2E72A

Solution structure of the zinc finger domain of human kiaa0461
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSSGSSGQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Pogo transposable element with ZNF domain
publication title Solution structure of the zinc finger domain of human KIAA0461
rcsb
source organism Homo sapiens
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2007-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2e72A00
2RPCA 2NABA 2EOHA 2YSOA 4X9JA 2YU8A 2GHFA 2RSIA 2YTIA 4FK5C 2EPUA 2CSHA 4R2QA 2EN2A 1Z1BA 2EMXA 1ZR9A 2EOMA 2BB8A 1NCSA 2EJ4A 2EMKA 1A1HA 2YRHA 1X6FA 1TF3A 1X6EA 2EM5A 2EM3A 2HGHA 2EMWA 2YTGA 3UK3C 1F2IG 2EMYA 2M9AA 2EMGA 4R2SA 2YTNA 2LT7A 2EPCA 2EPZA 4WSGA 1YUJA 3EPHA 5KL5A 2YRKA 2EOSA 1X3CA 2EP3A 2MKNA 2EQ3A 2YTEA 4GZNC 2LO3A 2EQ1A 4F6MA 2PRTA 2DLKA 4IJDA 2GLIA 2CTDA 2J7JA 3EPLA 1BB8A 1JK2A 2VRDA 1G2FC 1P47A 2EN8A 2EOQA 2MDGA 1B69A 4R2EA 2EM4A 4IS1C 4R2AA 2EL4A 4M9VC 2EN6A 2ELZA 2ENAA 3M99B 1A1IA 2LVHA 2EMZA 1X6HA 5KL3A 2EOZA 3EPKA 2EE8A 2MKDA 1TN9A 1RMDA 1YUIA 2YSPA 2LV2A 3MHHC 2EL5A 2A25A 2DGCA 2JP9A 2EMLA 1A1FA 1JK1A 2YTPA 2EORA 2EN7A 2I13A 2YU5A 1MEYC 2EMHA 1X5WA 2ENHA 2WBSA 3MHSC 2WBTA 1A1LA 2EPAA 1UBDC 2EMFA 2EN4A 2YTFA 1UN6B 2EMIA 2YTDA 2EM8A 2EOIA 4R2CA 1A1JA 3EPJA 2EM0A 2EOEA 1WJPA 2D9HA 2DRPA 1AAYA 1G2DC 2YTJA 2R1FA 2EOOA 2E72A 4R2PA 1LLMC 3VHTB 1YSAC 2DMIA 1DGCA 2EM6A 2EM7A 4F2JC 2WBUA 2EOJA 5KL6A 2EM2A 2EOFA 2CT1A 2EMCA 5KL7A 1KJKA 1TF6A 1A1GA 1ZU1A 2DLQA 4R2RA 2ELYA 2EMBA 1BBOA 2EPPA 4R2DA 2EPXA 2EQ0A 2EPRA 5KL4A 2EM9A 1A1KA 2ADRA 2EN3A 2YTQA 2WCC3 2EL6A 2EOYA 2LCEA 2EMAA 2ENCA 2JPAA 2EN1A 5KL2A 2YTOA 4F6NA 2YRMA 2EOXA 1ZAAC
chains in the Genus database with same CATH superfamily
2RPCA 2NABA 5IWAE 1RC7A 2GHFA 4BCAA 2EWLA 1Z1BA 2NUEA 2EMXA 2EOMA 1A1HA 3OTOE 1X6FA 4MLQA 1X6EA 2KOUA 2EMWA 2YTGA 1F2IG 3LLHA 4L5NC 3JTZA 3J7Yp 2JR1A 5F3WA 2EMGA 2YTNA 2V8QB 1UILA 5A6JA 5KL5A 2L2MA 4LF4E 4WYQB 3T1YE 2EOSA 4F9CB 3JAMC 4JI4E 2LBSB 2EQ1A 3IWBA 4WFTA 2PRTA 5T6JA 2EPOA 4YY3E 3HPZA 3EPLA 2UU9E 4BHCA 2E1MA 1KYQA 2MDGA 2EOQA 2V83A 4JI3E 4R2EA 3JU0A 2EM4A 2B7TA 3L00A 4R2AA 4M9VC 3M99B 1A1IA 2ODRD 1DI2A 1HNZE 2EMZA 5AC5A 4OX9E 4DUZE 4WSPA 5CFFE 2MKDA 1YUIA 5A69A 3C6KA 4WPYA 2JP9A 4NXME 2EMLA 3QG5C 4Q35B 1JK1A 4DR5E 2YU5A 1T4OA 3ADGA 4DMIA 4DR4E 2RQLA 1N32E 2YTDA 2EM8A 3KZYA 3AUZA 2EOEA 1WJPA 2D9HA 2YPNA 4DR1E 1WHNA 4X64E 4Q28A 4R03A 2EOOA 4HEIA 4X65E 2IHR1 2EM6A 4BBYA 4DV6E 2EM7A 1IBLE 4N4RB 1FJGE 2JYAA 4KHPE 2EOFA 2CT1A 4O4KA 5KL7A 3K6QA 4DV7E 2VQEE 3F6HA 4R2DA 4TUGA 2EPXA 1EH8A 2EM9A 4DV0E 1A1KA 2BBGA 2DIXA 1T4NA 4NZVA 2ENCA 2R76A 4L8NA 4LFAE 4LFBE 2GPIA 2CPNA 1QU6A 2YRMA 1RQ0A 2EOXA 1ZAAC 3KZZA 1HR0E 3BF2A 2EOHA 2JWOA 4FK5C 5IXMB 2CSHA 2EN2A 1ZR9A 4LF7E 4O43A 3ADLA 1AH5A 4LF6E 2B9DA 3DJWA 2B7VA 2EM5A 2KHXA 5A6BD 2NUFA 2JXPA 3J7AG 2LUQA 3BGHA 2EMYA 2M9AA 4OOGC 4DUYE 2JVAA 4R2SA 4KWYA 2EPCA 2YWQA 5ADZA 2L2NA 2L92A 4WX9A 2LJUA 1N34E 1X3CA 1PJTA 2VQFE 4HTGA 2EQ3A 2RS6A 3DF6A 5AE3A 2DLKA 5IT9C 2GLIA 2M4IA 2CTDA 3HQ1A 4JV5E 1G2FC 1P47A 4IS1C 4BC9A 4DV4E 2EL4A 1IQOA 2ENAA 4AQYE 1STUA 1GZ6A 1X6HA 4DR2E 2EOZA 4DKKA 4F9BB 4WXCA 2EE8A 4WXDA 4X66E 2FV4B 4B3TE 1GQEA 2K4VA 2A25A 2DGCA 3HXLA 1A1FA 2H36X 2UXCE 4X8WA 2EORA 4BC7A 2L3CA 3IWCA 2I13A 4ZYDA 2WBSA 2N3HA 2VE7C 2EN4A 2EOIA 2JOXA 4R2CA 3EPJA 4GEQB 1XNQE 4DR3E 1G2DC 2L3JA 1YYWA 5BR8E 2L6MA 1LLMC 2LMZA 4YHHE 2HC5A 2N8XA 1XMOE 2DMIA 2N3GA 4F2JC 2EOJA 5KL6A 2EM2A 2FTXB 1A1GA 5LMUE 4R2RA 2EMBA 2EPPA 2LTRA 3C6MA 4RH8A 5KL4A 2EN3A 3OMLA 4B3RE 1N36E 2LCEA 1WRJA 2B3TB 4I8OA 3ZOQB 4LF5E 2DMYA 2UXDE 2E5LE 5FLXC 2YTIA 2EPMX 4K0KE 2EPUA 1YPNA 1SR9A 1ZBTA 2BB8A 1NCSA 2EJ4A 2DB2A 2L8TA 2LJHA 5LLQA 1TF3A 2MC6A 2EM3A 2MDRA 2HGHA 3UK3C 2YZTA 3H09A 4DV5E 1J26A 3TQMA 1EKZA 5AE2A 2LT7A 2JOBA 4LF8E 1NEIA 3EPHA 1YUJA 4ZYEA 1PJSA 2YRKA 4JI5E 5TSEA 3F6GA 4JI7E 2MKNA 2I9IA 2G7HA 2UUBE 4LFCE 4JI0E 1JK2A 4BMJA 2EN8A 3KWRA 1X48A 2LVHA 1WXRA 4B3SE 4DR7E 5KL3A 2JY9A 4TUIA 2KONA 1L4SA 2FGGA 3J80C 2YSPA 2LV2A 1XNRE 1MGTA 2EL5A 3FIGA 1UHZA 5AE1A 5A6AA 2MC5A 2EN7A 1IBME 1MEYC 1X5WA 1T38A 2V85A 2HJJA 3MHSC 1SFEA 1O0WA 2EPNA 3AV0A 2EPAA 2V86A 1A1LA 2YTFA 1UN6B 3IWDA 1A1JA 1BBGA 2EM0A 1AAYA 2M7QA 5AC4A 2E72A 4R2PA 1HNWE 3ECRA 1YSAC 1X47A 2HHHE 3VYYA 1XMQE 1DGCA 3T1HE 4NHRA 2WBUA 1PKPA 2L33A 2EMCA 4JI1E 1KJKA 3THNA 4DV2E 1ZU1A 5A6KA 2DLQA 4O24A 1BBOA 2RS7A 2RTXA 3HTXA 2ADRA 1X49A 2YTQA 2LUPB 2EL6A 2ZM6E 2EMAA 1IMUA 1PJQA 2EN1A 2K7IA 4M30A 2YSOA 4X9JA 2M1SA 2YU8A 2RSIA 3HPSA 4R2QA 2EMKA 2YT4A 2YRHA 3LMLA 1EH7A 2VF1A 4ZYHA 2F8BA 1YZ9A 2Q8UA 2RSMA 3ADJA 4F9AB 4DV3E 2LE2A 2UXBE 3J81C 2EPZA 4WSGA 2V88A 1N33E 4LU9A 3MSWA 4JI2E 2EP3A 2EPKX 4LF9E 4BHBA 4NXNE 5A6BA 2YTEA 4GZNC 2LO3A 4M2ZA 4KZSA 4F6MA 4IJDA 5IV8B 4GKJE 2J7JA 2L2KB 1EH6A 4JI6E 3VK6A 1BB8A 5LL6R 2VRDA 4DR6E 1B69A 4B3ME 1IQSA 3THOB 3RMPA 2EN6A 2ELZA 3C4BA 3BIDA 4DV1E 4GKKE 5DNYA 4ZYGA 1PDAA 3EPKA 5LMNE 3ADIA 1TN9A 1RMDA 1QNTA 4J8ZA 4P78A 3P1XA 4JI8E 3MHHC 1DQ3A 2WZOA 2LRSA 2YTPA 2EMHA 2F4VE 2ENHA 2NA2A 4BS9A 2V87A 2WBTA 1UBDC 1ZBQA 2EMFA 2EMIA 4X62E 4MLVA 4RHBB 5A2QC 4JYAE 1YYOA 2DRPA 2DSYA 4M0VA 2UUAE 2YTJA 1WHQA 1N3GA 1IBKE 2R1FA 2V89A 1I94E 1J5EE 3VHTB 2UUCE 4O5GA 4LTYA 2EZ6A 2ODRC 1T39A 3BBGA 2LTSA 4P7DA 2EPLX 1TF6A 3EQ1A 2ELYA 2EQ0A 3C4TA 4R8OA 2EPRA 1YFHA 1GTKA 1FKAE 1YYKA 2WCC3 1T4LB 2EOYA 2NUGA 1HNXE 2JPAA 5KL2A 4F54A 2YTOA 5AASA 4F6NA 3VYXA
chains in the Genus database with same CATH topology
2RPCA 2NABA 2EOHA 2YSOA 4X9JA 2YU8A 2GHFA 2RSIA 2YTIA 4FK5C 2EPUA 2CSHA 4R2QA 2EN2A 1Z1BA 2EMXA 1ZR9A 2EOMA 2BB8A 1NCSA 2EJ4A 2EMKA 1A1HA 2YRHA 1X6FA 1TF3A 1X6EA 2EM5A 2EM3A 2HGHA 2EMWA 2YTGA 3UK3C 1F2IG 2EMYA 2M9AA 2EMGA 4R2SA 2YTNA 2LT7A 2EPCA 2EPZA 4WSGA 1YUJA 3EPHA 5KL5A 2YRKA 2EOSA 1X3CA 2EP3A 2MKNA 2EQ3A 2YTEA 4GZNC 2LO3A 2EQ1A 4F6MA 2PRTA 2DLKA 4IJDA 2GLIA 2CTDA 2J7JA 3EPLA 1BB8A 1JK2A 2VRDA 1G2FC 1P47A 2EN8A 2EOQA 2MDGA 1B69A 4R2EA 2EM4A 4IS1C 4R2AA 2EL4A 4M9VC 2EN6A 2ELZA 2ENAA 3M99B 1A1IA 2LVHA 2EMZA 1X6HA 5KL3A 2EOZA 3EPKA 2EE8A 2MKDA 1TN9A 1RMDA 1YUIA 2YSPA 2LV2A 3MHHC 2EL5A 2A25A 2DGCA 2JP9A 2EMLA 1A1FA 1JK1A 2YTPA 2EORA 2EN7A 2I13A 2YU5A 1MEYC 2EMHA 1X5WA 2ENHA 2WBSA 3MHSC 2WBTA 1A1LA 2EPAA 1UBDC 2EMFA 2EN4A 2YTFA 1UN6B 2EMIA 2YTDA 2EM8A 2EOIA 4R2CA 1A1JA 3EPJA 2EM0A 2EOEA 1WJPA 2D9HA 2DRPA 1AAYA 1G2DC 2YTJA 2R1FA 2EOOA 2E72A 4R2PA 1LLMC 3VHTB 1YSAC 2DMIA 1DGCA 2EM6A 2EM7A 4F2JC 2WBUA 2EOJA 5KL6A 2EM2A 2EOFA 2CT1A 2EMCA 5KL7A 1KJKA 1TF6A 1A1GA 1ZU1A 2DLQA 4R2RA 2ELYA 2EMBA 1BBOA 2EPPA 4R2DA 2EPXA 2EQ0A 2EPRA 5KL4A 2EM9A 1A1KA 2ADRA 2EN3A 2YTQA 2WCC3 2EL6A 2EOYA 2LCEA 2EMAA 2ENCA 2JPAA 2EN1A 5KL2A 2YTOA 4F6NA 2YRMA 2EOXA 1ZAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPC A;  2NAB A;  2EOH A;  2YSO A;  4X9J A;  2YU8 A;  2GHF A;  2RSI A;  2YTI A;  4FK5 C;  2EPU A;  2CSH A;  4R2Q A;  2EN2 A;  1Z1B A;  2EMX A;  1ZR9 A;  2EOM A;  2BB8 A;  1NCS A;  2EJ4 A;  2EMK A;  1A1H A;  2YRH A;  1X6F A;  1TF3 A;  1X6E A;  2EM5 A;  2EM3 A;  2HGH A;  2EMW A;  2YTG A;  3UK3 C;  1F2I G;  2EMY A;  2M9A A;  2EMG A;  4R2S A;  2YTN A;  2LT7 A;  2EPC A;  2EPZ A;  4WSG A;  1YUJ A;  3EPH A;  5KL5 A;  2YRK A;  2EOS A;  1X3C A;  2EP3 A;  2MKN A;  2EQ3 A;  2YTE A;  4GZN C;  2LO3 A;  2EQ1 A;  4F6M A;  2PRT A;  2DLK A;  4IJD A;  2GLI A;  2CTD A;  2J7J A;  3EPL A;  1BB8 A;  1JK2 A;  2VRD A;  1G2F C;  1P47 A;  2EN8 A;  2EOQ A;  2MDG A;  1B69 A;  4R2E A;  2EM4 A;  4IS1 C;  4R2A A;  2EL4 A;  4M9V C;  2EN6 A;  2ELZ A;  2ENA A;  3M99 B;  1A1I A;  2LVH A;  2EMZ A;  1X6H A;  5KL3 A;  2EOZ A;  3EPK A;  2EE8 A;  2MKD A;  1TN9 A;  1RMD A;  1YUI A;  2YSP A;  2LV2 A;  3MHH C;  2EL5 A;  2A25 A;  2DGC A;  2JP9 A;  2EML A;  1A1F A;  1JK1 A;  2YTP A;  2EOR A;  2EN7 A;  2I13 A;  2YU5 A;  1MEY C;  2EMH A;  1X5W A;  2ENH A;  2WBS A;  3MHS C;  2WBT A;  1A1L A;  2EPA A;  1UBD C;  2EMF A;  2EN4 A;  2YTF A;  1UN6 B;  2EMI A;  2YTD A;  2EM8 A;  2EOI A;  4R2C A;  1A1J A;  3EPJ A;  2EM0 A;  2EOE A;  1WJP A;  2D9H A;  2DRP A;  1AAY A;  1G2D C;  2YTJ A;  2R1F A;  2EOO A;  2E72 A;  4R2P A;  1LLM C;  3VHT B;  1YSA C;  2DMI A;  1DGC A;  2EM6 A;  2EM7 A;  4F2J C;  2WBU A;  2EOJ A;  5KL6 A;  2EM2 A;  2EOF A;  2CT1 A;  2EMC A;  5KL7 A;  1KJK A;  1TF6 A;  1A1G A;  1ZU1 A;  2DLQ A;  4R2R A;  2ELY A;  2EMB A;  1BBO A;  2EPP A;  4R2D A;  2EPX A;  2EQ0 A;  2EPR A;  5KL4 A;  2EM9 A;  1A1K A;  2ADR A;  2EN3 A;  2YTQ A;  2WCC 3;  2EL6 A;  2EOY A;  2LCE A;  2EMA A;  2ENC A;  2JPA A;  2EN1 A;  5KL2 A;  2YTO A;  4F6N A;  2YRM A;  2EOX A;  1ZAA C; 
#chains in the Genus database with same CATH topology
 2RPC A;  2NAB A;  5IWA E;  1RC7 A;  2GHF A;  4BCA A;  2EWL A;  1Z1B A;  2NUE A;  2EMX A;  2EOM A;  1A1H A;  3OTO E;  1X6F A;  4MLQ A;  1X6E A;  2KOU A;  2EMW A;  2YTG A;  1F2I G;  3LLH A;  4L5N C;  3JTZ A;  3J7Y p;  2JR1 A;  5F3W A;  2EMG A;  2YTN A;  2V8Q B;  1UIL A;  5A6J A;  5KL5 A;  2L2M A;  4LF4 E;  4WYQ B;  3T1Y E;  2EOS A;  4F9C B;  3JAM C;  4JI4 E;  2LBS B;  2EQ1 A;  3IWB A;  4WFT A;  2PRT A;  5T6J A;  2EPO A;  4YY3 E;  3HPZ A;  3EPL A;  2UU9 E;  4BHC A;  2E1M A;  1KYQ A;  2MDG A;  2EOQ A;  2V83 A;  4JI3 E;  4R2E A;  3JU0 A;  2EM4 A;  2B7T A;  3L00 A;  4R2A A;  4M9V C;  3M99 B;  1A1I A;  2ODR D;  1DI2 A;  1HNZ E;  2EMZ A;  5AC5 A;  4OX9 E;  4DUZ E;  4WSP A;  5CFF E;  2MKD A;  1YUI A;  5A69 A;  3C6K A;  4WPY A;  2JP9 A;  4NXM E;  2EML A;  3QG5 C;  4Q35 B;  1JK1 A;  4DR5 E;  2YU5 A;  1T4O A;  3ADG A;  4DMI A;  4DR4 E;  2RQL A;  1N32 E;  2YTD A;  2EM8 A;  3KZY A;  3AUZ A;  2EOE A;  1WJP A;  2D9H A;  2YPN A;  4DR1 E;  1WHN A;  4X64 E;  4Q28 A;  4R03 A;  2EOO A;  4HEI A;  4X65 E;  2IHR 1;  2EM6 A;  4BBY A;  4DV6 E;  2EM7 A;  1IBL E;  4N4R B;  1FJG E;  2JYA A;  4KHP E;  2EOF A;  2CT1 A;  4O4K A;  5KL7 A;  3K6Q A;  4DV7 E;  2VQE E;  3F6H A;  4R2D A;  4TUG A;  2EPX A;  1EH8 A;  2EM9 A;  4DV0 E;  1A1K A;  2BBG A;  2DIX A;  1T4N A;  4NZV A;  2ENC A;  2R76 A;  4L8N A;  4LFA E;  4LFB E;  2GPI A;  2CPN A;  1QU6 A;  2YRM A;  1RQ0 A;  2EOX A;  1ZAA C;  3KZZ A;  1HR0 E;  3BF2 A;  2EOH A;  2JWO A;  4FK5 C;  5IXM B;  2CSH A;  2EN2 A;  1ZR9 A;  4LF7 E;  4O43 A;  3ADL A;  1AH5 A;  4LF6 E;  2B9D A;  3DJW A;  2B7V A;  2EM5 A;  2KHX A;  5A6B D;  2NUF A;  2JXP A;  3J7A G;  2LUQ A;  3BGH A;  2EMY A;  2M9A A;  4OOG C;  4DUY E;  2JVA A;  4R2S A;  4KWY A;  2EPC A;  2YWQ A;  5ADZ A;  2L2N A;  2L92 A;  4WX9 A;  2LJU A;  1N34 E;  1X3C A;  1PJT A;  2VQF E;  4HTG A;  2EQ3 A;  2RS6 A;  3DF6 A;  5AE3 A;  2DLK A;  5IT9 C;  2GLI A;  2M4I A;  2CTD A;  3HQ1 A;  4JV5 E;  1G2F C;  1P47 A;  4IS1 C;  4BC9 A;  4DV4 E;  2EL4 A;  1IQO A;  2ENA A;  4AQY E;  1STU A;  1GZ6 A;  1X6H A;  4DR2 E;  2EOZ A;  4DKK A;  4F9B B;  4WXC A;  2EE8 A;  4WXD A;  4X66 E;  2FV4 B;  4B3T E;  1GQE A;  2K4V A;  2A25 A;  2DGC A;  3HXL A;  1A1F A;  2H36 X;  2UXC E;  4X8W A;  2EOR A;  4BC7 A;  2L3C A;  3IWC A;  2I13 A;  4ZYD A;  2WBS A;  2N3H A;  2VE7 C;  2EN4 A;  2EOI A;  2JOX A;  4R2C A;  3EPJ A;  4GEQ B;  1XNQ E;  4DR3 E;  1G2D C;  2L3J A;  1YYW A;  5BR8 E;  2L6M A;  1LLM C;  2LMZ A;  4YHH E;  2HC5 A;  2N8X A;  1XMO E;  2DMI A;  2N3G A;  4F2J C;  2EOJ A;  5KL6 A;  2EM2 A;  2FTX B;  1A1G A;  5LMU E;  4R2R A;  2EMB A;  2EPP A;  2LTR A;  3C6M A;  4RH8 A;  5KL4 A;  2EN3 A;  3OML A;  4B3R E;  1N36 E;  2LCE A;  1WRJ A;  2B3T B;  4I8O A;  3ZOQ B;  4LF5 E;  2DMY A;  2UXD E;  2E5L E;  5FLX C;  2YTI A;  2EPM X;  4K0K E;  2EPU A;  1YPN A;  1SR9 A;  1ZBT A;  2BB8 A;  1NCS A;  2EJ4 A;  2DB2 A;  2L8T A;  2LJH A;  5LLQ A;  1TF3 A;  2MC6 A;  2EM3 A;  2MDR A;  2HGH A;  3UK3 C;  2YZT A;  3H09 A;  4DV5 E;  1J26 A;  3TQM A;  1EKZ A;  5AE2 A;  2LT7 A;  2JOB A;  4LF8 E;  1NEI A;  3EPH A;  1YUJ A;  4ZYE A;  1PJS A;  2YRK A;  4JI5 E;  5TSE A;  3F6G A;  4JI7 E;  2MKN A;  2I9I A;  2G7H A;  2UUB E;  4LFC E;  4JI0 E;  1JK2 A;  4BMJ A;  2EN8 A;  3KWR A;  1X48 A;  2LVH A;  1WXR A;  4B3S E;  4DR7 E;  5KL3 A;  2JY9 A;  4TUI A;  2KON A;  1L4S A;  2FGG A;  3J80 C;  2YSP A;  2LV2 A;  1XNR E;  1MGT A;  2EL5 A;  3FIG A;  1UHZ A;  5AE1 A;  5A6A A;  2MC5 A;  2EN7 A;  1IBM E;  1MEY C;  1X5W A;  1T38 A;  2V85 A;  2HJJ A;  3MHS C;  1SFE A;  1O0W A;  2EPN A;  3AV0 A;  2EPA A;  2V86 A;  1A1L A;  2YTF A;  1UN6 B;  3IWD A;  1A1J A;  1BBG A;  2EM0 A;  1AAY A;  2M7Q A;  5AC4 A;  2E72 A;  4R2P A;  1HNW E;  3ECR A;  1YSA C;  1X47 A;  2HHH E;  3VYY A;  1XMQ E;  1DGC A;  3T1H E;  4NHR A;  2WBU A;  1PKP A;  2L33 A;  2EMC A;  4JI1 E;  1KJK A;  3THN A;  4DV2 E;  1ZU1 A;  5A6K A;  2DLQ A;  4O24 A;  1BBO A;  2RS7 A;  2RTX A;  3HTX A;  2ADR A;  1X49 A;  2YTQ A;  2LUP B;  2EL6 A;  2ZM6 E;  2EMA A;  1IMU A;  1PJQ A;  2EN1 A;  2K7I A;  4M30 A;  2YSO A;  4X9J A;  2M1S A;  2YU8 A;  2RSI A;  3HPS A;  4R2Q A;  2EMK A;  2YT4 A;  2YRH A;  3LML A;  1EH7 A;  2VF1 A;  4ZYH A;  2F8B A;  1YZ9 A;  2Q8U A;  2RSM A;  3ADJ A;  4F9A B;  4DV3 E;  2LE2 A;  2UXB E;  3J81 C;  2EPZ A;  4WSG A;  2V88 A;  1N33 E;  4LU9 A;  3MSW A;  4JI2 E;  2EP3 A;  2EPK X;  4LF9 E;  4BHB A;  4NXN E;  5A6B A;  2YTE A;  4GZN C;  2LO3 A;  4M2Z A;  4KZS A;  4F6M A;  4IJD A;  5IV8 B;  4GKJ E;  2J7J A;  2L2K B;  1EH6 A;  4JI6 E;  3VK6 A;  1BB8 A;  5LL6 R;  2VRD A;  4DR6 E;  1B69 A;  4B3M E;  1IQS A;  3THO B;  3RMP A;  2EN6 A;  2ELZ A;  3C4B A;  3BID A;  4DV1 E;  4GKK E;  5DNY A;  4ZYG A;  1PDA A;  3EPK A;  5LMN E;  3ADI A;  1TN9 A;  1RMD A;  1QNT A;  4J8Z A;  4P78 A;  3P1X A;  4JI8 E;  3MHH C;  1DQ3 A;  2WZO A;  2LRS A;  2YTP A;  2EMH A;  2F4V E;  2ENH A;  2NA2 A;  4BS9 A;  2V87 A;  2WBT A;  1UBD C;  1ZBQ A;  2EMF A;  2EMI A;  4X62 E;  4MLV A;  4RHB B;  5A2Q C;  4JYA E;  1YYO A;  2DRP A;  2DSY A;  4M0V A;  2UUA E;  2YTJ A;  1WHQ A;  1N3G A;  1IBK E;  2R1F A;  2V89 A;  1I94 E;  1J5E E;  3VHT B;  2UUC E;  4O5G A;  4LTY A;  2EZ6 A;  2ODR C;  1T39 A;  3BBG A;  2LTS A;  4P7D A;  2EPL X;  1TF6 A;  3EQ1 A;  2ELY A;  2EQ0 A;  3C4T A;  4R8O A;  2EPR A;  1YFH A;  1GTK A;  1FKA E;  1YYK A;  2WCC 3;  1T4L B;  2EOY A;  2NUG A;  1HNX E;  2JPA A;  5KL2 A;  4F54 A;  2YTO A;  5AAS A;  4F6N A;  3VYX A; 
#chains in the Genus database with same CATH homology
 2RPC A;  2NAB A;  2EOH A;  2YSO A;  4X9J A;  2YU8 A;  2GHF A;  2RSI A;  2YTI A;  4FK5 C;  2EPU A;  2CSH A;  4R2Q A;  2EN2 A;  1Z1B A;  2EMX A;  1ZR9 A;  2EOM A;  2BB8 A;  1NCS A;  2EJ4 A;  2EMK A;  1A1H A;  2YRH A;  1X6F A;  1TF3 A;  1X6E A;  2EM5 A;  2EM3 A;  2HGH A;  2EMW A;  2YTG A;  3UK3 C;  1F2I G;  2EMY A;  2M9A A;  2EMG A;  4R2S A;  2YTN A;  2LT7 A;  2EPC A;  2EPZ A;  4WSG A;  1YUJ A;  3EPH A;  5KL5 A;  2YRK A;  2EOS A;  1X3C A;  2EP3 A;  2MKN A;  2EQ3 A;  2YTE A;  4GZN C;  2LO3 A;  2EQ1 A;  4F6M A;  2PRT A;  2DLK A;  4IJD A;  2GLI A;  2CTD A;  2J7J A;  3EPL A;  1BB8 A;  1JK2 A;  2VRD A;  1G2F C;  1P47 A;  2EN8 A;  2EOQ A;  2MDG A;  1B69 A;  4R2E A;  2EM4 A;  4IS1 C;  4R2A A;  2EL4 A;  4M9V C;  2EN6 A;  2ELZ A;  2ENA A;  3M99 B;  1A1I A;  2LVH A;  2EMZ A;  1X6H A;  5KL3 A;  2EOZ A;  3EPK A;  2EE8 A;  2MKD A;  1TN9 A;  1RMD A;  1YUI A;  2YSP A;  2LV2 A;  3MHH C;  2EL5 A;  2A25 A;  2DGC A;  2JP9 A;  2EML A;  1A1F A;  1JK1 A;  2YTP A;  2EOR A;  2EN7 A;  2I13 A;  2YU5 A;  1MEY C;  2EMH A;  1X5W A;  2ENH A;  2WBS A;  3MHS C;  2WBT A;  1A1L A;  2EPA A;  1UBD C;  2EMF A;  2EN4 A;  2YTF A;  1UN6 B;  2EMI A;  2YTD A;  2EM8 A;  2EOI A;  4R2C A;  1A1J A;  3EPJ A;  2EM0 A;  2EOE A;  1WJP A;  2D9H A;  2DRP A;  1AAY A;  1G2D C;  2YTJ A;  2R1F A;  2EOO A;  2E72 A;  4R2P A;  1LLM C;  3VHT B;  1YSA C;  2DMI A;  1DGC A;  2EM6 A;  2EM7 A;  4F2J C;  2WBU A;  2EOJ A;  5KL6 A;  2EM2 A;  2EOF A;  2CT1 A;  2EMC A;  5KL7 A;  1KJK A;  1TF6 A;  1A1G A;  1ZU1 A;  2DLQ A;  4R2R A;  2ELY A;  2EMB A;  1BBO A;  2EPP A;  4R2D A;  2EPX A;  2EQ0 A;  2EPR A;  5KL4 A;  2EM9 A;  1A1K A;  2ADR A;  2EN3 A;  2YTQ A;  2WCC 3;  2EL6 A;  2EOY A;  2LCE A;  2EMA A;  2ENC A;  2JPA A;  2EN1 A;  5KL2 A;  2YTO A;  4F6N A;  2YRM A;  2EOX A;  1ZAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...