1DI2A

Crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
MPVGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVETFVETGSGTSKQVAKRVAAEKLLTKFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3')
publication title Molecular basis of double-stranded RNA-protein interactions: structure of a dsRNA-binding domain complexed with dsRNA.
pubmed doi rcsb
source organism Xenopus laevis
total genus 17
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1di2A00
4DKKA 1RC7A 2HHHE 1WHQA 4LF4E 1HNWE 2UUBE 4JI7E 5CFFE 1HR0E 4NXME 4DV2E 1XMOE 2NUEA 2UXCE 1O0WA 1T4NA 3T1YE 2RSMA 3C4TA 4DR7E 1YYOA 2N3HA 2JVAA 2VQFE 2B3TB 4DV0E 1STUA 2LJHA 4X62E 1I94E 2N3GA 1T4LB 2UU9E 4DV1E 4DV5E 2EZ6A 3ADLA 4JI4E 4X66E 3J7Yp 4LF6E 2F4VE 4JI8E 4LF8E 4OOGC 1IBLE 5LMNE 4JI6E 2UXDE 4JI0E 2KHXA 3VYYA 1IBME 4NXNE 4M30A 3HTXA 4DUZE 1FJGE 1QU6A 2DMYA 2ZM6E 2JY9A 1X48A 4YHHE 4DR3E 2B7TA 4DR6E 4LF5E 4JI2E 4DR2E 1WHNA 4DV3E 2DIXA 1XMQE 4JI1E 2E5LE 2MDRA 4LFAE 1J5EE 4DV4E 2L3CA 2VQEE 1PKPA 4GKKE 2RS6A 2UUCE 4M2ZA 4X8WA 4DV6E 4DUYE 2IHR1 1X47A 1UILA 2RS7A 1X49A 1N33E 3VYXA 4AQYE 1YYWA 2RTXA 3T1HE 2LBSB 4DV7E 3OTOE 4X65E 4DR5E 2LRSA 2CPNA 1XNQE 4WFTA 4B3TE 4JI3E 2LUQA 4B3ME 1FKAE 2L3JA 1N36E 2NA2A 4LF9E 1UHZA 2YT4A 2LUPB 5LMUE 4LF7E 3ADGA 1IBKE 4JI5E 4K0KE 4LFBE 1T4OA 5IWAE 4JV5E 2L2NA 2L2KB 4DR1E 2DB2A 1ZBTA 1N34E 2LTSA 2UXBE 2B7VA 4YY3E 4OX9E 1EKZA 2UUAE 1HNXE 2NUFA 2NUGA 1RQ0A 1DI2A 4KHPE 1XNRE 4B3RE 3ADIA 5BR8E 2L2MA 4JYAE 3ADJA 4WYQB 4GKJE 4DR4E 3LLHA 1HNZE 1YYKA 1GQEA 2L33A 1N32E 1YZ9A 2LTRA 4X64E 3P1XA 3C4BA 1J26A 4B3SE 4LFCE
chains in the Genus database with same CATH superfamily
1RC7A 2V85A 2YTNA 1WHQA 2V83A 1HNWE 1ZU1A 5CFFE 1BBGA 2LCEA 4BCAA 2JYAA 1GTKA 2UXCE 2EOMA 4MLQA 3C6KA 2RSMA 5A6KA 2DSYA 2JVAA 4P7DA 4NHRA 4BC9A 4WPYA 2VQFE 2EM0A 2B3TB 2M4IA 1YSAC 4DV0E 1WJPA 1N3GA 1T39A 2YWQA 4DV1E 2KONA 2EMWA 4JI4E 3C6MA 4JI8E 4NZVA 5TSEA 2M9AA 1PJSA 1EH8A 2FTXB 2EOSA 1QNTA 1IBME 2E72A 3EQ1A 2L92A 1GZ6A 2ENHA 2EPZA 2DMYA 3J81C 2JY9A 4YHHE 4DR3E 2WBUA 4R2QA 4DR6E 2YTFA 2LMZA 5KL7A 4WX9A 4F2JC 2EN1A 2K7IA 1F2IG 1XMQE 4JI1E 3J7AG 1J5EE 4O43A 2RPCA 2RS6A 2UUCE 2K4VA 2JOBA 2IHR1 3ZOQB 2RS7A 2YTJA 4R2SA 2EMYA 1YYWA 4WSGA 3T1HE 4M9VC 2V89A 1X5WA 2LRSA 1XNQE 5AC5A 4ZYGA 1FKAE 2YT4A 4L8NA 4N4RB 1DGCA 2EQ0A 2YU5A 4LF7E 2EPCA 3IWBA 2EORA 1EH7A 2EN3A 1WXRA 3EPKA 4K0KE 1T4OA 1PDAA 5IWAE 1G2FC 1YPNA 2L2KB 3HPSA 1ZBTA 2ELZA 2MC6A 3HQ1A 2EL5A 2WBTA 4OX9E 4WSPA 4BMJA 4LTYA 3F6HA 1RQ0A 3THNA 3H09A 4X9JA 4B3RE 2YU8A 3J80C 2EMBA 2HJJA 4WYQB 2LT7A 5KL3A 1X6FA 2EM3A 2DGCA 1YYKA 2EMIA 2FV4B 2ODRD 2L33A 2JP9A 1N32E 4X64E 3P1XA 3C4BA 3EPJA 4B3SE 2N8XA 5F3WA 2UUBE 3HXLA 1IMUA 2EOIA 3AUZA 1UBDC 1T4NA 5DNYA 3T1YE 2NABA 2EQ1A 1YYOA 1TN9A 2EOHA 3KZZA 2EM6A 2BB8A 5IT9C 2LV2A 4KZSA 2LJHA 4X62E 2N3GA 1T4LB 1LLMC 2UU9E 4DV5E 2ADRA 3M99B 2EZ6A 4F9BB 3ADLA 3EPHA 4LF6E 1BBOA 5KL2A 1NCSA 2YRHA 1IBLE 2YRMA 4GZNC 2EWLA 3KZYA 2EN4A 2DMIA 4BS9A 4DUZE 1FJGE 2LO3A 3L00A 1JK1A 1ZAAC 4BBYA 1A1LA 2EN2A 2ZM6E 4F6NA 2DLKA 2B7TA 2L6MA 2JOXA 3MHHC 2EOOA 2JXPA 4P78A 4RHBB 4JI2E 2JR1A 4DV3E 5AE1A 2DIXA 5A6BD 2EL4A 2L8TA 2YTGA 2EMFA 3VHTB 4M2ZA 4X8WA 4DV6E 2CSHA 3F6GA 2WCC3 1KJKA 1T38A 1A1GA 1N33E 1NEIA 1G2DC 2RTXA 4DV7E 3OTOE 4O5GA 5AC4A 4BHBA 4JI3E 4B3TE 4TUGA 2V88A 3KWRA 5A69A 2NA2A 2EOYA 5LLQA 1IBKE 3THOB 4LFBE 3TQMA 2EPPA 5IXMB 1A1HA 3BGHA 2YSPA 4Q28A 4TUIA 1N34E 1TF3A 2LTSA 4IJDA 2CTDA 4F6MA 1EKZA 2EPRA 2EN8A 1HNXE 2EOJA 4HEIA 4Q35B 2NUGA 2YTOA 1IQSA 3EPLA 4KHPE 4ZYEA 2WZOA 2YTEA 3K6QA 1X6HA 2EJ4A 4R03A 1DQ3A 4BC7A 1Z1BA 1B69A 4LU9A 1GQEA 1HNZE 2EPLX 2V87A 2EM5A 4J8ZA 1A1JA 2HHHE 2MKDA 2EP3A 1SFEA 4JI7E 2D9HA 4HTGA 4NXME 1XMOE 3BF2A 2NUEA 3IWDA 3BIDA 2CT1A 2MDGA 3ECRA 5T6JA 1ZR9A 3FIGA 2VRDA 2EM2A 2A25A 2HGHA 4BHCA 2EPMX 2YTDA 2H36X 1STUA 4RH8A 2EQ3A 2EMCA 4I8OA 1A1KA 2LJUA 4L5NC 2F4VE 4OOGC 2MC5A 2YRKA 2EOEA 2WBSA 2B9DA 2EOZA 2EOXA 2UXDE 2MKNA 4JI0E 4R2PA 4NXNE 2EMHA 3HTXA 5KL5A 3JU0A 2G7HA 2EOQA 5KL4A 2GPIA 2EOFA 2EN7A 4IS1C 4DR2E 3JAMC 3MSWA 2EM9A 4R2RA 2YZTA 2E5LE 2MDRA 3RMPA 2LVHA 2L3CA 4GKKE 4O4KA 2EPUA 1X47A 1UILA 2DLQA 2YTPA 1X49A 3VYXA 4AQYE 2R1FA 4DR5E 4R2EA 3IWCA 4R8OA 2EMKA 2LUQA 4FK5C 4B3ME 2L3JA 4LF9E 1UHZA 5LMUE 1KYQA 2EE8A 2ENAA 3JTZA 3LMLA 4JV5E 1L4SA 2YSOA 4DR1E 2DB2A 5AE3A 2UXBE 2FGGA 2EMZA 5A6BA 5FLXC 2PRTA 2NUFA 1DI2A 1XNRE 5A6AA 4KWYA 2BBGA 2VE7C 3ADIA 5BR8E 2L2MA 4JYAE 2EMGA 3ADJA 4DMIA 2JPAA 3LLHA 2EM4A 2EPKX 1MGTA 1YZ9A 2LTRA 1ZBQA 2VF1A 1EH6A 1J26A 4DKKA 4LF4E 4WXDA 1HR0E 4DV2E 4GEQB 2YPNA 3DJWA 4M0VA 1P47A 1O0WA 5A6JA 2ELYA 3C4TA 4DR7E 3VK6A 2N3HA 2R76A 3HPZA 2Q8UA 1I94E 2DRPA 2LE2A 4X66E 3J7Yp 3OMLA 1BB8A 4LF8E 2EM8A 2EL6A 1X3CA 5LMNE 5AASA 5KL6A 4ZYHA 1A1IA 4JI6E 4F9CB 1PJTA 5IV8B 2KHXA 3VYYA 2E1MA 4M30A 1SR9A 5AE2A 1YUJA 1QU6A 2EPAA 2KOUA 1X48A 2YTQA 2EMAA 1AAYA 3UK3C 2EPOA 2HC5A 4LF5E 1WHNA 1YUIA 1RMDA 1WRJA 4LFAE 4R2DA 2YTIA 2M1SA 4DV4E 2VQEE 1PKPA 1TF6A 2J7JA 1X6EA 4DUYE 5LL6R 4ZYDA 2EPNA 4R2AA 3AV0A 2LBSB 2EN6A 2JWOA 4X65E 2CPNA 4WFTA 4F9AB 1N36E 4WXCA 2ENCA 3BBGA 2LUPB 3ADGA 2V86A 3MHSC 4JI5E 1YFHA 4MLVA 2EMXA 2L2NA 3DF6A 2EMLA 1IQOA 4R2CA 5ADZA 2B7VA 4YY3E 4O24A 2M7QA 2UUAE 2V8QB 4F54A 1JK2A 2RSIA 5A2QC 1A1FA 2RQLA 1PJQA 1AH5A 2I9IA 2F8BA 1MEYC 3QG5C 2ODRC 2GLIA 2I13A 2EPXA 4GKJE 2EM7A 4DR4E 2GHFA 1UN6B 4LFCE
chains in the Genus database with same CATH topology
4DKKA 1RC7A 2HHHE 2V85A 1WHQA 4LF4E 2V83A 1HNWE 5F3WA 2UUBE 4JI7E 5CFFE 1HR0E 3HXLA 4DV2E 4NXME 4GEQB 4BCAA 1XMOE 2NUEA 3AUZA 3DJWA 2UXCE 3IWDA 4M0VA 1O0WA 1T4NA 5DNYA 5T6JA 3T1YE 2RSMA 3C4TA 4DR7E 3VK6A 1YYOA 2N3HA 3FIGA 2DSYA 2JVAA 4P7DA 4BC9A 3HPZA 4WPYA 2VQFE 2B3TB 2M4IA 2H36X 5IT9C 4DV0E 1STUA 2LJHA 4KZSA 4X62E 1I94E 2N3GA 1T4LB 4I8OA 2UU9E 4DV1E 2KONA 2LE2A 4DV5E 4F9BB 4X66E 3J7Yp 4L5NC 4JI4E 3OMLA 4LF6E 3ADLA 4JI8E 4LF8E 2F4VE 4OOGC 2MC5A 1IBLE 5LMNE 5AASA 2EWLA 2B9DA 2FTXB 4JI6E 4F9CB 2UXDE 4JI0E 2KHXA 4BS9A 3VYYA 1IBME 4NXNE 2E1MA 4M30A 2L92A 3HTXA 1SR9A 1GZ6A 4DUZE 1FJGE 3JU0A 2G7HA 5AE2A 4BBYA 1QU6A 2DMYA 3J81C 2KOUA 2JY9A 1X48A 2ZM6E 4YHHE 4DR3E 2B7TA 2L6MA 2JOXA 4DR6E 2LMZA 4P78A 4LF5E 4JI2E 2JR1A 4DR2E 1WHNA 3JAMC 3MSWA 2YZTA 4DV3E 5AE1A 2DIXA 1XMQE 4JI1E 2E5LE 2MDRA 3J7AG 4LFAE 3RMPA 1J5EE 4DV4E 2L3CA 2M1SA 2VQEE 1PKPA 2L8TA 4GKKE 2RS6A 2UUCE 4M2ZA 4X8WA 4DV6E 2K4VA 2JOBA 3F6GA 4DUYE 2IHR1 3ZOQB 1X47A 3C4BA 1UILA 2RS7A 5LL6R 1X49A 1N33E 3VYXA 4AQYE 1YYWA 2RTXA 3T1HE 3AV0A 2V89A 4DV7E 3OTOE 2LBSB 2JWOA 4X65E 2LRSA 4DR5E 2CPNA 1XNQE 3IWCA 4R8OA 4WFTA 2LUQA 4TUGA 4B3TE 2V88A 4B3ME 4JI3E 4F9AB 3KWRA 2L3JA 1N36E 1FKAE 2NA2A 4LF9E 1UHZA 2YT4A 4L8NA 2LUPB 5LMUE 4LF7E 3IWBA 3ADGA 2V86A 1WXRA 1IBKE 4JI5E 4K0KE 4LFBE 1T4OA 3JTZA 5IWAE 3DF6A 2L2NA 3LMLA 2L2KB 4JV5E 4DR1E 2DB2A 3HPSA 4Q28A 4TUIA 1ZBTA 1N34E 5AE3A 2LTSA 5ADZA 2B7VA 2MC6A 4YY3E 2UXBE 2FGGA 3HQ1A 2M7QA 4OX9E 1EKZA 2V8QB 4WSPA 4BMJA 2UUAE 4F54A 1HNXE 5FLXC 2EZ6A 2NUFA 4LTYA 3F6HA 2NUGA 1RQ0A 5A2QC 1DI2A 3H09A 1XNRE 4KHPE 2WZOA 4B3RE 3K6QA 2VE7C 2F8BA 3J80C 3ADIA 5BR8E 2L2MA 4JYAE 3ADJA 2ODRC 4R03A 4DMIA 4WYQB 1DQ3A 4GKJE 4DR4E 4BC7A 3LLHA 2FV4B 1HNZE 4LU9A 1GQEA 2ODRD 1YYKA 2L33A 2V87A 1N32E 1YZ9A 2LTRA 4X64E 1ZBQA 2VF1A 3P1XA 4J8ZA 1J26A 4B3SE 4LFCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKK A;  1RC7 A;  2HHH E;  1WHQ A;  4LF4 E;  1HNW E;  2UUB E;  4JI7 E;  5CFF E;  1HR0 E;  4NXM E;  4DV2 E;  1XMO E;  2NUE A;  2UXC E;  1O0W A;  1T4N A;  3T1Y E;  2RSM A;  3C4T A;  4DR7 E;  1YYO A;  2N3H A;  2JVA A;  2VQF E;  2B3T B;  4DV0 E;  1STU A;  2LJH A;  4X62 E;  1I94 E;  2N3G A;  1T4L B;  2UU9 E;  4DV1 E;  4DV5 E;  2EZ6 A;  3ADL A;  4JI4 E;  4X66 E;  3J7Y p;  4LF6 E;  2F4V E;  4JI8 E;  4LF8 E;  4OOG C;  1IBL E;  5LMN E;  4JI6 E;  2UXD E;  4JI0 E;  2KHX A;  3VYY A;  1IBM E;  4NXN E;  4M30 A;  3HTX A;  4DUZ E;  1FJG E;  1QU6 A;  2DMY A;  2ZM6 E;  2JY9 A;  1X48 A;  4YHH E;  4DR3 E;  2B7T A;  4DR6 E;  4LF5 E;  4JI2 E;  4DR2 E;  1WHN A;  4DV3 E;  2DIX A;  1XMQ E;  4JI1 E;  2E5L E;  2MDR A;  4LFA E;  1J5E E;  4DV4 E;  2L3C A;  2VQE E;  1PKP A;  4GKK E;  2RS6 A;  2UUC E;  4M2Z A;  4X8W A;  4DV6 E;  4DUY E;  2IHR 1;  1X47 A;  1UIL A;  2RS7 A;  1X49 A;  1N33 E;  3VYX A;  4AQY E;  1YYW A;  2RTX A;  3T1H E;  2LBS B;  4DV7 E;  3OTO E;  4X65 E;  4DR5 E;  2LRS A;  2CPN A;  1XNQ E;  4WFT A;  4B3T E;  4JI3 E;  2LUQ A;  4B3M E;  1FKA E;  2L3J A;  1N36 E;  2NA2 A;  4LF9 E;  1UHZ A;  2YT4 A;  2LUP B;  5LMU E;  4LF7 E;  3ADG A;  1IBK E;  4JI5 E;  4K0K E;  4LFB E;  1T4O A;  5IWA E;  4JV5 E;  2L2N A;  2L2K B;  4DR1 E;  2DB2 A;  1ZBT A;  1N34 E;  2LTS A;  2UXB E;  2B7V A;  4YY3 E;  4OX9 E;  1EKZ A;  2UUA E;  1HNX E;  2NUF A;  2NUG A;  1RQ0 A;  1DI2 A;  4KHP E;  1XNR E;  4B3R E;  3ADI A;  5BR8 E;  2L2M A;  4JYA E;  3ADJ A;  4WYQ B;  4GKJ E;  4DR4 E;  3LLH A;  1HNZ E;  1YYK A;  1GQE A;  2L33 A;  1N32 E;  1YZ9 A;  2LTR A;  4X64 E;  3P1X A;  3C4B A;  1J26 A;  4B3S E;  4LFC E; 
#chains in the Genus database with same CATH topology
 1RC7 A;  2V85 A;  2YTN A;  1WHQ A;  2V83 A;  1HNW E;  1ZU1 A;  5CFF E;  1BBG A;  2LCE A;  4BCA A;  2JYA A;  1GTK A;  2UXC E;  2EOM A;  4MLQ A;  3C6K A;  2RSM A;  5A6K A;  2DSY A;  2JVA A;  4P7D A;  4NHR A;  4BC9 A;  4WPY A;  2VQF E;  2EM0 A;  2B3T B;  2M4I A;  1YSA C;  4DV0 E;  1WJP A;  1N3G A;  1T39 A;  2YWQ A;  4DV1 E;  2KON A;  2EMW A;  4JI4 E;  3C6M A;  4JI8 E;  4NZV A;  5TSE A;  2M9A A;  1PJS A;  1EH8 A;  2FTX B;  2EOS A;  1QNT A;  1IBM E;  2E72 A;  3EQ1 A;  2L92 A;  1GZ6 A;  2ENH A;  2EPZ A;  2DMY A;  3J81 C;  2JY9 A;  4YHH E;  4DR3 E;  2WBU A;  4R2Q A;  4DR6 E;  2YTF A;  2LMZ A;  5KL7 A;  4WX9 A;  4F2J C;  2EN1 A;  2K7I A;  1F2I G;  1XMQ E;  4JI1 E;  3J7A G;  1J5E E;  4O43 A;  2RPC A;  2RS6 A;  2UUC E;  2K4V A;  2JOB A;  2IHR 1;  3ZOQ B;  2RS7 A;  2YTJ A;  4R2S A;  2EMY A;  1YYW A;  4WSG A;  3T1H E;  4M9V C;  2V89 A;  1X5W A;  2LRS A;  1XNQ E;  5AC5 A;  4ZYG A;  1FKA E;  2YT4 A;  4L8N A;  4N4R B;  1DGC A;  2EQ0 A;  2YU5 A;  4LF7 E;  2EPC A;  3IWB A;  2EOR A;  1EH7 A;  2EN3 A;  1WXR A;  3EPK A;  4K0K E;  1T4O A;  1PDA A;  5IWA E;  1G2F C;  1YPN A;  2L2K B;  3HPS A;  1ZBT A;  2ELZ A;  2MC6 A;  3HQ1 A;  2EL5 A;  2WBT A;  4OX9 E;  4WSP A;  4BMJ A;  4LTY A;  3F6H A;  1RQ0 A;  3THN A;  3H09 A;  4X9J A;  4B3R E;  2YU8 A;  3J80 C;  2EMB A;  2HJJ A;  4WYQ B;  2LT7 A;  5KL3 A;  1X6F A;  2EM3 A;  2DGC A;  1YYK A;  2EMI A;  2FV4 B;  2ODR D;  2L33 A;  2JP9 A;  1N32 E;  4X64 E;  3P1X A;  3C4B A;  3EPJ A;  4B3S E;  2N8X A;  5F3W A;  2UUB E;  3HXL A;  1IMU A;  2EOI A;  3AUZ A;  1UBD C;  1T4N A;  5DNY A;  3T1Y E;  2NAB A;  2EQ1 A;  1YYO A;  1TN9 A;  2EOH A;  3KZZ A;  2EM6 A;  2BB8 A;  5IT9 C;  2LV2 A;  4KZS A;  2LJH A;  4X62 E;  2N3G A;  1T4L B;  1LLM C;  2UU9 E;  4DV5 E;  2ADR A;  3M99 B;  2EZ6 A;  4F9B B;  3ADL A;  3EPH A;  4LF6 E;  1BBO A;  5KL2 A;  1NCS A;  2YRH A;  1IBL E;  2YRM A;  4GZN C;  2EWL A;  3KZY A;  2EN4 A;  2DMI A;  4BS9 A;  4DUZ E;  1FJG E;  2LO3 A;  3L00 A;  1JK1 A;  1ZAA C;  4BBY A;  1A1L A;  2EN2 A;  2ZM6 E;  4F6N A;  2DLK A;  2B7T A;  2L6M A;  2JOX A;  3MHH C;  2EOO A;  2JXP A;  4P78 A;  4RHB B;  4JI2 E;  2JR1 A;  4DV3 E;  5AE1 A;  2DIX A;  5A6B D;  2EL4 A;  2L8T A;  2YTG A;  2EMF A;  3VHT B;  4M2Z A;  4X8W A;  4DV6 E;  2CSH A;  3F6G A;  2WCC 3;  1KJK A;  1T38 A;  1A1G A;  1N33 E;  1NEI A;  1G2D C;  2RTX A;  4DV7 E;  3OTO E;  4O5G A;  5AC4 A;  4BHB A;  4JI3 E;  4B3T E;  4TUG A;  2V88 A;  3KWR A;  5A69 A;  2NA2 A;  2EOY A;  5LLQ A;  1IBK E;  3THO B;  4LFB E;  3TQM A;  2EPP A;  5IXM B;  1A1H A;  3BGH A;  2YSP A;  4Q28 A;  4TUI A;  1N34 E;  1TF3 A;  2LTS A;  4IJD A;  2CTD A;  4F6M A;  1EKZ A;  2EPR A;  2EN8 A;  1HNX E;  2EOJ A;  4HEI A;  4Q35 B;  2NUG A;  2YTO A;  1IQS A;  3EPL A;  4KHP E;  4ZYE A;  2WZO A;  2YTE A;  3K6Q A;  1X6H A;  2EJ4 A;  4R03 A;  1DQ3 A;  4BC7 A;  1Z1B A;  1B69 A;  4LU9 A;  1GQE A;  1HNZ E;  2EPL X;  2V87 A;  2EM5 A;  4J8Z A;  1A1J A;  2HHH E;  2MKD A;  2EP3 A;  1SFE A;  4JI7 E;  2D9H A;  4HTG A;  4NXM E;  1XMO E;  3BF2 A;  2NUE A;  3IWD A;  3BID A;  2CT1 A;  2MDG A;  3ECR A;  5T6J A;  1ZR9 A;  3FIG A;  2VRD A;  2EM2 A;  2A25 A;  2HGH A;  4BHC A;  2EPM X;  2YTD A;  2H36 X;  1STU A;  4RH8 A;  2EQ3 A;  2EMC A;  4I8O A;  1A1K A;  2LJU A;  4L5N C;  2F4V E;  4OOG C;  2MC5 A;  2YRK A;  2EOE A;  2WBS A;  2B9D A;  2EOZ A;  2EOX A;  2UXD E;  2MKN A;  4JI0 E;  4R2P A;  4NXN E;  2EMH A;  3HTX A;  5KL5 A;  3JU0 A;  2G7H A;  2EOQ A;  5KL4 A;  2GPI A;  2EOF A;  2EN7 A;  4IS1 C;  4DR2 E;  3JAM C;  3MSW A;  2EM9 A;  4R2R A;  2YZT A;  2E5L E;  2MDR A;  3RMP A;  2LVH A;  2L3C A;  4GKK E;  4O4K A;  2EPU A;  1X47 A;  1UIL A;  2DLQ A;  2YTP A;  1X49 A;  3VYX A;  4AQY E;  2R1F A;  4DR5 E;  4R2E A;  3IWC A;  4R8O A;  2EMK A;  2LUQ A;  4FK5 C;  4B3M E;  2L3J A;  4LF9 E;  1UHZ A;  5LMU E;  1KYQ A;  2EE8 A;  2ENA A;  3JTZ A;  3LML A;  4JV5 E;  1L4S A;  2YSO A;  4DR1 E;  2DB2 A;  5AE3 A;  2UXB E;  2FGG A;  2EMZ A;  5A6B A;  5FLX C;  2PRT A;  2NUF A;  1DI2 A;  1XNR E;  5A6A A;  4KWY A;  2BBG A;  2VE7 C;  3ADI A;  5BR8 E;  2L2M A;  4JYA E;  2EMG A;  3ADJ A;  4DMI A;  2JPA A;  3LLH A;  2EM4 A;  2EPK X;  1MGT A;  1YZ9 A;  2LTR A;  1ZBQ A;  2VF1 A;  1EH6 A;  1J26 A;  4DKK A;  4LF4 E;  4WXD A;  1HR0 E;  4DV2 E;  4GEQ B;  2YPN A;  3DJW A;  4M0V A;  1P47 A;  1O0W A;  5A6J A;  2ELY A;  3C4T A;  4DR7 E;  3VK6 A;  2N3H A;  2R76 A;  3HPZ A;  2Q8U A;  1I94 E;  2DRP A;  2LE2 A;  4X66 E;  3J7Y p;  3OML A;  1BB8 A;  4LF8 E;  2EM8 A;  2EL6 A;  1X3C A;  5LMN E;  5AAS A;  5KL6 A;  4ZYH A;  1A1I A;  4JI6 E;  4F9C B;  1PJT A;  5IV8 B;  2KHX A;  3VYY A;  2E1M A;  4M30 A;  1SR9 A;  5AE2 A;  1YUJ A;  1QU6 A;  2EPA A;  2KOU A;  1X48 A;  2YTQ A;  2EMA A;  1AAY A;  3UK3 C;  2EPO A;  2HC5 A;  4LF5 E;  1WHN A;  1YUI A;  1RMD A;  1WRJ A;  4LFA E;  4R2D A;  2YTI A;  2M1S A;  4DV4 E;  2VQE E;  1PKP A;  1TF6 A;  2J7J A;  1X6E A;  4DUY E;  5LL6 R;  4ZYD A;  2EPN A;  4R2A A;  3AV0 A;  2LBS B;  2EN6 A;  2JWO A;  4X65 E;  2CPN A;  4WFT A;  4F9A B;  1N36 E;  4WXC A;  2ENC A;  3BBG A;  2LUP B;  3ADG A;  2V86 A;  3MHS C;  4JI5 E;  1YFH A;  4MLV A;  2EMX A;  2L2N A;  3DF6 A;  2EML A;  1IQO A;  4R2C A;  5ADZ A;  2B7V A;  4YY3 E;  4O24 A;  2M7Q A;  2UUA E;  2V8Q B;  4F54 A;  1JK2 A;  2RSI A;  5A2Q C;  1A1F A;  2RQL A;  1PJQ A;  1AH5 A;  2I9I A;  2F8B A;  1MEY C;  3QG5 C;  2ODR C;  2GLI A;  2I13 A;  2EPX A;  4GKJ E;  2EM7 A;  4DR4 E;  2GHF A;  1UN6 B;  4LFC E; 
#chains in the Genus database with same CATH homology
 4DKK A;  1RC7 A;  2HHH E;  2V85 A;  1WHQ A;  4LF4 E;  2V83 A;  1HNW E;  5F3W A;  2UUB E;  4JI7 E;  5CFF E;  1HR0 E;  3HXL A;  4DV2 E;  4NXM E;  4GEQ B;  4BCA A;  1XMO E;  2NUE A;  3AUZ A;  3DJW A;  2UXC E;  3IWD A;  4M0V A;  1O0W A;  1T4N A;  5DNY A;  5T6J A;  3T1Y E;  2RSM A;  3C4T A;  4DR7 E;  3VK6 A;  1YYO A;  2N3H A;  3FIG A;  2DSY A;  2JVA A;  4P7D A;  4BC9 A;  3HPZ A;  4WPY A;  2VQF E;  2B3T B;  2M4I A;  2H36 X;  5IT9 C;  4DV0 E;  1STU A;  2LJH A;  4KZS A;  4X62 E;  1I94 E;  2N3G A;  1T4L B;  4I8O A;  2UU9 E;  4DV1 E;  2KON A;  2LE2 A;  4DV5 E;  4F9B B;  4X66 E;  3J7Y p;  4L5N C;  4JI4 E;  3OML A;  4LF6 E;  3ADL A;  4JI8 E;  4LF8 E;  2F4V E;  4OOG C;  2MC5 A;  1IBL E;  5LMN E;  5AAS A;  2EWL A;  2B9D A;  2FTX B;  4JI6 E;  4F9C B;  2UXD E;  4JI0 E;  2KHX A;  4BS9 A;  3VYY A;  1IBM E;  4NXN E;  2E1M A;  4M30 A;  2L92 A;  3HTX A;  1SR9 A;  1GZ6 A;  4DUZ E;  1FJG E;  3JU0 A;  2G7H A;  5AE2 A;  4BBY A;  1QU6 A;  2DMY A;  3J81 C;  2KOU A;  2JY9 A;  1X48 A;  2ZM6 E;  4YHH E;  4DR3 E;  2B7T A;  2L6M A;  2JOX A;  4DR6 E;  2LMZ A;  4P78 A;  4LF5 E;  4JI2 E;  2JR1 A;  4DR2 E;  1WHN A;  3JAM C;  3MSW A;  2YZT A;  4DV3 E;  5AE1 A;  2DIX A;  1XMQ E;  4JI1 E;  2E5L E;  2MDR A;  3J7A G;  4LFA E;  3RMP A;  1J5E E;  4DV4 E;  2L3C A;  2M1S A;  2VQE E;  1PKP A;  2L8T A;  4GKK E;  2RS6 A;  2UUC E;  4M2Z A;  4X8W A;  4DV6 E;  2K4V A;  2JOB A;  3F6G A;  4DUY E;  2IHR 1;  3ZOQ B;  1X47 A;  3C4B A;  1UIL A;  2RS7 A;  5LL6 R;  1X49 A;  1N33 E;  3VYX A;  4AQY E;  1YYW A;  2RTX A;  3T1H E;  3AV0 A;  2V89 A;  4DV7 E;  3OTO E;  2LBS B;  2JWO A;  4X65 E;  2LRS A;  4DR5 E;  2CPN A;  1XNQ E;  3IWC A;  4R8O A;  4WFT A;  2LUQ A;  4TUG A;  4B3T E;  2V88 A;  4B3M E;  4JI3 E;  4F9A B;  3KWR A;  2L3J A;  1N36 E;  1FKA E;  2NA2 A;  4LF9 E;  1UHZ A;  2YT4 A;  4L8N A;  2LUP B;  5LMU E;  4LF7 E;  3IWB A;  3ADG A;  2V86 A;  1WXR A;  1IBK E;  4JI5 E;  4K0K E;  4LFB E;  1T4O A;  3JTZ A;  5IWA E;  3DF6 A;  2L2N A;  3LML A;  2L2K B;  4JV5 E;  4DR1 E;  2DB2 A;  3HPS A;  4Q28 A;  4TUI A;  1ZBT A;  1N34 E;  5AE3 A;  2LTS A;  5ADZ A;  2B7V A;  2MC6 A;  4YY3 E;  2UXB E;  2FGG A;  3HQ1 A;  2M7Q A;  4OX9 E;  1EKZ A;  2V8Q B;  4WSP A;  4BMJ A;  2UUA E;  4F54 A;  1HNX E;  5FLX C;  2EZ6 A;  2NUF A;  4LTY A;  3F6H A;  2NUG A;  1RQ0 A;  5A2Q C;  1DI2 A;  3H09 A;  1XNR E;  4KHP E;  2WZO A;  4B3R E;  3K6Q A;  2VE7 C;  2F8B A;  3J80 C;  3ADI A;  5BR8 E;  2L2M A;  4JYA E;  3ADJ A;  2ODR C;  4R03 A;  4DMI A;  4WYQ B;  1DQ3 A;  4GKJ E;  4DR4 E;  4BC7 A;  3LLH A;  2FV4 B;  1HNZ E;  4LU9 A;  1GQE A;  2ODR D;  1YYK A;  2L33 A;  2V87 A;  1N32 E;  1YZ9 A;  2LTR A;  4X64 E;  1ZBQ A;  2VF1 A;  3P1X A;  4J8Z A;  1J26 A;  4B3S E;  4LFC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...