1DI2A

Crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
MPVGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVETFVETGSGTSKQVAKRVAAEKLLTKFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(*GP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3')
publication title Molecular basis of double-stranded RNA-protein interactions: structure of a dsRNA-binding domain complexed with dsRNA.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna binding protein/rna
total genus 17
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1di2A00
4JI1E 4DR2E 2N3GA 2UUBE 2YT4A 2LRSA 2RSMA 1RQ0A 3OTOE 4DR4E 1IBLE 1YZ9A 2LJHA 2F4VE 4JYAE 3T1HE 4DR3E 5LMUE 4OOGC 1X48A 4DR6E 4KHPE 4LF8E 1T4LB 1XNQE 3ADIA 4B3ME 4DUZE 2RS6A 1N32E 4LF6E 3P1XA 2UXCE 2MDRA 2L3JA 4JI3E 2LUPB 4B3TE 2E5LE 1J5EE 1FKAE 1HNZE 2L2MA 1GQEA 2RTXA 3ADGA 4B3RE 4LF9E 4LF4E 4WYQB 1PKPA 4DR5E 4DR1E 3T1YE 2EZ6A 5IWAE 4GKKE 1YYOA 1IBKE 2B7VA 4NXNE 1T4OA 1EKZA 2B3TB 4X64E 4OX9E 2LUQA 4B3SE 2UUCE 2RS7A 1XMOE 3VYYA 2B7TA 4JI5E 1N36E 1HNXE 4DV5E 4LF7E 2HHHE 2L33A 2VQFE 3HTXA 2NUEA 1UILA 4LFBE 3C4TA 4DUYE 2NUGA 4LFCE 4LFAE 2DIXA 3VYXA 4X8WA 2L3CA 2JVAA 1HNWE 2UU9E 4M2ZA 2JY9A 1T4NA 2CPNA 1ZBTA 2IHR1 4YY3E 4JI7E 2NUFA 4DV4E 4LF5E 1WHNA 2VQEE 2L2NA 4DV1E 1N33E 4AQYE 2L2KB 1WHQA 2DMYA 4JI8E 2KHXA 2UUAE 2N3HA 3ADLA 1XNRE 2LTSA 2LTRA 4YHHE 1QU6A 2DB2A 3J7Yp 4DV6E 2LBSB 1YYWA 1J26A 5LMNE 4JI4E 4WFTA 4JV5E 4GKJE 4DKKA 5BR8E 1X49A 1IBME 4K0KE 4DR7E 5CFFE 4JI0E 1DI2A 1X47A 1FJGE 2ZM6E 4DV7E 1O0WA 1HR0E 3ADJA 4JI2E 2UXBE 4X62E 1XMQE 1RC7A 4NXME 2UXDE 1YYKA 1N34E 1UHZA 4DV3E 2NA2A 1I94E 4X66E 1STUA 3LLHA 4X65E 4M30A 4DV2E 4JI6E 4DV0E 3C4BA
chains in the Genus database with same CATH superfamily
2UUBE 1EH6A 1WXRA 2LJUA 1RQ0A 2YTPA 4P78A 1YZ9A 3T1HE 5LMUE 3MSWA 4F6MA 4LF8E 2EQ1A 3HPSA 2CTDA 4DUZE 2ENCA 2RS6A 3KWRA 1YUIA 2EN8A 2EQ0A 2JPAA 3P1XA 2K4VA 2LUPB 1N3GA 3F6HA 5KL4A 5KL6A 4BC7A 2EOQA 4B3RE 4LF9E 1PKPA 4DR1E 3JU0A 1Z1BA 4BBYA 1YYOA 1G2FC 2B3TB 2YU8A 4X64E 4R2EA 4O5GA 1XMOE 1X6HA 2V86A 3VYYA 1ZU1A 2EMFA 1PJQA 2HHHE 5AE2A 1YSAC 2NUEA 1UILA 2GHFA 2RQLA 4O4KA 1AH5A 2BB8A 2EMBA 4LFAE 1ZBQA 5ADZA 1X6FA 2GPIA 2DLKA 5A6JA 3J81C 2CPNA 2YRMA 4ZYEA 4DV4E 4LF5E 3QG5C 2L2NA 4BHBA 4NZVA 2EE8A 3J80C 4TUIA 1WHQA 2EMLA 2WBSA 2KHXA 2YTJA 2EMHA 1IMUA 2EM9A 2LV2A 2HC5A 1QU6A 2DB2A 1J26A 5LMNE 2EMAA 4DKKA 2JXPA 2EOYA 2EPMX 2EOOA 1A1FA 5IT9C 2FGGA 2YTIA 2YSOA 1QNTA 2V8QB 2BBGA 4RH8A 3JAMC 1BB8A 3OMLA 3THNA 1HR0E 4X62E 4NXME 1RC7A 2DLQA 2UXDE 5LL6R 4WSPA 4WPYA 1STUA 2EN3A 3HXLA 4DV2E 4JI6E 2EQ3A 2V88A 2N8XA 4DV0E 2LMZA 2A25A 4DR2E 2EN2A 2N3GA 3IWCA 1F2IG 2RSIA 1NEIA 4X9JA 1NCSA 3OTOE 2YSPA 4DR4E 4JYAE 2M1SA 2F4VE 4O43A 2HJJA 2EMKA 4DR3E 3BF2A 2KONA 3DJWA 1XNQE 4KHPE 3ADIA 2EPNA 4LTYA 1BBOA 1J5EE 2L2MA 5A6BA 2RTXA 3LMLA 2JP9A 2EMYA 2EOMA 3MHHC 3F6GA 4M0VA 4LF4E 2M4IA 1KJKA 4R2PA 4DR5E 2EZ6A 2V89A 2RPCA 5IWAE 4BCAA 2YTDA 2B7VA 5A6BD 5A6AA 2DMIA 1A1KA 4B3SE 2UUCE 1ZAAC 2LO3A 2ODRD 4BC9A 4R03A 1N36E 2MDGA 4DV5E 1YUJA 3BGHA 2VQFE 3HTXA 2WBUA 4LFBE 4F9BB 3C4TA 1PJTA 2NUGA 2V87A 5AC4A 4R2AA 2YRKA 1IQSA 2DIXA 3VYXA 1UN6B 2ENAA 2YRHA 5AE1A 2JVAA 2UU9E 2EPCA 1ZBTA 3UK3C 4MLQA 4JI7E 2NUFA 2EN6A 1TF3A 2EM0A 2MC6A 3IWBA 4AQYE 2GLIA 1WRJA 3L00A 3AUZA 2YTFA 4R2SA 2E72A 2KOUA 3K6QA 5IXMB 2UUAE 1XNRE 2B9DA 2LTSA 2YTOA 4YHHE 1AAYA 2EOXA 3J7Yp 1JK1A 4GKJE 3RMPA 3C6KA 4K0KE 4P7DA 2WCC3 2YTEA 4DR7E 2EM7A 5CFFE 4JI0E 1MGTA 1UBDC 4I8OA 1X5WA 3BIDA 2LT7A 3ECRA 1YFHA 4GEQB 1XMQE 2YZTA 2ODRC 1N34E 4Q35B 1UHZA 1G2DC 3VHTB 1I94E 3LLHA 2EL4A 1FJGE 1X6EA 2VE7C 2ADRA 2EMWA 2R76A 2LRSA 2EL6A 4ZYGA 1IBLE 2DGCA 2LJHA 5KL7A 5KL2A 2EN7A 1X48A 2EPZA 4J8ZA 4L5NC 2WZOA 2EMGA 4B3ME 2LCEA 4WXDA 4LF6E 1WJPA 2EOEA 2UXCE 2JYAA 4R2DA 4B3TE 1FKAE 2EPLX 1GQEA 1YPNA 4R2QA 1LLMC 4WYQB 2EM4A 3T1YE 1X3CA 1IBKE 4NXNE 1T4OA 1EKZA 4M9VC 5FLXC 4MLVA 4OX9E 2PRTA 1JK2A 2WBTA 2RS7A 2D9HA 4WSGA 4BS9A 2EPXA 3VK6A 2MKDA 4JI5E 4F9CB 3BBGA 2YTGA 2L33A 2EM8A 2V85A 1BBGA 4TUGA 5AC5A 4DUYE 4LFCE 2LE2A 2F8BA 1A1LA 3DF6A 3HPZA 4HEIA 1A1GA 4F6NA 2LVHA 1DQ3A 1HNWE 4R2CA 2JY9A 1T4NA 3JTZA 2FV4B 4ZYHA 2EOJA 4LU9A 4NHRA 2VQEE 4DV1E 1N33E 2VRDA 2YTNA 2EOIA 2EN1A 2Q8UA 3KZYA 2DMYA 4JI8E 1KYQA 3TQMA 2LTRA 4DV6E 3C6MA 4GZNC 2LBSB 4WFTA 1EH7A 2EOHA 5BR8E 4ZYDA 5T6JA 2EPOA 5KL3A 4IJDA 2YTQA 1EH8A 4KZSA 1DI2A 2EL5A 5DNYA 4JI2E 1A1JA 2EPKX 2EMXA 2EPAA 3ZOQB 4BHCA 5IV8B 2JOBA 4DV3E 1B69A 2NA2A 5AE3A 4N4RB 4X66E 1GZ6A 3KZZA 4JI1E 2EOZA 2K7IA 4R8OA 2YT4A 3EQ1A 1A1HA 3EPJA 2EPUA 2RSMA 5F3WA 2R1FA 1PJSA 2ELZA 2EN4A 3H09A 4OOGC 3EPKA 1A1IA 2EMZA 4DR6E 2DSYA 1T4LB 2EPRA 2EMIA 2EJ4A 1N32E 5TSEA 2EPPA 2FTXB 2JWOA 2MDRA 2L3JA 4JI3E 1PDAA 2E5LE 2G7HA 1HNZE 3ADGA 2E1MA 4WX9A 4GKKE 4F54A 2YWQA 2LUQA 4KWYA 3MHSC 2YU5A 1GTKA 2I9IA 2I13A 2B7TA 1HNXE 4LF7E 1T39A 1TF6A 2ENHA 2VF1A 3M99B 2V83A 4L8NA 3EPLA 2M7QA 4O24A 1L4SA 2L6MA 1P47A 5AASA 1T38A 4X8WA 1SR9A 2L3CA 2EM3A 3HQ1A 2EM6A 5KL5A 4DMIA 4M2ZA 2L92A 1MEYC 5A2QC 2DRPA 2IHR1 1IQOA 3IWDA 4YY3E 4HTGA 1WHNA 2L8TA 2L2KB 4BMJA 1RMDA 2MC5A 4R2RA 2YPNA 2N3HA 3ADLA 3AV0A 2EOFA 4F2JC 1DGCA 2H36X 1YYWA 4JI4E 4JV5E 5LLQA 4IS1C 3EPHA 2EOSA 1X49A 1IBME 3THOB 2EMCA 2EWLA 2EORA 5A69A 1X47A 2CT1A 3FIGA 3J7AG 2JR1A 1TN9A 2NABA 4Q28A 1ZR9A 2ZM6E 4FK5C 4DV7E 1O0WA 2HGHA 3ADJA 2MKNA 2UXBE 2ELYA 1SFEA 2EM5A 4WXCA 2EM2A 2J7JA 1YYKA 2EP3A 2CSHA 4F9AB 4X65E 5A6KA 4M30A 2JOXA 4RHBB 2M9AA 3C4BA
chains in the Genus database with same CATH topology
4JI1E 4DR2E 2VE7C 2N3GA 3IWCA 2UUBE 4R8OA 2YT4A 2LRSA 1WXRA 2RSMA 1RQ0A 3OTOE 5F3WA 4P78A 4DR4E 1IBLE 2M1SA 2LJHA 1YZ9A 2F4VE 4JYAE 3T1HE 4DR3E 3H09A 4OOGC 5LMUE 3MSWA 1X48A 4DR6E 2KONA 2DSYA 3DJWA 4J8ZA 1T4LB 3HPSA 4L5NC 2WZOA 4LTYA 4B3ME 4DUZE 1XNQE 3ADIA 2RS6A 3KWRA 1N32E 4LF6E 3P1XA 2UXCE 2FTXB 2K4VA 2JWOA 2MDRA 2L3JA 4JI3E 2LUPB 4B3TE 2E5LE 1J5EE 2G7HA 3F6HA 2EZ6A 1FKAE 1HNZE 2L2MA 1GQEA 2RTXA 3LMLA 3ADGA 2E1MA 4BC7A 4B3RE 4LF9E 3F6GA 4M0VA 4LF4E 2M4IA 4WYQB 1PKPA 4DR5E 4DR1E 2V89A 3JU0A 3T1YE 5IWAE 4BCAA 4BBYA 1YYOA 1IBKE 2B7VA 4NXNE 4GKKE 1T4OA 4F54A 1EKZA 2B3TB 4X64E 5FLXC 4OX9E 2LUQA 4B3SE 2UUCE 2RS7A 4DV0E 1XMOE 4BS9A 2ODRD 4BC9A 2V86A 3VYYA 3VK6A 2B7TA 4R03A 4JI5E 1N36E 1HNXE 4DV5E 4LF7E 4F9CB 2HHHE 2VF1A 2L33A 5AE2A 2VQFE 2V85A 3HTXA 2V83A 4L8NA 2NUEA 1UILA 4KHPE 4TUGA 2M7QA 4F9BB 3C4TA 4LFBE 4DUYE 2NUGA 4LFCE 2L6MA 2LE2A 2F8BA 2V87A 3DF6A 4LFAE 3HPZA 5AASA 2DIXA 3VYXA 1ZBQA 1SR9A 4X8WA 5ADZA 1DQ3A 3HQ1A 2L3CA 5AE1A 2JVAA 4DMIA 2UU9E 4M2ZA 2L92A 3J81C 5A2QC 2JY9A 1HNWE 1T4NA 2CPNA 1ZBTA 2FV4B 2IHR1 3JTZA 3IWDA 4JI7E 4YY3E 2NUFA 4LU9A 4DV4E 4LF5E 1WHNA 2L8TA 2VQEE 2L2NA 2MC6A 3IWBA 4DV1E 1N33E 4AQYE 2L2KB 3AUZA 4BMJA 3J80C 1WHQA 2DMYA 2MC5A 4JI8E 4TUIA 2KOUA 3K6QA 2KHXA 2UUAE 2N3HA 3ADLA 1XNRE 2B9DA 2LTRA 2LTSA 3AV0A 4YHHE 1QU6A 2DB2A 3J7Yp 4DV6E 2H36X 2LBSB 1YYWA 5LMNE 4JI4E 4WFTA 1J26A 4JV5E 4GKJE 3RMPA 4DKKA 5BR8E 5T6JA 1X49A 1IBME 5IT9C 4K0KE 2FGGA 4P7DA 2V8QB 2EWLA 4KZSA 5CFFE 4JI0E 4DR7E 1DI2A 4I8OA 4LF8E 1X47A 3FIGA 3JAMC 3OMLA 3J7AG 2JR1A 4Q28A 2ZM6E 1FJGE 4DV7E 1O0WA 5DNYA 3ADJA 1HR0E 4JI2E 2UXBE 4GEQB 4X62E 1XMQE 1RC7A 4NXME 2YZTA 2UXDE 1YYKA 2ODRC 5LL6R 1N34E 3ZOQB 1UHZA 2JOBA 4DV3E 2NA2A 4WSPA 4WPYA 1I94E 5AE3A 4X66E 1STUA 3HXLA 3LLHA 4M30A 4F9AB 4X65E 4DV2E 1GZ6A 4JI6E 2JOXA 2V88A 2LMZA 3C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 E;  4DR2 E;  2N3G A;  2UUB E;  2YT4 A;  2LRS A;  2RSM A;  1RQ0 A;  3OTO E;  4DR4 E;  1IBL E;  1YZ9 A;  2LJH A;  2F4V E;  4JYA E;  3T1H E;  4DR3 E;  5LMU E;  4OOG C;  1X48 A;  4DR6 E;  4KHP E;  4LF8 E;  1T4L B;  1XNQ E;  3ADI A;  4B3M E;  4DUZ E;  2RS6 A;  1N32 E;  4LF6 E;  3P1X A;  2UXC E;  2MDR A;  2L3J A;  4JI3 E;  2LUP B;  4B3T E;  2E5L E;  1J5E E;  1FKA E;  1HNZ E;  2L2M A;  1GQE A;  2RTX A;  3ADG A;  4B3R E;  4LF9 E;  4LF4 E;  4WYQ B;  1PKP A;  4DR5 E;  4DR1 E;  3T1Y E;  2EZ6 A;  5IWA E;  4GKK E;  1YYO A;  1IBK E;  2B7V A;  4NXN E;  1T4O A;  1EKZ A;  2B3T B;  4X64 E;  4OX9 E;  2LUQ A;  4B3S E;  2UUC E;  2RS7 A;  1XMO E;  3VYY A;  2B7T A;  4JI5 E;  1N36 E;  1HNX E;  4DV5 E;  4LF7 E;  2HHH E;  2L33 A;  2VQF E;  3HTX A;  2NUE A;  1UIL A;  4LFB E;  3C4T A;  4DUY E;  2NUG A;  4LFC E;  4LFA E;  2DIX A;  3VYX A;  4X8W A;  2L3C A;  2JVA A;  1HNW E;  2UU9 E;  4M2Z A;  2JY9 A;  1T4N A;  2CPN A;  1ZBT A;  2IHR 1;  4YY3 E;  4JI7 E;  2NUF A;  4DV4 E;  4LF5 E;  1WHN A;  2VQE E;  2L2N A;  4DV1 E;  1N33 E;  4AQY E;  2L2K B;  1WHQ A;  2DMY A;  4JI8 E;  2KHX A;  2UUA E;  2N3H A;  3ADL A;  1XNR E;  2LTS A;  2LTR A;  4YHH E;  1QU6 A;  2DB2 A;  3J7Y p;  4DV6 E;  2LBS B;  1YYW A;  1J26 A;  5LMN E;  4JI4 E;  4WFT A;  4JV5 E;  4GKJ E;  4DKK A;  5BR8 E;  1X49 A;  1IBM E;  4K0K E;  4DR7 E;  5CFF E;  4JI0 E;  1DI2 A;  1X47 A;  1FJG E;  2ZM6 E;  4DV7 E;  1O0W A;  1HR0 E;  3ADJ A;  4JI2 E;  2UXB E;  4X62 E;  1XMQ E;  1RC7 A;  4NXM E;  2UXD E;  1YYK A;  1N34 E;  1UHZ A;  4DV3 E;  2NA2 A;  1I94 E;  4X66 E;  1STU A;  3LLH A;  4X65 E;  4M30 A;  4DV2 E;  4JI6 E;  4DV0 E;  3C4B A; 
#chains in the Genus database with same CATH topology
 2UUB E;  1EH6 A;  1WXR A;  2LJU A;  1RQ0 A;  2YTP A;  4P78 A;  1YZ9 A;  3T1H E;  5LMU E;  3MSW A;  4F6M A;  4LF8 E;  2EQ1 A;  3HPS A;  2CTD A;  4DUZ E;  2ENC A;  2RS6 A;  3KWR A;  1YUI A;  2EN8 A;  2EQ0 A;  2JPA A;  3P1X A;  2K4V A;  2LUP B;  1N3G A;  3F6H A;  5KL4 A;  5KL6 A;  4BC7 A;  2EOQ A;  4B3R E;  4LF9 E;  1PKP A;  4DR1 E;  3JU0 A;  1Z1B A;  4BBY A;  1YYO A;  1G2F C;  2B3T B;  2YU8 A;  4X64 E;  4R2E A;  4O5G A;  1XMO E;  1X6H A;  2V86 A;  3VYY A;  1ZU1 A;  2EMF A;  1PJQ A;  2HHH E;  5AE2 A;  1YSA C;  2NUE A;  1UIL A;  2GHF A;  2RQL A;  4O4K A;  1AH5 A;  2BB8 A;  2EMB A;  4LFA E;  1ZBQ A;  5ADZ A;  1X6F A;  2GPI A;  2DLK A;  5A6J A;  3J81 C;  2CPN A;  2YRM A;  4ZYE A;  4DV4 E;  4LF5 E;  3QG5 C;  2L2N A;  4BHB A;  4NZV A;  2EE8 A;  3J80 C;  4TUI A;  1WHQ A;  2EML A;  2WBS A;  2KHX A;  2YTJ A;  2EMH A;  1IMU A;  2EM9 A;  2LV2 A;  2HC5 A;  1QU6 A;  2DB2 A;  1J26 A;  5LMN E;  2EMA A;  4DKK A;  2JXP A;  2EOY A;  2EPM X;  2EOO A;  1A1F A;  5IT9 C;  2FGG A;  2YTI A;  2YSO A;  1QNT A;  2V8Q B;  2BBG A;  4RH8 A;  3JAM C;  1BB8 A;  3OML A;  3THN A;  1HR0 E;  4X62 E;  4NXM E;  1RC7 A;  2DLQ A;  2UXD E;  5LL6 R;  4WSP A;  4WPY A;  1STU A;  2EN3 A;  3HXL A;  4DV2 E;  4JI6 E;  2EQ3 A;  2V88 A;  2N8X A;  4DV0 E;  2LMZ A;  2A25 A;  4DR2 E;  2EN2 A;  2N3G A;  3IWC A;  1F2I G;  2RSI A;  1NEI A;  4X9J A;  1NCS A;  3OTO E;  2YSP A;  4DR4 E;  4JYA E;  2M1S A;  2F4V E;  4O43 A;  2HJJ A;  2EMK A;  4DR3 E;  3BF2 A;  2KON A;  3DJW A;  1XNQ E;  4KHP E;  3ADI A;  2EPN A;  4LTY A;  1BBO A;  1J5E E;  2L2M A;  5A6B A;  2RTX A;  3LML A;  2JP9 A;  2EMY A;  2EOM A;  3MHH C;  3F6G A;  4M0V A;  4LF4 E;  2M4I A;  1KJK A;  4R2P A;  4DR5 E;  2EZ6 A;  2V89 A;  2RPC A;  5IWA E;  4BCA A;  2YTD A;  2B7V A;  5A6B D;  5A6A A;  2DMI A;  1A1K A;  4B3S E;  2UUC E;  1ZAA C;  2LO3 A;  2ODR D;  4BC9 A;  4R03 A;  1N36 E;  2MDG A;  4DV5 E;  1YUJ A;  3BGH A;  2VQF E;  3HTX A;  2WBU A;  4LFB E;  4F9B B;  3C4T A;  1PJT A;  2NUG A;  2V87 A;  5AC4 A;  4R2A A;  2YRK A;  1IQS A;  2DIX A;  3VYX A;  1UN6 B;  2ENA A;  2YRH A;  5AE1 A;  2JVA A;  2UU9 E;  2EPC A;  1ZBT A;  3UK3 C;  4MLQ A;  4JI7 E;  2NUF A;  2EN6 A;  1TF3 A;  2EM0 A;  2MC6 A;  3IWB A;  4AQY E;  2GLI A;  1WRJ A;  3L00 A;  3AUZ A;  2YTF A;  4R2S A;  2E72 A;  2KOU A;  3K6Q A;  5IXM B;  2UUA E;  1XNR E;  2B9D A;  2LTS A;  2YTO A;  4YHH E;  1AAY A;  2EOX A;  3J7Y p;  1JK1 A;  4GKJ E;  3RMP A;  3C6K A;  4K0K E;  4P7D A;  2WCC 3;  2YTE A;  4DR7 E;  2EM7 A;  5CFF E;  4JI0 E;  1MGT A;  1UBD C;  4I8O A;  1X5W A;  3BID A;  2LT7 A;  3ECR A;  1YFH A;  4GEQ B;  1XMQ E;  2YZT A;  2ODR C;  1N34 E;  4Q35 B;  1UHZ A;  1G2D C;  3VHT B;  1I94 E;  3LLH A;  2EL4 A;  1FJG E;  1X6E A;  2VE7 C;  2ADR A;  2EMW A;  2R76 A;  2LRS A;  2EL6 A;  4ZYG A;  1IBL E;  2DGC A;  2LJH A;  5KL7 A;  5KL2 A;  2EN7 A;  1X48 A;  2EPZ A;  4J8Z A;  4L5N C;  2WZO A;  2EMG A;  4B3M E;  2LCE A;  4WXD A;  4LF6 E;  1WJP A;  2EOE A;  2UXC E;  2JYA A;  4R2D A;  4B3T E;  1FKA E;  2EPL X;  1GQE A;  1YPN A;  4R2Q A;  1LLM C;  4WYQ B;  2EM4 A;  3T1Y E;  1X3C A;  1IBK E;  4NXN E;  1T4O A;  1EKZ A;  4M9V C;  5FLX C;  4MLV A;  4OX9 E;  2PRT A;  1JK2 A;  2WBT A;  2RS7 A;  2D9H A;  4WSG A;  4BS9 A;  2EPX A;  3VK6 A;  2MKD A;  4JI5 E;  4F9C B;  3BBG A;  2YTG A;  2L33 A;  2EM8 A;  2V85 A;  1BBG A;  4TUG A;  5AC5 A;  4DUY E;  4LFC E;  2LE2 A;  2F8B A;  1A1L A;  3DF6 A;  3HPZ A;  4HEI A;  1A1G A;  4F6N A;  2LVH A;  1DQ3 A;  1HNW E;  4R2C A;  2JY9 A;  1T4N A;  3JTZ A;  2FV4 B;  4ZYH A;  2EOJ A;  4LU9 A;  4NHR A;  2VQE E;  4DV1 E;  1N33 E;  2VRD A;  2YTN A;  2EOI A;  2EN1 A;  2Q8U A;  3KZY A;  2DMY A;  4JI8 E;  1KYQ A;  3TQM A;  2LTR A;  4DV6 E;  3C6M A;  4GZN C;  2LBS B;  4WFT A;  1EH7 A;  2EOH A;  5BR8 E;  4ZYD A;  5T6J A;  2EPO A;  5KL3 A;  4IJD A;  2YTQ A;  1EH8 A;  4KZS A;  1DI2 A;  2EL5 A;  5DNY A;  4JI2 E;  1A1J A;  2EPK X;  2EMX A;  2EPA A;  3ZOQ B;  4BHC A;  5IV8 B;  2JOB A;  4DV3 E;  1B69 A;  2NA2 A;  5AE3 A;  4N4R B;  4X66 E;  1GZ6 A;  3KZZ A;  4JI1 E;  2EOZ A;  2K7I A;  4R8O A;  2YT4 A;  3EQ1 A;  1A1H A;  3EPJ A;  2EPU A;  2RSM A;  5F3W A;  2R1F A;  1PJS A;  2ELZ A;  2EN4 A;  3H09 A;  4OOG C;  3EPK A;  1A1I A;  2EMZ A;  4DR6 E;  2DSY A;  1T4L B;  2EPR A;  2EMI A;  2EJ4 A;  1N32 E;  5TSE A;  2EPP A;  2FTX B;  2JWO A;  2MDR A;  2L3J A;  4JI3 E;  1PDA A;  2E5L E;  2G7H A;  1HNZ E;  3ADG A;  2E1M A;  4WX9 A;  4GKK E;  4F54 A;  2YWQ A;  2LUQ A;  4KWY A;  3MHS C;  2YU5 A;  1GTK A;  2I9I A;  2I13 A;  2B7T A;  1HNX E;  4LF7 E;  1T39 A;  1TF6 A;  2ENH A;  2VF1 A;  3M99 B;  2V83 A;  4L8N A;  3EPL A;  2M7Q A;  4O24 A;  1L4S A;  2L6M A;  1P47 A;  5AAS A;  1T38 A;  4X8W A;  1SR9 A;  2L3C A;  2EM3 A;  3HQ1 A;  2EM6 A;  5KL5 A;  4DMI A;  4M2Z A;  2L92 A;  1MEY C;  5A2Q C;  2DRP A;  2IHR 1;  1IQO A;  3IWD A;  4YY3 E;  4HTG A;  1WHN A;  2L8T A;  2L2K B;  4BMJ A;  1RMD A;  2MC5 A;  4R2R A;  2YPN A;  2N3H A;  3ADL A;  3AV0 A;  2EOF A;  4F2J C;  1DGC A;  2H36 X;  1YYW A;  4JI4 E;  4JV5 E;  5LLQ A;  4IS1 C;  3EPH A;  2EOS A;  1X49 A;  1IBM E;  3THO B;  2EMC A;  2EWL A;  2EOR A;  5A69 A;  1X47 A;  2CT1 A;  3FIG A;  3J7A G;  2JR1 A;  1TN9 A;  2NAB A;  4Q28 A;  1ZR9 A;  2ZM6 E;  4FK5 C;  4DV7 E;  1O0W A;  2HGH A;  3ADJ A;  2MKN A;  2UXB E;  2ELY A;  1SFE A;  2EM5 A;  4WXC A;  2EM2 A;  2J7J A;  1YYK A;  2EP3 A;  2CSH A;  4F9A B;  4X65 E;  5A6K A;  4M30 A;  2JOX A;  4RHB B;  2M9A A;  3C4B A; 
#chains in the Genus database with same CATH homology
 4JI1 E;  4DR2 E;  2VE7 C;  2N3G A;  3IWC A;  2UUB E;  4R8O A;  2YT4 A;  2LRS A;  1WXR A;  2RSM A;  1RQ0 A;  3OTO E;  5F3W A;  4P78 A;  4DR4 E;  1IBL E;  2M1S A;  2LJH A;  1YZ9 A;  2F4V E;  4JYA E;  3T1H E;  4DR3 E;  3H09 A;  4OOG C;  5LMU E;  3MSW A;  1X48 A;  4DR6 E;  2KON A;  2DSY A;  3DJW A;  4J8Z A;  1T4L B;  3HPS A;  4L5N C;  2WZO A;  4LTY A;  4B3M E;  4DUZ E;  1XNQ E;  3ADI A;  2RS6 A;  3KWR A;  1N32 E;  4LF6 E;  3P1X A;  2UXC E;  2FTX B;  2K4V A;  2JWO A;  2MDR A;  2L3J A;  4JI3 E;  2LUP B;  4B3T E;  2E5L E;  1J5E E;  2G7H A;  3F6H A;  2EZ6 A;  1FKA E;  1HNZ E;  2L2M A;  1GQE A;  2RTX A;  3LML A;  3ADG A;  2E1M A;  4BC7 A;  4B3R E;  4LF9 E;  3F6G A;  4M0V A;  4LF4 E;  2M4I A;  4WYQ B;  1PKP A;  4DR5 E;  4DR1 E;  2V89 A;  3JU0 A;  3T1Y E;  5IWA E;  4BCA A;  4BBY A;  1YYO A;  1IBK E;  2B7V A;  4NXN E;  4GKK E;  1T4O A;  4F54 A;  1EKZ A;  2B3T B;  4X64 E;  5FLX C;  4OX9 E;  2LUQ A;  4B3S E;  2UUC E;  2RS7 A;  4DV0 E;  1XMO E;  4BS9 A;  2ODR D;  4BC9 A;  2V86 A;  3VYY A;  3VK6 A;  2B7T A;  4R03 A;  4JI5 E;  1N36 E;  1HNX E;  4DV5 E;  4LF7 E;  4F9C B;  2HHH E;  2VF1 A;  2L33 A;  5AE2 A;  2VQF E;  2V85 A;  3HTX A;  2V83 A;  4L8N A;  2NUE A;  1UIL A;  4KHP E;  4TUG A;  2M7Q A;  4F9B B;  3C4T A;  4LFB E;  4DUY E;  2NUG A;  4LFC E;  2L6M A;  2LE2 A;  2F8B A;  2V87 A;  3DF6 A;  4LFA E;  3HPZ A;  5AAS A;  2DIX A;  3VYX A;  1ZBQ A;  1SR9 A;  4X8W A;  5ADZ A;  1DQ3 A;  3HQ1 A;  2L3C A;  5AE1 A;  2JVA A;  4DMI A;  2UU9 E;  4M2Z A;  2L92 A;  3J81 C;  5A2Q C;  2JY9 A;  1HNW E;  1T4N A;  2CPN A;  1ZBT A;  2FV4 B;  2IHR 1;  3JTZ A;  3IWD A;  4JI7 E;  4YY3 E;  2NUF A;  4LU9 A;  4DV4 E;  4LF5 E;  1WHN A;  2L8T A;  2VQE E;  2L2N A;  2MC6 A;  3IWB A;  4DV1 E;  1N33 E;  4AQY E;  2L2K B;  3AUZ A;  4BMJ A;  3J80 C;  1WHQ A;  2DMY A;  2MC5 A;  4JI8 E;  4TUI A;  2KOU A;  3K6Q A;  2KHX A;  2UUA E;  2N3H A;  3ADL A;  1XNR E;  2B9D A;  2LTR A;  2LTS A;  3AV0 A;  4YHH E;  1QU6 A;  2DB2 A;  3J7Y p;  4DV6 E;  2H36 X;  2LBS B;  1YYW A;  5LMN E;  4JI4 E;  4WFT A;  1J26 A;  4JV5 E;  4GKJ E;  3RMP A;  4DKK A;  5BR8 E;  5T6J A;  1X49 A;  1IBM E;  5IT9 C;  4K0K E;  2FGG A;  4P7D A;  2V8Q B;  2EWL A;  4KZS A;  5CFF E;  4JI0 E;  4DR7 E;  1DI2 A;  4I8O A;  4LF8 E;  1X47 A;  3FIG A;  3JAM C;  3OML A;  3J7A G;  2JR1 A;  4Q28 A;  2ZM6 E;  1FJG E;  4DV7 E;  1O0W A;  5DNY A;  3ADJ A;  1HR0 E;  4JI2 E;  2UXB E;  4GEQ B;  4X62 E;  1XMQ E;  1RC7 A;  4NXM E;  2YZT A;  2UXD E;  1YYK A;  2ODR C;  5LL6 R;  1N34 E;  3ZOQ B;  1UHZ A;  2JOB A;  4DV3 E;  2NA2 A;  4WSP A;  4WPY A;  1I94 E;  5AE3 A;  4X66 E;  1STU A;  3HXL A;  3LLH A;  4M30 A;  4F9A B;  4X65 E;  4DV2 E;  1GZ6 A;  4JI6 E;  2JOX A;  2V88 A;  2LMZ A;  3C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...