT7 A;  1FJG E;  2YPN A;  4JV5 E;  1YYW A;  5T6J A;  3FIG A;  1MGT A;  2MDG A;  5LLQ A;  2DMY A;  4LU9 A;  2EM9 A;  1XMQ E;  2ODR D;  2ENC A;  2WCC 3;  1X49 A;  2UXB E;  4R2C A;  2JOX A;  2V86 A;  2H36 X;  3DJW A;  1HNW E;  4DMI A;  4ZYH A;  2BBG A;  5IXM B;  1GQE A;  2E72 A;  2EOY A;  1WXR A;  2DLQ A;  4F6M A;  4BMJ A;  2EMW A;  4DR2 E;  2EOE A;  3C4B A;  3ZOQ B;  5A69 A;  2PRT A;  1SFE A;  4TUG A;  2EMA A;  2N8X A;  5A6A A;  1MEY C;  2EL4 A;  4JI3 E;  1UN6 B;  2V85 A;  1YZ9 A;  4DV5 E;  3ADG A;  4OOG C;  3TQM A;  3VYY A;  2DB2 A;  4JI7 E;  5DNY A;  4I8O A;  3BBG A;  2L33 A;  4B3T E;  1IMU A;  2HC5 A;  4WYQ B;  1I94 E;  4RHB B;  1NCS A;  2CTD A;  2EPK X;  4B3R E;  2EL6 A;  2ZM6 E;  4X9J A;  4DR7 E;  4JI5 E;  1YUI A;  2EN6 A;  2V8Q B;  1TF6 A;  2GPI A;  4TUI A;  2YSO A;  2FV4 B;  1IQS A;  1TF3 A;  2EN7 A;  5KL4 A;  4K0K E;  1ZR9 A;  2EOJ A;  2EML A;  3EQ1 A;  3T1Y E;  1BBG A;  2VF1 A;  1A1L A;  2EMK A;  2EQ0 A;  4X8W A;  1EH6 A;  2EN2 A;  4Q28 A;  3F6H A;  4KZS A;  2EPZ A;  4WFT A;  2L92 A;  4KHP E;  2IHR 1;  1N33 E;  1IBK E;  3VHT B;  2HJJ A;  1UHZ A;  2RTX A;  2V88 A;  3AV0 A;  1HNX E;  2VRD A;  4R8O A;  2EPC A;  3BGH A;  1GTK A;  4O24 A;  1F2I G;  4JI6 E;  1L4S A;  2EQ1 A;  1T4L B;  1WRJ A;  1X3C A;  2UXC E;  2EPO A;  3T1H E;  1PKP A;  2ELZ A;  4F6N A;  2NUF A;  4R2E A;  3EPJ A;  4DR1 E;  2JOB A;  4F9A B;  4R2D A;  1EKZ A;  4L5N C;  1BBO A;  4X62 E;  5CFF E;  1ZU1 A;  4B3S E;  3EPH A;  2KON A;  4LFA E;  1KYQ A;  4BC7 A;  1NEI A;  2DRP A;  4MLQ A;  2M1S A;  2HGH A;  2KOU A;  1X5W A;  5LMU E;  1N32 E;  2EM6 A;  2EN1 A;  4MLV A;  2LTS A;  2EOR A;  4JI4 E;  2EPU A;  2YT4 A;  3OML A;  1PDA A;  3ADJ A;  2YTF A;  4LTY A;  5LMN E;  5AC4 A;  1WJP A;  1QNT A;  2EP3 A;  3H09 A;  3AUZ A;  2EQ3 A;  2L2M A;  2EN3 A;  2CSH A;  3IWB A;  2RQL A;  1P47 A;  1A1F A;  4BCA A;  4WSG A;  4DR6 E;  1A1H A;  2EPX A;  1T4O A;  2BB8 A;  4DV7 E;  2EE8 A;  2JWO A;  4F9C B;  2YU5 A;  3J7A G;  2EZ6 A;  4HTG A;  2EL5 A;  2YU8 A;  1J26 A;  4JI1 E;  2EM5 A;  4X65 E;  2V83 A;  4JI0 E;  1XMO E;  2ADR A;  2F8B A;  5A2Q C;  5AE1 A;  4DUZ E;  2MDR A;  2L3J A;  1O0W A;  2M4I A;  2JVA A;  2K7I A;  2B7V A;  2ENA A;  4DR5 E;  2J7J A;  2L8T A;  2JY9 A;  4FK5 C;  1LLM C;  4R2S A;  2EOH A;  2YTJ A;  4JI8 E;  2LUQ A;  2YSP A;  3JU0 A;  4AQY E;  2RSI A;  2L6M A;  2ODR C;  2F4V E;  2UXD E;  1UBD C;  2B7T A;  1X48 A;  2NUE A;  1HNZ E;  4NZV A;  2EMH A;  2B9D A;  3J80 C;  2MC6 A;  2LMZ A;  3OTO E;  4BBY A;  1SR9 A;  3ADL A;  1EH7 A;  3MHH C;  1G2D C;  4KWY A;  5TSE A;  4N4R B;  2EPA A;  1PJS A;  3MHS C;  3ADI A;  5A6B D;  2CPN A;  3J81 C;  2EMC A;  1B69 A;  4LF9 E;  2UUB E;  3C6M A;  4DV1 E;  1PJT A;  5A6B A;  4YY3 E;  2YRK A;  4DV0 E;  2WBU A;  3MSW A;  1RQ0 A;  1HR0 E;  2FGG A;  4R2R A;  4M30 A;  5KL6 A;  4M2Z A;  1DGC A;  4ZYG A;  4BHC A;  2YTD A;  3BF2 A;  3HXL A;  4NXN E;  2EN4 A;  2EOM A;  5KL3 A;  1J5E E;  1A1J A;  1YUJ A;  4LF7 E;  2WZO A;  2LV2 A;  3HPS A;  4WXD A;  5F3W A;  4GKK E;  2JR1 A;  3HQ1 A;  4YHH E;  3KWR A;  3L00 A;  4DV6 E;  2WBS A;  4LF6 E;  4WSP A;  2WBT A;  4O4K A;  4WXC A;  1G2F C;  2R76 A;  2I9I A;  5KL5 A;  4R03 A;  2UUC E;  4LF8 E;  2YTG A;  3VK6 A;  4JYA E;  2KHX A;  2EOZ A;  4DV3 E;  4WPY A;  1RC7 A;  1IBM E;  4F54 A;  1T39 A;  4F9B B;  5IT9 C;  2HHH E;  2MC5 A;  4O43 A;  2DMI A;  3BID A;  2E5L E;  2I13 A;  4X66 E;  1ZAA C;  2YRM A;  2FTX B;  2MKN A;  2VQF E;  2G7H A;  1XNQ E;  1XNR E;  3LLH A;  3HPZ A;  2EM7 A;  4OX9 E;  4B3M E;  1ZBT A;  2UU9 E;  5IV8 B;  2EPN A;  2EJ4 A;  3KZY A;  2EMG A;  2YWQ A;  3IWD A;  1TN9 A;  1YYO A;  4HEI A;  1QU6 A;  4O5G A;  2EM0 A;  2EOX A;  4M0V A;  2NAB A;  3DF6 A;  3EPL A;  3HTX A;  1WHN A;  3C4T A;  3UK3 C;  4R2A A;  4DR4 E;  1IQO A;  2EMI A;  4IJD A;  2EM2 A;  3JTZ A;  2B3T B;  3ECR A;  1GZ6 A;  2EPP A;  2EN8 A;  2Q8U A;  4BC9 A;  3THO B;  1PJQ A;  4GEQ B;  2D9H A;  2GHF A;  2M7Q A;  1X47 A;  4NXM E;  4NHR A;  1N3G A;  2LJU A;  5ADZ A;  4DV4 E;  2EMB A;  1DI2 A;  5A6J A;  4LFB E;  1JK1 A;  4DV2 E; 
#chains in the Genus database with same CATH homology
 4B3S E;  4KHP E;  2DMY A;  4M30 A;  4M2Z A;  2KON A;  4LU9 A;  4LFA E;  3VYX A;  1XMQ E;  4BS9 A;  1DQ3 A;  4BC7 A;  4GKJ E;  4NXN E;  3HXL A;  2ODR D;  1J5E E;  2M1S A;  2L2K B;  4DV2 E;  2KOU A;  4J8Z A;  4LF7 E;  2WZO A;  1N34 E;  1X49 A;  1FKA E;  5LMU E;  2UXB E;  3HPS A;  3IWC A;  5F3W A;  2JOX A;  2V86 A;  4P7D A;  2LTR A;  1N32 E;  2H36 X;  3DJW A;  2LBS B;  1HNW E;  2LTS A;  4GKK E;  4JI4 E;  4DMI A;  1YYK A;  2JR1 A;  1WXR A;  1GQE A;  2YT4 A;  3HQ1 A;  4YHH E;  3OML A;  3ADJ A;  4BMJ A;  4LTY A;  3P1X A;  4DR2 E;  3C4B A;  3KWR A;  3ZOQ B;  5LMN E;  4LF5 E;  4DV6 E;  4TUG A;  3H09 A;  4LF6 E;  4WSP A;  2DSY A;  3RMP A;  3AUZ A;  4DUY E;  1T4N A;  4P78 A;  5IWA E;  4JI3 E;  3LML A;  2L2M A;  2V85 A;  1YZ9 A;  3IWB A;  4DV5 E;  2YZT A;  2RS6 A;  2VE7 C;  3ADG A;  4R03 A;  4OOG C;  2UUC E;  4LF8 E;  4BCA A;  2RS7 A;  3VYY A;  2DB2 A;  4JI2 E;  3VK6 A;  4JI7 E;  5DNY A;  1N36 E;  2UUA E;  2KHX A;  4DR6 E;  4I8O A;  4JYA E;  1T4O A;  4DV3 E;  2L33 A;  4B3T E;  4WPY A;  4DV7 E;  1RC7 A;  1IBM E;  4WYQ B;  1WHQ A;  2JWO A;  4F9C B;  1I94 E;  4LF4 E;  1IBL E;  4F54 A;  4X64 E;  4B3R E;  5BR8 E;  4F9B B;  5IT9 C;  3J7A G;  2HHH E;  2MC5 A;  2LE2 A;  2EZ6 A;  2ZM6 E;  2NUG A;  2E5L E;  5LL6 R;  5AE2 A;  1J26 A;  4JI1 E;  4X66 E;  4DR7 E;  4JI5 E;  2V8Q B;  2FTX B;  4TUI A;  4X65 E;  2FV4 B;  5FLX C;  2V83 A;  2VQF E;  2G7H A;  4JI0 E;  1XNQ E;  1XNR E;  2V89 A;  3LLH A;  2DIX A;  1XMO E;  3HPZ A;  2F8B A;  5A2Q C;  1UIL A;  5AE1 A;  4DUZ E;  4K0K E;  2MDR A;  2L3J A;  4OX9 E;  2RSM A;  5AE3 A;  4B3M E;  1ZBT A;  2UU9 E;  3T1Y E;  1O0W A;  2L2N A;  1STU A;  2M4I A;  2VF1 A;  2JVA A;  2B7V A;  4DR5 E;  4L8N A;  2L8T A;  2V87 A;  4X8W A;  2JY9 A;  3IWD A;  4Q28 A;  3F6H A;  4KZS A;  1YYO A;  1QU6 A;  1HR0 E;  4JI8 E;  3K6Q A;  3F6G A;  4WFT A;  2EWL A;  2L92 A;  2IHR 1;  5AAS A;  2K4V A;  2L3C A;  2LUQ A;  2N3G A;  3JU0 A;  1IBK E;  1N33 E;  4AQY E;  4M0V A;  3DF6 A;  1UHZ A;  2L6M A;  2ODR C;  2RTX A;  2V88 A;  2VQE E;  3AV0 A;  2LUP B;  3HTX A;  4DR3 E;  1HNX E;  2F4V E;  1WHN A;  2B7T A;  3C4T A;  4DR4 E;  1X48 A;  2NUE A;  1HNZ E;  4R8O A;  3JAM C;  3JTZ A;  2B9D A;  2N3H A;  3J80 C;  2B3T B;  1GZ6 A;  2LMZ A;  2MC6 A;  3OTO E;  4BBY A;  1SR9 A;  4JI6 E;  2LRS A;  3ADL A;  4BC9 A;  4LFC E;  1T4L B;  2UXC E;  3T1H E;  1PKP A;  3J7Y p;  4GEQ B;  2M7Q A;  4NXM E;  3ADI A;  1X47 A;  2NUF A;  2UXD E;  1ZBQ A;  2CPN A;  3J81 C;  4DR1 E;  5ADZ A;  4DV4 E;  4LF9 E;  2UUB E;  2JOB A;  4F9A B;  4DV1 E;  2E1M A;  1DI2 A;  4DKK A;  2LJH A;  4YY3 E;  1FJG E;  2NA2 A;  1EKZ A;  4JV5 E;  4L5N C;  4DV0 E;  4LFB E;  3MSW A;  4X62 E;  1YYW A;  5T6J A;  3FIG A;  1RQ0 A;  5CFF E;  2FGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...