2JWOA

A phd finger motif in the c-terminus of rag2 modulates recombination activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
GPLGSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords V(D)J recombination-activating protein 2
publication title A PHD finger motif in the C terminus of RAG2 modulates recombination activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Recombination
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.290 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2jwoA01
2V88A 2V83A 2JWOA 2V89A 2V86A 2V85A 2V87A
chains in the Genus database with same CATH superfamily
1ZBQA 3UK3C 4DR7E 2FGGA 1EH6A 2V87A 2EN4A 3DF6A 1G2FC 1BB8A 2LMZA 2RPCA 2R76A 4KWYA 4R2AA 4M2ZA 5KL7A 1X6FA 2YU5A 4ZYEA 1I94E 2EMLA 2ENCA 5A69A 4M9VC 2LV2A 3EQ1A 3AV0A 2JY9A 1HNWE 1X5WA 4DV4E 2GPIA 1XMQE 1AAYA 5KL5A 1FKAE 4KHPE 2EZ6A 3EPLA 4WXDA 4J8ZA 3EPHA 2LCEA 5IXMB 5AC5A 2KOUA 2DLQA 1JK1A 1A1GA 4DUZE 3ECRA 2EORA 4R2QA 4LU9A 2EMKA 1ZAAC 4X66E 2EOFA 2EOZA 3LLHA 4Q28A 2EQ1A 4JI4E 1T4OA 4R2RA 3HQ1A 1X6EA 3EPJA 2ODRC 2YRMA 3JAMC 2ZM6E 3J7Yp 5AE3A 4GZNC 4X64E 2UUCE 4NHRA 4YHHE 2R1FA 1IQOA 4P78A 1RQ0A 4WXCA 3T1YE 2DRPA 1A1IA 4DR5E 4JI0E 2EPAA 2NA2A 4R2SA 1RC7A 1YFHA 2KONA 4TUIA 4L8NA 4TUGA 2EPZA 4JI3E 4B3SE 3HXLA 2CSHA 2EMWA 4ZYDA 2EM5A 2LTSA 3TQMA 4DR1E 1GZ6A 3KZZA 2N3GA 2UUBE 5BR8E 2EOIA 2WCC3 2A25A 2M1SA 1YYWA 4DR6E 2EL6A 2M9AA 3JU0A 2DMIA 1PKPA 1MGTA 2EL4A 1DI2A 2M7QA 2YTJA 4BCAA 1T4NA 1XMOE 4M30A 3L00A 5LLQA 5A6KA 1EH7A 2EOMA 4GKKE 3F6GA 3HPZA 4LF6E 2L3CA 1JK2A 2YTPA 2V89A 4BC9A 1AH5A 4WSPA 1QU6A 4X65E 2DGCA 2EQ3A 2E1MA 2DIXA 4ZYGA 1PJQA 1EKZA 1SR9A 2G7HA 2K7IA 3P1XA 2L2KB 2UXDE 4R03A 2BBGA 2L2MA 5AC4A 3H09A 3J80C 1L4SA 4R2DA 3C6MA 5T6JA 2YPNA 2YTNA 2EPRA 2EOSA 2MKNA 2EN2A 2I9IA 2L3JA 2EMCA 4L5NC 1O0WA 4BHCA 5FLXC 2EM2A 1N34E 2YWQA 5A6AA 1KJKA 4MLVA 2EMAA 2N3HA 2MDGA 1UHZA 2EM4A 1YYOA 2B7VA 2YTDA 4DV2E 3EPKA 3VYYA 1P47A 1A1JA 2YTQA 1YZ9A 4ZYHA 4LF7E 4RH8A 2PRTA 1LLMC 4BHBA 5DNYA 3OMLA 2CTDA 2F8BA 4OOGC 2K4VA 2FV4B 3C4TA 5ADZA 1YUIA 2EOEA 2YU8A 2FTXB 2YZTA 2EMZA 1HR0E 3ADJA 1A1FA 1N32E 4NXME 4DR2E 4BS9A 2RSMA 2LJHA 3DJWA 2JPAA 2V88A 1XNRE 5IWAE 2EM3A 2WBSA 4R2EA 2YRHA 3C6KA 2LO3A 1IQSA 1STUA 2B3TB 4LFBE 2YTIA 2NUGA 3VK6A 4F6MA 2I13A 2EJ4A 4IJDA 2E5LE 4LF5E 2EPXA 2YSOA 4O43A 2EMIA 2LBSB 4GKJE 4JYAE 4IS1C 2EN6A 2LRSA 1A1LA 4R2PA 4R2CA 2DLKA 2GHFA 2DMYA 2JOBA 4JI2E 2BB8A 1A1HA 2L6MA 4AQYE 4LFCE 1J5EE 4F9CB 3HPSA 4WX9A 5IT9C 1YUJA 2EPNA 5KL2A 2EPKX 2NUFA 4RHBB 2EPCA 3MHHC 1PJSA 1BBGA 2LUPB 3K6QA 4JI7E 2DB2A 4DUYE 2UU9E 1X3CA 1WHQA 1IBKE 2EOXA 3MHSC 4FK5C 4X9JA 4BMJA 4X62E 3F6HA 5CFFE 4M0VA 2L92A 2RSIA 1G2DC 2V85A 1T38A 2HC5A 1QNTA 3C4BA 1YSAC 2YTGA 4O24A 2L33A 2LUQA 4WYQB 1X49A 3THOB 2EPUA 2L8TA 2UUAE 5KL4A 2Q8UA 3RMPA 4K0KE 4JI8E 2VQEE 2JWOA 1N33E 2B7TA 1X47A 2JYAA 2EN1A 1GTKA 2NABA 1IMUA 2CPNA 2VRDA 1A1KA 5KL6A 3KWRA 2D9HA 2EMXA 4GEQB 4HEIA 2UXBE 2JP9A 5KL3A 2EPLX 4I8OA 2RTXA 5A6JA 4Q35B 1MEYC 4KZSA 2WZOA 1FJGE 1T4LB 2L2NA 2NUEA 3BGHA 2EMBA 3ADGA 3THNA 2EQ0A 4NZVA 3J7AG 1XNQE 1IBME 5LL6R 5A6BA 1NEIA 1X6HA 1UN6B 1DGCA 2EMHA 2MKDA 5LMNE 3IWDA 4WSGA 1WRJA 4DV3E 2RS7A 4B3RE 4OX9E 2JVAA 1ZR9A 4DMIA 3ADLA 4JI1E 4DV1E 2EE8A 2B9DA 2MDRA 4WPYA 4JI5E 2YRKA 4LFAE 2ENAA 4O5GA 2IHR1 4WFTA 1TF3A 2ELYA 3IWCA 2ODRD 2V8QB 2E72A 1PDAA 3QG5C 1PJTA 4R8OA 3JTZA 4F9BB 4LF9E 4DR4E 4HTGA 4F2JC 1UBDC 2EMYA 2RS6A 2LE2A 1N3GA 3BBGA 3ZOQB 5A2QC 2H36X 4BC7A 2EM0A 5F3WA 3HTXA 4B3ME 2HGHA 1ZU1A 3BIDA 2CT1A 2VE7C 1HNZE 2EOYA 4MLQA 2JR1A 1YPNA 2EN8A 1ZBTA 1EH8A 3OTOE 3ADIA 2YSPA 2UXCE 2F4VE 4P7DA 2LVHA 1N36E 4DV6E 3VHTB 2EM8A 1Z1BA 1X48A 2EMFA 4F54A 1WHNA 1RMDA 2LTRA 3BF2A 4LTYA 1GQEA 2EM7A 2EWLA 2JXPA 4DV7E 4N4RB 4X8WA 2KHXA 1WJPA 1YYKA 1HNXE 2MC5A 4DKKA 2YTEA 4DV5E 2V83A 3KZYA 2V86A 1KYQA 2HHHE 2ENHA 3FIGA 4O4KA 1F2IG 3AUZA 5AE1A 2WBTA 2EL5A 2EPPA 3VYXA 2EN7A 3IWBA 4F9AB 2EN3A 2EOJA 1TN9A 2EOQA 4BBYA 2GLIA 2LJUA 2EPOA 4JI6E 5AASA 3T1HE 2J7JA 4DR3E 2M4IA 2N8XA 2EMGA 2MC6A 5AE2A 1J26A 3M99B 2EPMX 2HJJA 3MSWA 4NXNE 2VQFE 5IV8B 5A6BD 2VF1A 2EOHA 2WBUA 4B3TE 2EM9A 1UILA 2YT4A 2LT7A 2ADRA 2YTFA 2EM6A 2EP3A 5TSEA 3LMLA 4YY3E 5LMUE 4LF8E 1B69A 4DV0E 1SFEA 4F6NA 3J81C 1BBOA 2EOOA 2JOXA 1DQ3A 2DSYA 2YTOA 1T39A 1TF6A 1WXRA 4LF4E 4JV5E 1IBLE 2RQLA 2ELZA 1NCSA
chains in the Genus database with same CATH topology
1ZBQA 4DR4E 4DR7E 1YYWA 2DMYA 2FGGA 2JOBA 4JI2E 4DR6E 2L6MA 4AQYE 4LFCE 1J5EE 2RS6A 2V87A 2LE2A 3JU0A 4F9CB 3DF6A 1PKPA 1DI2A 3HPSA 2M7QA 4BCAA 5IT9C 1T4NA 2LMZA 3ZOQB 5A2QC 1XMOE 2H36X 4BC7A 4M30A 4M2ZA 5F3WA 3HTXA 4B3ME 2NUFA 1I94E 4GKKE 3F6GA 2VE7C 1HNZE 3HPZA 2LUPB 2JR1A 4LF6E 1ZBTA 3K6QA 3AV0A 4JI7E 2L3CA 3OTOE 3ADIA 2DB2A 4DUYE 2UXCE 2UU9E 2JY9A 1HNWE 2F4VE 2V89A 4P7DA 4BC9A 1N36E 4DV4E 1XMQE 4KHPE 1WHQA 4WSPA 1QU6A 4X65E 4DV6E 1IBKE 1FKAE 2EZ6A 2E1MA 4BMJA 1X48A 4X62E 2DIXA 4F54A 3F6HA 1WHNA 2LTRA 4LTYA 2L92A 4M0VA 5CFFE 4J8ZA 1GQEA 2V85A 1SR9A 2G7HA 3C4BA 2EWLA 3P1XA 2L2KB 1EKZA 4DV7E 4R03A 2UXDE 2L33A 4X8WA 2KHXA 2LUQA 2L2MA 4WYQB 1YYKA 1HNXE 1X49A 2KOUA 3H09A 3J80C 2MC5A 5T6JA 2L8TA 4DKKA 2UUAE 4DUZE 3RMPA 2L3JA 4DV5E 2V83A 4JI8E 4K0KE 2VQEE 2JWOA 1N33E 4L5NC 2V86A 2B7TA 1O0WA 1X47A 4LU9A 5FLXC 2HHHE 1N34E 2CPNA 3FIGA 4X66E 3KWRA 4GEQB 2N3HA 3AUZA 5AE1A 3LLHA 2UXBE 4Q28A 4JI4E 1UHZA 1T4OA 3VYXA 1YYOA 2B7VA 2RTXA 3HQ1A 3IWBA 4I8OA 4F9AB 4DV2E 2ODRC 4KZSA 4BBYA 3VYYA 2WZOA 1FJGE 1T4LB 2L2NA 3JAMC 2ZM6E 2NUEA 4JI6E 1YZ9A 3J7Yp 5AE3A 5AASA 4LF7E 4X64E 3T1HE 2UUCE 5DNYA 3OMLA 4DR3E 2M4IA 2F8BA 3ADGA 2K4VA 4OOGC 2MC6A 5AE2A 1J26A 4YHHE 3J7AG 3MSWA 2FV4B 3C4TA 5ADZA 1XNQE 4NXNE 1IBME 5LL6R 2VQFE 4P78A 2VF1A 5LMNE 1RQ0A 3IWDA 2FTXB 2YZTA 4DV3E 2RS7A 4B3TE 3T1YE 4B3RE 4OX9E 2JVAA 4DMIA 1HR0E 4DR5E 1UILA 4JI0E 4JI1E 3ADJA 1N32E 2NA2A 2YT4A 4DV1E 3ADLA 4NXME 4DR2E 2B9DA 2MDRA 4BS9A 3LMLA 2RSMA 4WPYA 4YY3E 2LJHA 3DJWA 2V88A 4JI5E 1RC7A 1XNRE 5LMUE 4LFAE 2KONA 4LF8E 4TUIA 5IWAE 4DV0E 4L8NA 2IHR1 4TUGA 4WFTA 3IWCA 4JI3E 3J81C 4B3SE 3HXLA 2ODRD 2V8QB 1STUA 2B3TB 4LFBE 2LTSA 2NUGA 4DR1E 2JOXA 1GZ6A 1DQ3A 3VK6A 1IBLE 2DSYA 2E5LE 2N3GA 4LF5E 1WXRA 4LF4E 2LBSB 2UUBE 4GKJE 5BR8E 4JYAE 4JV5E 2M1SA 3JTZA 4R8OA 4F9BB 4LF9E 2LRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V88 A;  2V83 A;  2JWO A;  2V89 A;  2V86 A;  2V85 A;  2V87 A; 
#chains in the Genus database with same CATH topology
 1ZBQ A;  3UK3 C;  4DR7 E;  2FGG A;  1EH6 A;  2V87 A;  2EN4 A;  3DF6 A;  1G2F C;  1BB8 A;  2LMZ A;  2RPC A;  2R76 A;  4KWY A;  4R2A A;  4M2Z A;  5KL7 A;  1X6F A;  2YU5 A;  4ZYE A;  1I94 E;  2EML A;  2ENC A;  5A69 A;  4M9V C;  2LV2 A;  3EQ1 A;  3AV0 A;  2JY9 A;  1HNW E;  1X5W A;  4DV4 E;  2GPI A;  1XMQ E;  1AAY A;  5KL5 A;  1FKA E;  4KHP E;  2EZ6 A;  3EPL A;  4WXD A;  4J8Z A;  3EPH A;  2LCE A;  5IXM B;  5AC5 A;  2KOU A;  2DLQ A;  1JK1 A;  1A1G A;  4DUZ E;  3ECR A;  2EOR A;  4R2Q A;  4LU9 A;  2EMK A;  1ZAA C;  4X66 E;  2EOF A;  2EOZ A;  3LLH A;  4Q28 A;  2EQ1 A;  4JI4 E;  1T4O A;  4R2R A;  3HQ1 A;  1X6E A;  3EPJ A;  2ODR C;  2YRM A;  3JAM C;  2ZM6 E;  3J7Y p;  5AE3 A;  4GZN C;  4X64 E;  2UUC E;  4NHR A;  4YHH E;  2R1F A;  1IQO A;  4P78 A;  1RQ0 A;  4WXC A;  3T1Y E;  2DRP A;  1A1I A;  4DR5 E;  4JI0 E;  2EPA A;  2NA2 A;  4R2S A;  1RC7 A;  1YFH A;  2KON A;  4TUI A;  4L8N A;  4TUG A;  2EPZ A;  4JI3 E;  4B3S E;  3HXL A;  2CSH A;  2EMW A;  4ZYD A;  2EM5 A;  2LTS A;  3TQM A;  4DR1 E;  1GZ6 A;  3KZZ A;  2N3G A;  2UUB E;  5BR8 E;  2EOI A;  2WCC 3;  2A25 A;  2M1S A;  1YYW A;  4DR6 E;  2EL6 A;  2M9A A;  3JU0 A;  2DMI A;  1PKP A;  1MGT A;  2EL4 A;  1DI2 A;  2M7Q A;  2YTJ A;  4BCA A;  1T4N A;  1XMO E;  4M30 A;  3L00 A;  5LLQ A;  5A6K A;  1EH7 A;  2EOM A;  4GKK E;  3F6G A;  3HPZ A;  4LF6 E;  2L3C A;  1JK2 A;  2YTP A;  2V89 A;  4BC9 A;  1AH5 A;  4WSP A;  1QU6 A;  4X65 E;  2DGC A;  2EQ3 A;  2E1M A;  2DIX A;  4ZYG A;  1PJQ A;  1EKZ A;  1SR9 A;  2G7H A;  2K7I A;  3P1X A;  2L2K B;  2UXD E;  4R03 A;  2BBG A;  2L2M A;  5AC4 A;  3H09 A;  3J80 C;  1L4S A;  4R2D A;  3C6M A;  5T6J A;  2YPN A;  2YTN A;  2EPR A;  2EOS A;  2MKN A;  2EN2 A;  2I9I A;  2L3J A;  2EMC A;  4L5N C;  1O0W A;  4BHC A;  5FLX C;  2EM2 A;  1N34 E;  2YWQ A;  5A6A A;  1KJK A;  4MLV A;  2EMA A;  2N3H A;  2MDG A;  1UHZ A;  2EM4 A;  1YYO A;  2B7V A;  2YTD A;  4DV2 E;  3EPK A;  3VYY A;  1P47 A;  1A1J A;  2YTQ A;  1YZ9 A;  4ZYH A;  4LF7 E;  4RH8 A;  2PRT A;  1LLM C;  4BHB A;  5DNY A;  3OML A;  2CTD A;  2F8B A;  4OOG C;  2K4V A;  2FV4 B;  3C4T A;  5ADZ A;  1YUI A;  2EOE A;  2YU8 A;  2FTX B;  2YZT A;  2EMZ A;  1HR0 E;  3ADJ A;  1A1F A;  1N32 E;  4NXM E;  4DR2 E;  4BS9 A;  2RSM A;  2LJH A;  3DJW A;  2JPA A;  2V88 A;  1XNR E;  5IWA E;  2EM3 A;  2WBS A;  4R2E A;  2YRH A;  3C6K A;  2LO3 A;  1IQS A;  1STU A;  2B3T B;  4LFB E;  2YTI A;  2NUG A;  3VK6 A;  4F6M A;  2I13 A;  2EJ4 A;  4IJD A;  2E5L E;  4LF5 E;  2EPX A;  2YSO A;  4O43 A;  2EMI A;  2LBS B;  4GKJ E;  4JYA E;  4IS1 C;  2EN6 A;  2LRS A;  1A1L A;  4R2P A;  4R2C A;  2DLK A;  2GHF A;  2DMY A;  2JOB A;  4JI2 E;  2BB8 A;  1A1H A;  2L6M A;  4AQY E;  4LFC E;  1J5E E;  4F9C B;  3HPS A;  4WX9 A;  5IT9 C;  1YUJ A;  2EPN A;  5KL2 A;  2EPK X;  2NUF A;  4RHB B;  2EPC A;  3MHH C;  1PJS A;  1BBG A;  2LUP B;  3K6Q A;  4JI7 E;  2DB2 A;  4DUY E;  2UU9 E;  1X3C A;  1WHQ A;  1IBK E;  2EOX A;  3MHS C;  4FK5 C;  4X9J A;  4BMJ A;  4X62 E;  3F6H A;  5CFF E;  4M0V A;  2L92 A;  2RSI A;  1G2D C;  2V85 A;  1T38 A;  2HC5 A;  1QNT A;  3C4B A;  1YSA C;  2YTG A;  4O24 A;  2L33 A;  2LUQ A;  4WYQ B;  1X49 A;  3THO B;  2EPU A;  2L8T A;  2UUA E;  5KL4 A;  2Q8U A;  3RMP A;  4K0K E;  4JI8 E;  2VQE E;  2JWO A;  1N33 E;  2B7T A;  1X47 A;  2JYA A;  2EN1 A;  1GTK A;  2NAB A;  1IMU A;  2CPN A;  2VRD A;  1A1K A;  5KL6 A;  3KWR A;  2D9H A;  2EMX A;  4GEQ B;  4HEI A;  2UXB E;  2JP9 A;  5KL3 A;  2EPL X;  4I8O A;  2RTX A;  5A6J A;  4Q35 B;  1MEY C;  4KZS A;  2WZO A;  1FJG E;  1T4L B;  2L2N A;  2NUE A;  3BGH A;  2EMB A;  3ADG A;  3THN A;  2EQ0 A;  4NZV A;  3J7A G;  1XNQ E;  1IBM E;  5LL6 R;  5A6B A;  1NEI A;  1X6H A;  1UN6 B;  1DGC A;  2EMH A;  2MKD A;  5LMN E;  3IWD A;  4WSG A;  1WRJ A;  4DV3 E;  2RS7 A;  4B3R E;  4OX9 E;  2JVA A;  1ZR9 A;  4DMI A;  3ADL A;  4JI1 E;  4DV1 E;  2EE8 A;  2B9D A;  2MDR A;  4WPY A;  4JI5 E;  2YRK A;  4LFA E;  2ENA A;  4O5G A;  2IHR 1;  4WFT A;  1TF3 A;  2ELY A;  3IWC A;  2ODR D;  2V8Q B;  2E72 A;  1PDA A;  3QG5 C;  1PJT A;  4R8O A;  3JTZ A;  4F9B B;  4LF9 E;  4DR4 E;  4HTG A;  4F2J C;  1UBD C;  2EMY A;  2RS6 A;  2LE2 A;  1N3G A;  3BBG A;  3ZOQ B;  5A2Q C;  2H36 X;  4BC7 A;  2EM0 A;  5F3W A;  3HTX A;  4B3M E;  2HGH A;  1ZU1 A;  3BID A;  2CT1 A;  2VE7 C;  1HNZ E;  2EOY A;  4MLQ A;  2JR1 A;  1YPN A;  2EN8 A;  1ZBT A;  1EH8 A;  3OTO E;  3ADI A;  2YSP A;  2UXC E;  2F4V E;  4P7D A;  2LVH A;  1N36 E;  4DV6 E;  3VHT B;  2EM8 A;  1Z1B A;  1X48 A;  2EMF A;  4F54 A;  1WHN A;  1RMD A;  2LTR A;  3BF2 A;  4LTY A;  1GQE A;  2EM7 A;  2EWL A;  2JXP A;  4DV7 E;  4N4R B;  4X8W A;  2KHX A;  1WJP A;  1YYK A;  1HNX E;  2MC5 A;  4DKK A;  2YTE A;  4DV5 E;  2V83 A;  3KZY A;  2V86 A;  1KYQ A;  2HHH E;  2ENH A;  3FIG A;  4O4K A;  1F2I G;  3AUZ A;  5AE1 A;  2WBT A;  2EL5 A;  2EPP A;  3VYX A;  2EN7 A;  3IWB A;  4F9A B;  2EN3 A;  2EOJ A;  1TN9 A;  2EOQ A;  4BBY A;  2GLI A;  2LJU A;  2EPO A;  4JI6 E;  5AAS A;  3T1H E;  2J7J A;  4DR3 E;  2M4I A;  2N8X A;  2EMG A;  2MC6 A;  5AE2 A;  1J26 A;  3M99 B;  2EPM X;  2HJJ A;  3MSW A;  4NXN E;  2VQF E;  5IV8 B;  5A6B D;  2VF1 A;  2EOH A;  2WBU A;  4B3T E;  2EM9 A;  1UIL A;  2YT4 A;  2LT7 A;  2ADR A;  2YTF A;  2EM6 A;  2EP3 A;  5TSE A;  3LML A;  4YY3 E;  5LMU E;  4LF8 E;  1B69 A;  4DV0 E;  1SFE A;  4F6N A;  3J81 C;  1BBO A;  2EOO A;  2JOX A;  1DQ3 A;  2DSY A;  2YTO A;  1T39 A;  1TF6 A;  1WXR A;  4LF4 E;  4JV5 E;  1IBL E;  2RQL A;  2ELZ A;  1NCS A; 
#chains in the Genus database with same CATH homology
 1ZBQ A;  4DR4 E;  4DR7 E;  1YYW A;  2DMY A;  2FGG A;  2JOB A;  4JI2 E;  4DR6 E;  2L6M A;  4AQY E;  4LFC E;  1J5E E;  2RS6 A;  2V87 A;  2LE2 A;  3JU0 A;  4F9C B;  3DF6 A;  1PKP A;  1DI2 A;  3HPS A;  2M7Q A;  4BCA A;  5IT9 C;  1T4N A;  2LMZ A;  3ZOQ B;  5A2Q C;  1XMO E;  2H36 X;  4BC7 A;  4M30 A;  4M2Z A;  5F3W A;  3HTX A;  4B3M E;  2NUF A;  1I94 E;  4GKK E;  3F6G A;  2VE7 C;  1HNZ E;  3HPZ A;  2LUP B;  2JR1 A;  4LF6 E;  1ZBT A;  3K6Q A;  3AV0 A;  4JI7 E;  2L3C A;  3OTO E;  3ADI A;  2DB2 A;  4DUY E;  2UXC E;  2UU9 E;  2JY9 A;  1HNW E;  2F4V E;  2V89 A;  4P7D A;  4BC9 A;  1N36 E;  4DV4 E;  1XMQ E;  4KHP E;  1WHQ A;  4WSP A;  1QU6 A;  4X65 E;  4DV6 E;  1IBK E;  1FKA E;  2EZ6 A;  2E1M A;  4BMJ A;  1X48 A;  4X62 E;  2DIX A;  4F54 A;  3F6H A;  1WHN A;  2LTR A;  4LTY A;  2L92 A;  4M0V A;  5CFF E;  4J8Z A;  1GQE A;  2V85 A;  1SR9 A;  2G7H A;  3C4B A;  2EWL A;  3P1X A;  2L2K B;  1EKZ A;  4DV7 E;  4R03 A;  2UXD E;  2L33 A;  4X8W A;  2KHX A;  2LUQ A;  2L2M A;  4WYQ B;  1YYK A;  1HNX E;  1X49 A;  2KOU A;  3H09 A;  3J80 C;  2MC5 A;  5T6J A;  2L8T A;  4DKK A;  2UUA E;  4DUZ E;  3RMP A;  2L3J A;  4DV5 E;  2V83 A;  4JI8 E;  4K0K E;  2VQE E;  2JWO A;  1N33 E;  4L5N C;  2V86 A;  2B7T A;  1O0W A;  1X47 A;  4LU9 A;  5FLX C;  2HHH E;  1N34 E;  2CPN A;  3FIG A;  4X66 E;  3KWR A;  4GEQ B;  2N3H A;  3AUZ A;  5AE1 A;  3LLH A;  2UXB E;  4Q28 A;  4JI4 E;  1UHZ A;  1T4O A;  3VYX A;  1YYO A;  2B7V A;  2RTX A;  3HQ1 A;  3IWB A;  4I8O A;  4F9A B;  4DV2 E;  2ODR C;  4KZS A;  4BBY A;  3VYY A;  2WZO A;  1FJG E;  1T4L B;  2L2N A;  3JAM C;  2ZM6 E;  2NUE A;  4JI6 E;  1YZ9 A;  3J7Y p;  5AE3 A;  5AAS A;  4LF7 E;  4X64 E;  3T1H E;  2UUC E;  5DNY A;  3OML A;  4DR3 E;  2M4I A;  2F8B A;  3ADG A;  2K4V A;  4OOG C;  2MC6 A;  5AE2 A;  1J26 A;  4YHH E;  3J7A G;  3MSW A;  2FV4 B;  3C4T A;  5ADZ A;  1XNQ E;  4NXN E;  1IBM E;  5LL6 R;  2VQF E;  4P78 A;  2VF1 A;  5LMN E;  1RQ0 A;  3IWD A;  2FTX B;  2YZT A;  4DV3 E;  2RS7 A;  4B3T E;  3T1Y E;  4B3R E;  4OX9 E;  2JVA A;  4DMI A;  1HR0 E;  4DR5 E;  1UIL A;  4JI0 E;  4JI1 E;  3ADJ A;  1N32 E;  2NA2 A;  2YT4 A;  4DV1 E;  3ADL A;  4NXM E;  4DR2 E;  2B9D A;  2MDR A;  4BS9 A;  3LML A;  2RSM A;  4WPY A;  4YY3 E;  2LJH A;  3DJW A;  2V88 A;  4JI5 E;  1RC7 A;  1XNR E;  5LMU E;  4LFA E;  2KON A;  4LF8 E;  4TUI A;  5IWA E;  4DV0 E;  4L8N A;  2IHR 1;  4TUG A;  4WFT A;  3IWC A;  4JI3 E;  3J81 C;  4B3S E;  3HXL A;  2ODR D;  2V8Q B;  1STU A;  2B3T B;  4LFB E;  2LTS A;  2NUG A;  4DR1 E;  2JOX A;  1GZ6 A;  1DQ3 A;  3VK6 A;  1IBL E;  2DSY A;  2E5L E;  2N3G A;  4LF5 E;  1WXR A;  4LF4 E;  2LBS B;  2UUB E;  4GKJ E;  5BR8 E;  4JYA E;  4JV5 E;  2M1S A;  3JTZ A;  4R8O A;  4F9B B;  4LF9 E;  2LRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...