2E72A

Solution structure of the zinc finger domain of human kiaa0461
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
49
Chain Sequence
GSSGSSGQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pogo transposable element with ZNF domain
publication title Solution structure of the zinc finger domain of human KIAA0461
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 3
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2007-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2e72A00
2DRPA 3M99B 2CTDA 2EN6A 2LV2A 4GZNC 1A1IA 2DLQA 2EPPA 2D9HA 4R2EA 2EPCA 1TF3A 1RMDA 1A1GA 2WBTA 2I13A 3EPHA 1NCSA 4R2SA 2EM8A 2EM9A 1YUIA 2EN2A 2YTFA 2YTGA 2EPZA 2WBUA 1X3CA 2EL5A 2LVHA 1ZAAC 2EN3A 2YTNA 1G2FC 2EE8A 2EM2A 2YTEA 5KL4A 4R2RA 2LCEA 2EPXA 2YSOA 2EN7A 3EPKA 1DGCA 2EMFA 2EN8A 4R2PA 2EMGA 5KL2A 2EM3A 2EOYA 1YSAC 2EOQA 2EL6A 4R2QA 2WCC3 1X6HA 2EMKA 2ENHA 2YTPA 3MHHC 2EM0A 2YRMA 1A1FA 5KL6A 1A1HA 1F2IG 1G2DC 4F2JC 2EMLA 1X6FA 2EM5A 1UBDC 2ELYA 2MKDA 1MEYC 2LO3A 2YTIA 2DGCA 2YU5A 2EMBA 2EOMA 1YUJA 2MDGA 4F6MA 2YTOA 2EMYA 4IS1C 2CSHA 2YSPA 4R2CA 2GLIA 2YTDA 2M9AA 2EQ1A 2EMCA 2EL4A 5KL3A 2EOJA 3EPLA 2EMXA 2YTJA 1Z1BA 4M9VC 2EN1A 2EMZA 1BB8A 2MKNA 2A25A 1LLMC 2YRHA 2EJ4A 2EM6A 3UK3C 2EPAA 1TF6A 2RSIA 2EOXA 1X6EA 2WBSA 2EMHA 2EM4A 3VHTB 4FK5C 2EMIA 4R2AA 3EPJA 1ZU1A 2CT1A 2ELZA 2EM7A 4WSGA 1P47A 4R2DA 1A1KA 2LT7A 4X9JA 2ENAA 1KJKA 1A1LA 1BBOA 2JP9A 2EPUA 2YRKA 2EOHA 2EMWA 2EQ3A 4IJDA 1B69A 2E72A 2EOIA 5KL5A 1JK1A 2BB8A 1ZR9A 1WJPA 2EOSA 2RPCA 2YU8A 2R1FA 2EP3A 3MHSC 2PRTA 2J7JA 2EMAA 2VRDA 2EPRA 2EORA 2HGHA 2EOZA 2YTQA 5KL7A 2ENCA 2EOFA 2EOOA 2NABA 1X5WA 1TN9A 1UN6B 2DMIA 4F6NA 2EN4A 2EOEA 2DLKA 1JK2A 2ADRA 1A1JA 2EQ0A 1AAYA 2GHFA 2JPAA
chains in the Genus database with same CATH superfamily
3M99B 3DF6A 4LF7E 2EN6A 2FV4B 2ODRD 1A1IA 2B3TB 2RTXA 4BHCA 2MC5A 4DV2E 1TF3A 4KHPE 2GPIA 2I13A 2WBTA 5BR8E 4KZSA 3EPHA 4R2SA 2EM8A 4DR3E 1EKZA 2EN2A 2YTFA 2YTGA 2L2MA 4DR7E 3BIDA 2E5LE 2HC5A 4I8OA 4R2RA 4LF6E 2VQFE 2EPXA 2RS6A 2E1MA 2EN8A 4WFTA 3THOB 4P7DA 5KL2A 4GKJE 1EH8A 4O43A 4BC9A 2EOQA 4LFAE 3HTXA 1X6HA 1J5EE 2YTPA 4JI7E 3JTZA 4YY3E 2EM0A 4GEQB 2EPKX 1N33E 3HPZA 2MKDA 4J8ZA 2R76A 2KONA 2YTOA 2LTRA 2NUFA 4IS1C 4DR6E 4DR5E 2YTDA 2EMCA 4F9BB 5A6BD 4LF5E 5AASA 2EPNA 3KZYA 1T4NA 3VYYA 1ZBTA 1QNTA 2MKNA 4YHHE 2G7HA 3UK3C 2F8BA 5CFFE 2RSIA 4LU9A 2RQLA 1WHNA 1IBME 2CT1A 2EM7A 2EPOA 1YYWA 4WXDA 4R2DA 2ZM6E 1I94E 1A1KA 2LT7A 2ENAA 4JI3E 1A1LA 1HR0E 1KJKA 3LMLA 1IQOA 1IMUA 2EPUA 4LF8E 2EMWA 2EQ3A 3C4TA 4OX9E 2EOIA 4TUIA 4R8OA 2H36X 2RPCA 1UHZA 2EP3A 3MHSC 2J7JA 2HGHA 3BF2A 2KHXA 2B7TA 2NUEA 2EOFA 2EOOA 2NABA 5A6BA 4JYAE 1UN6B 3AV0A 2UU9E 2EN4A 1HNZE 1KYQA 1A1JA 1AAYA 1PJSA 2DRPA 4L5NC 2CTDA 3C6KA 4GZNC 4MLVA 5LMUE 4DR1E 2N3HA 4DR4E 1A1GA 5AE2A 1NCSA 4O4KA 2VQEE 2UUCE 1X3CA 1ZAAC 2EN3A 1G2FC 2YTEA 5KL4A 2LCEA 2LTSA 2NUGA 2EN7A 2JWOA 1X48A 2EM3A 2LE2A 2EOYA 1X47A 3LLHA 2EMKA 3J81C 2L2KB 4NXNE 2YRMA 5KL6A 2JY9A 1A1HA 1G2DC 4B3SE 2EM5A 1UBDC 4O5GA 1YYKA 3OTOE 1GZ6A 2VE7C 5AE3A 2YTIA 1MEYC 4NXME 2EMBA 4F6MA 1YFHA 2I9IA 2EMYA 1T38A 2RSMA 4GKKE 2EQ1A 4ZYHA 2N8XA 5LLQA 3VK6A 5FLXC 2EOXA 2EM4A 3VHTB 2EMIA 1ZU1A 2ELZA 3T1YE 2N3GA 1P47A 1XMQE 4BCAA 3FIGA 4X9JA 3VYXA 2B9DA 2JR1A 4TUGA 1B69A 1IBLE 2V85A 3ADLA 2E72A 5LL6R 2BB8A 1JK1A 2UXDE 2UXBE 1SR9A 2L3CA 4AQYE 4ZYDA 4X66E 2EORA 2EOZA 4M30A 1MGTA 1T4LB 3K6QA 1X5WA 1TN9A 5A6AA 2DMIA 3AUZA 4F6NA 5A6JA 4LFBE 2NA2A 2DLKA 3KWRA 4B3RE 2UUBE 2GHFA 2JPAA 3H09A 5AC5A 2DLQA 2EPPA 3C4BA 3QG5C 4WX9A 3J7AG 2V86A 4DV4E 4R2EA 2EPCA 2L3JA 1RMDA 4KWYA 1YUIA 3IWCA 2LUQA 5IV8B 1WXRA 2WBUA 2B7VA 2EL5A 2YZTA 1PDAA 2YTNA 4OOGC 2WZOA 2EM2A 1N3GA 4WXCA 4BC7A 4B3ME 2EPMX 5A6KA 3J7Yp 4R2PA 1T39A 2K7IA 1SFEA 4BHBA 3ADGA 1HNXE 4R2QA 1XMOE 2WCC3 3BBGA 4K0KE 4LTYA 4DV1E 2LJUA 2ENHA 2LUPB 2JOXA 3ADIA 4ZYEA 3MHHC 4Q28A 4RHBB 1YPNA 1F2IG 2YWQA 3EQ1A 4F2JC 2EMLA 3F6GA 4LF9E 2V88A 2DGCA 4WYQB 1YUJA 2JVAA 1YZ9A 4JI8E 4R03A 2UUAE 2V83A 2DMYA 2CSHA 2YSPA 2GLIA 4MLQA 4NHRA 2M9AA 1DQ3A 2V8QB 5KL3A 1RC7A 1N34E 4LF4E 2EOJA 3EPLA 1XNRE 2EMXA 2YTJA 3TQMA 1Z1BA 4M9VC 5LMNE 4JI5E 2L33A 2M7QA 2EWLA 1PJTA 2YRHA 2EPLX 1PKPA 2EM6A 4DUYE 2LRSA 2VF1A 4N4RB 4LFCE 1J26A 4M0VA 2EPAA 1IQSA 5IWAE 1X6EA 2EMHA 2M4IA 3IWDA 4DV6E 4DUZE 4F9CB 1RQ0A 3EPJA 3OMLA 2YT4A 4WSGA 4WSPA 3T1HE 1PJQA 1T4OA 1DI2A 1BBOA 2V89A 5DNYA 3HPSA 2UXCE 2DIXA 4Q35B 2EOHA 3RMPA 1EH7A 4BBYA 3BGHA 5T6JA 3DJWA 4IJDA 5IT9C 1HNWE 4DKKA 4X64E 3C6MA 2HHHE 5KL5A 1ZR9A 4DV7E 4DV5E 2EOSA 4JV5E 4DMIA 2EMAA 2VRDA 2MDRA 5KL7A 2ENCA 3J80C 2V87A 2CPNA 2RS7A 1YYOA 5IXMB 1JK2A 2ADRA 4B3TE 2DB2A 4ZYGA 2LV2A 5TSEA 4M2ZA 2D9HA 3ADJA 4BS9A 5ADZA 2DSYA 4JI4E 3P1XA 2Q8UA 1WHQA 2EM9A 5F3WA 4JI0E 1UILA 4X8WA 2EPZA 2LVHA 2YPNA 1NEIA 4BMJA 2EE8A 2L2NA 1GQEA 3ZOQB 2YSOA 1BBGA 3HQ1A 3EPKA 1DGCA 2EMFA 3KZZA 2L92A 2EMGA 2KOUA 1YSAC 2EL6A 4DV0E 1ZBQA 4X65E 1A1FA 4HTGA 1N32E 1X6FA 2ELYA 5AE1A 2MC6A 2LO3A 1XNQE 2YU5A 2EOMA 4JI1E 4P78A 2MDGA 3F6HA 2F4VE 4R2CA 2EL4A 2EN1A 2EMZA 1BB8A 2A25A 1LLMC 2JXPA 4HEIA 5A69A 1L4SA 2EJ4A 4F9AB 1O0WA 1X49A 1TF6A 2FGGA 2WBSA 1AH5A 1QU6A 4FK5C 3IWBA 4R2AA 4DV3E 3JU0A 2HJJA 2FTXB 2LBSB 2JP9A 1GTKA 1FJGE 4X62E 2L6MA 2IHR1 4L8NA 2YRKA 3JAMC 2ODRC 1EH6A 5AC4A 4JI2E 1WRJA 2K4VA 2L8TA 2LMZA 4WPYA 2M1SA 2JOBA 2EZ6A 4O24A 1N36E 1WJPA 4NZVA 2JYAA 4JI6E 2YU8A 4DR2E 2R1FA 3L00A 2PRTA 1FKAE 3MSWA 1STUA 2BBGA 2EPRA 4F54A 3ECRA 2LJHA 2YTQA 4RH8A 2EOEA 5A2QC 1IBKE 3THNA 3HXLA 2EQ0A
chains in the Genus database with same CATH topology
2DRPA 3M99B 2CTDA 2EN6A 2LV2A 4GZNC 1A1IA 2DLQA 2EPPA 2D9HA 4R2EA 2EPCA 1TF3A 1RMDA 1A1GA 2WBTA 2I13A 3EPHA 1NCSA 4R2SA 2EM8A 2EM9A 1YUIA 2EN2A 2YTFA 2YTGA 2EPZA 2WBUA 1X3CA 2EL5A 2LVHA 1ZAAC 2EN3A 2YTNA 1G2FC 2EE8A 2EM2A 2YTEA 5KL4A 4R2RA 2LCEA 2EPXA 2YSOA 2EN7A 3EPKA 1DGCA 2EMFA 2EN8A 4R2PA 2EMGA 5KL2A 2EM3A 2EOYA 1YSAC 2EOQA 2EL6A 4R2QA 2WCC3 1X6HA 2EMKA 2ENHA 2YTPA 3MHHC 2EM0A 2YRMA 1A1FA 5KL6A 1A1HA 1F2IG 1G2DC 4F2JC 2EMLA 1X6FA 2EM5A 1UBDC 2ELYA 2MKDA 1MEYC 2LO3A 2YTIA 2DGCA 2YU5A 2EMBA 2EOMA 1YUJA 2MDGA 4F6MA 2YTOA 2EMYA 4IS1C 2CSHA 2YSPA 4R2CA 2GLIA 2YTDA 2M9AA 2EQ1A 2EMCA 2EL4A 5KL3A 2EOJA 3EPLA 2EMXA 2YTJA 1Z1BA 4M9VC 2EN1A 2EMZA 1BB8A 2MKNA 2A25A 1LLMC 2YRHA 2EJ4A 2EM6A 3UK3C 2EPAA 1TF6A 2RSIA 2EOXA 1X6EA 2WBSA 2EMHA 2EM4A 3VHTB 4FK5C 2EMIA 4R2AA 3EPJA 1ZU1A 2CT1A 2ELZA 2EM7A 4WSGA 1P47A 4R2DA 1A1KA 2LT7A 4X9JA 2ENAA 1KJKA 1A1LA 1BBOA 2JP9A 2EPUA 2YRKA 2EOHA 2EMWA 2EQ3A 4IJDA 1B69A 2E72A 2EOIA 5KL5A 1JK1A 2BB8A 1ZR9A 1WJPA 2EOSA 2RPCA 2YU8A 2R1FA 2EP3A 3MHSC 2PRTA 2J7JA 2EMAA 2VRDA 2EPRA 2EORA 2HGHA 2EOZA 2YTQA 5KL7A 2ENCA 2EOFA 2EOOA 2NABA 1X5WA 1TN9A 1UN6B 2DMIA 4F6NA 2EN4A 2EOEA 2DLKA 1JK2A 2ADRA 1A1JA 2EQ0A 1AAYA 2GHFA 2JPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRP A;  3M99 B;  2CTD A;  2EN6 A;  2LV2 A;  4GZN C;  1A1I A;  2DLQ A;  2EPP A;  2D9H A;  4R2E A;  2EPC A;  1TF3 A;  1RMD A;  1A1G A;  2WBT A;  2I13 A;  3EPH A;  1NCS A;  4R2S A;  2EM8 A;  2EM9 A;  1YUI A;  2EN2 A;  2YTF A;  2YTG A;  2EPZ A;  2WBU A;  1X3C A;  2EL5 A;  2LVH A;  1ZAA C;  2EN3 A;  2YTN A;  1G2F C;  2EE8 A;  2EM2 A;  2YTE A;  5KL4 A;  4R2R A;  2LCE A;  2EPX A;  2YSO A;  2EN7 A;  3EPK A;  1DGC A;  2EMF A;  2EN8 A;  4R2P A;  2EMG A;  5KL2 A;  2EM3 A;  2EOY A;  1YSA C;  2EOQ A;  2EL6 A;  4R2Q A;  2WCC 3;  1X6H A;  2EMK A;  2ENH A;  2YTP A;  3MHH C;  2EM0 A;  2YRM A;  1A1F A;  5KL6 A;  1A1H A;  1F2I G;  1G2D C;  4F2J C;  2EML A;  1X6F A;  2EM5 A;  1UBD C;  2ELY A;  2MKD A;  1MEY C;  2LO3 A;  2YTI A;  2DGC A;  2YU5 A;  2EMB A;  2EOM A;  1YUJ A;  2MDG A;  4F6M A;  2YTO A;  2EMY A;  4IS1 C;  2CSH A;  2YSP A;  4R2C A;  2GLI A;  2YTD A;  2M9A A;  2EQ1 A;  2EMC A;  2EL4 A;  5KL3 A;  2EOJ A;  3EPL A;  2EMX A;  2YTJ A;  1Z1B A;  4M9V C;  2EN1 A;  2EMZ A;  1BB8 A;  2MKN A;  2A25 A;  1LLM C;  2YRH A;  2EJ4 A;  2EM6 A;  3UK3 C;  2EPA A;  1TF6 A;  2RSI A;  2EOX A;  1X6E A;  2WBS A;  2EMH A;  2EM4 A;  3VHT B;  4FK5 C;  2EMI A;  4R2A A;  3EPJ A;  1ZU1 A;  2CT1 A;  2ELZ A;  2EM7 A;  4WSG A;  1P47 A;  4R2D A;  1A1K A;  2LT7 A;  4X9J A;  2ENA A;  1KJK A;  1A1L A;  1BBO A;  2JP9 A;  2EPU A;  2YRK A;  2EOH A;  2EMW A;  2EQ3 A;  4IJD A;  1B69 A;  2E72 A;  2EOI A;  5KL5 A;  1JK1 A;  2BB8 A;  1ZR9 A;  1WJP A;  2EOS A;  2RPC A;  2YU8 A;  2R1F A;  2EP3 A;  3MHS C;  2PRT A;  2J7J A;  2EMA A;  2VRD A;  2EPR A;  2EOR A;  2HGH A;  2EOZ A;  2YTQ A;  5KL7 A;  2ENC A;  2EOF A;  2EOO A;  2NAB A;  1X5W A;  1TN9 A;  1UN6 B;  2DMI A;  4F6N A;  2EN4 A;  2EOE A;  2DLK A;  1JK2 A;  2ADR A;  1A1J A;  2EQ0 A;  1AAY A;  2GHF A;  2JPA A; 
#chains in the Genus database with same CATH topology
 3M99 B;  3DF6 A;  4LF7 E;  2EN6 A;  2FV4 B;  2ODR D;  1A1I A;  2B3T B;  2RTX A;  4BHC A;  2MC5 A;  4DV2 E;  1TF3 A;  4KHP E;  2GPI A;  2I13 A;  2WBT A;  5BR8 E;  4KZS A;  3EPH A;  4R2S A;  2EM8 A;  4DR3 E;  1EKZ A;  2EN2 A;  2YTF A;  2YTG A;  2L2M A;  4DR7 E;  3BID A;  2E5L E;  2HC5 A;  4I8O A;  4R2R A;  4LF6 E;  2VQF E;  2EPX A;  2RS6 A;  2E1M A;  2EN8 A;  4WFT A;  3THO B;  4P7D A;  5KL2 A;  4GKJ E;  1EH8 A;  4O43 A;  4BC9 A;  2EOQ A;  4LFA E;  3HTX A;  1X6H A;  1J5E E;  2YTP A;  4JI7 E;  3JTZ A;  4YY3 E;  2EM0 A;  4GEQ B;  2EPK X;  1N33 E;  3HPZ A;  2MKD A;  4J8Z A;  2R76 A;  2KON A;  2YTO A;  2LTR A;  2NUF A;  4IS1 C;  4DR6 E;  4DR5 E;  2YTD A;  2EMC A;  4F9B B;  5A6B D;  4LF5 E;  5AAS A;  2EPN A;  3KZY A;  1T4N A;  3VYY A;  1ZBT A;  1QNT A;  2MKN A;  4YHH E;  2G7H A;  3UK3 C;  2F8B A;  5CFF E;  2RSI A;  4LU9 A;  2RQL A;  1WHN A;  1IBM E;  2CT1 A;  2EM7 A;  2EPO A;  1YYW A;  4WXD A;  4R2D A;  2ZM6 E;  1I94 E;  1A1K A;  2LT7 A;  2ENA A;  4JI3 E;  1A1L A;  1HR0 E;  1KJK A;  3LML A;  1IQO A;  1IMU A;  2EPU A;  4LF8 E;  2EMW A;  2EQ3 A;  3C4T A;  4OX9 E;  2EOI A;  4TUI A;  4R8O A;  2H36 X;  2RPC A;  1UHZ A;  2EP3 A;  3MHS C;  2J7J A;  2HGH A;  3BF2 A;  2KHX A;  2B7T A;  2NUE A;  2EOF A;  2EOO A;  2NAB A;  5A6B A;  4JYA E;  1UN6 B;  3AV0 A;  2UU9 E;  2EN4 A;  1HNZ E;  1KYQ A;  1A1J A;  1AAY A;  1PJS A;  2DRP A;  4L5N C;  2CTD A;  3C6K A;  4GZN C;  4MLV A;  5LMU E;  4DR1 E;  2N3H A;  4DR4 E;  1A1G A;  5AE2 A;  1NCS A;  4O4K A;  2VQE E;  2UUC E;  1X3C A;  1ZAA C;  2EN3 A;  1G2F C;  2YTE A;  5KL4 A;  2LCE A;  2LTS A;  2NUG A;  2EN7 A;  2JWO A;  1X48 A;  2EM3 A;  2LE2 A;  2EOY A;  1X47 A;  3LLH A;  2EMK A;  3J81 C;  2L2K B;  4NXN E;  2YRM A;  5KL6 A;  2JY9 A;  1A1H A;  1G2D C;  4B3S E;  2EM5 A;  1UBD C;  4O5G A;  1YYK A;  3OTO E;  1GZ6 A;  2VE7 C;  5AE3 A;  2YTI A;  1MEY C;  4NXM E;  2EMB A;  4F6M A;  1YFH A;  2I9I A;  2EMY A;  1T38 A;  2RSM A;  4GKK E;  2EQ1 A;  4ZYH A;  2N8X A;  5LLQ A;  3VK6 A;  5FLX C;  2EOX A;  2EM4 A;  3VHT B;  2EMI A;  1ZU1 A;  2ELZ A;  3T1Y E;  2N3G A;  1P47 A;  1XMQ E;  4BCA A;  3FIG A;  4X9J A;  3VYX A;  2B9D A;  2JR1 A;  4TUG A;  1B69 A;  1IBL E;  2V85 A;  3ADL A;  2E72 A;  5LL6 R;  2BB8 A;  1JK1 A;  2UXD E;  2UXB E;  1SR9 A;  2L3C A;  4AQY E;  4ZYD A;  4X66 E;  2EOR A;  2EOZ A;  4M30 A;  1MGT A;  1T4L B;  3K6Q A;  1X5W A;  1TN9 A;  5A6A A;  2DMI A;  3AUZ A;  4F6N A;  5A6J A;  4LFB E;  2NA2 A;  2DLK A;  3KWR A;  4B3R E;  2UUB E;  2GHF A;  2JPA A;  3H09 A;  5AC5 A;  2DLQ A;  2EPP A;  3C4B A;  3QG5 C;  4WX9 A;  3J7A G;  2V86 A;  4DV4 E;  4R2E A;  2EPC A;  2L3J A;  1RMD A;  4KWY A;  1YUI A;  3IWC A;  2LUQ A;  5IV8 B;  1WXR A;  2WBU A;  2B7V A;  2EL5 A;  2YZT A;  1PDA A;  2YTN A;  4OOG C;  2WZO A;  2EM2 A;  1N3G A;  4WXC A;  4BC7 A;  4B3M E;  2EPM X;  5A6K A;  3J7Y p;  4R2P A;  1T39 A;  2K7I A;  1SFE A;  4BHB A;  3ADG A;  1HNX E;  4R2Q A;  1XMO E;  2WCC 3;  3BBG A;  4K0K E;  4LTY A;  4DV1 E;  2LJU A;  2ENH A;  2LUP B;  2JOX A;  3ADI A;  4ZYE A;  3MHH C;  4Q28 A;  4RHB B;  1YPN A;  1F2I G;  2YWQ A;  3EQ1 A;  4F2J C;  2EML A;  3F6G A;  4LF9 E;  2V88 A;  2DGC A;  4WYQ B;  1YUJ A;  2JVA A;  1YZ9 A;  4JI8 E;  4R03 A;  2UUA E;  2V83 A;  2DMY A;  2CSH A;  2YSP A;  2GLI A;  4MLQ A;  4NHR A;  2M9A A;  1DQ3 A;  2V8Q B;  5KL3 A;  1RC7 A;  1N34 E;  4LF4 E;  2EOJ A;  3EPL A;  1XNR E;  2EMX A;  2YTJ A;  3TQM A;  1Z1B A;  4M9V C;  5LMN E;  4JI5 E;  2L33 A;  2M7Q A;  2EWL A;  1PJT A;  2YRH A;  2EPL X;  1PKP A;  2EM6 A;  4DUY E;  2LRS A;  2VF1 A;  4N4R B;  4LFC E;  1J26 A;  4M0V A;  2EPA A;  1IQS A;  5IWA E;  1X6E A;  2EMH A;  2M4I A;  3IWD A;  4DV6 E;  4DUZ E;  4F9C B;  1RQ0 A;  3EPJ A;  3OML A;  2YT4 A;  4WSG A;  4WSP A;  3T1H E;  1PJQ A;  1T4O A;  1DI2 A;  1BBO A;  2V89 A;  5DNY A;  3HPS A;  2UXC E;  2DIX A;  4Q35 B;  2EOH A;  3RMP A;  1EH7 A;  4BBY A;  3BGH A;  5T6J A;  3DJW A;  4IJD A;  5IT9 C;  1HNW E;  4DKK A;  4X64 E;  3C6M A;  2HHH E;  5KL5 A;  1ZR9 A;  4DV7 E;  4DV5 E;  2EOS A;  4JV5 E;  4DMI A;  2EMA A;  2VRD A;  2MDR A;  5KL7 A;  2ENC A;  3J80 C;  2V87 A;  2CPN A;  2RS7 A;  1YYO A;  5IXM B;  1JK2 A;  2ADR A;  4B3T E;  2DB2 A;  4ZYG A;  2LV2 A;  5TSE A;  4M2Z A;  2D9H A;  3ADJ A;  4BS9 A;  5ADZ A;  2DSY A;  4JI4 E;  3P1X A;  2Q8U A;  1WHQ A;  2EM9 A;  5F3W A;  4JI0 E;  1UIL A;  4X8W A;  2EPZ A;  2LVH A;  2YPN A;  1NEI A;  4BMJ A;  2EE8 A;  2L2N A;  1GQE A;  3ZOQ B;  2YSO A;  1BBG A;  3HQ1 A;  3EPK A;  1DGC A;  2EMF A;  3KZZ A;  2L92 A;  2EMG A;  2KOU A;  1YSA C;  2EL6 A;  4DV0 E;  1ZBQ A;  4X65 E;  1A1F A;  4HTG A;  1N32 E;  1X6F A;  2ELY A;  5AE1 A;  2MC6 A;  2LO3 A;  1XNQ E;  2YU5 A;  2EOM A;  4JI1 E;  4P78 A;  2MDG A;  3F6H A;  2F4V E;  4R2C A;  2EL4 A;  2EN1 A;  2EMZ A;  1BB8 A;  2A25 A;  1LLM C;  2JXP A;  4HEI A;  5A69 A;  1L4S A;  2EJ4 A;  4F9A B;  1O0W A;  1X49 A;  1TF6 A;  2FGG A;  2WBS A;  1AH5 A;  1QU6 A;  4FK5 C;  3IWB A;  4R2A A;  4DV3 E;  3JU0 A;  2HJJ A;  2FTX B;  2LBS B;  2JP9 A;  1GTK A;  1FJG E;  4X62 E;  2L6M A;  2IHR 1;  4L8N A;  2YRK A;  3JAM C;  2ODR C;  1EH6 A;  5AC4 A;  4JI2 E;  1WRJ A;  2K4V A;  2L8T A;  2LMZ A;  4WPY A;  2M1S A;  2JOB A;  2EZ6 A;  4O24 A;  1N36 E;  1WJP A;  4NZV A;  2JYA A;  4JI6 E;  2YU8 A;  4DR2 E;  2R1F A;  3L00 A;  2PRT A;  1FKA E;  3MSW A;  1STU A;  2BBG A;  2EPR A;  4F54 A;  3ECR A;  2LJH A;  2YTQ A;  4RH8 A;  2EOE A;  5A2Q C;  1IBK E;  3THN A;  3HXL A;  2EQ0 A; 
#chains in the Genus database with same CATH homology
 2DRP A;  3M99 B;  2CTD A;  2EN6 A;  2LV2 A;  4GZN C;  1A1I A;  2DLQ A;  2EPP A;  2D9H A;  4R2E A;  2EPC A;  1TF3 A;  1RMD A;  1A1G A;  2WBT A;  2I13 A;  3EPH A;  1NCS A;  4R2S A;  2EM8 A;  2EM9 A;  1YUI A;  2EN2 A;  2YTF A;  2YTG A;  2EPZ A;  2WBU A;  1X3C A;  2EL5 A;  2LVH A;  1ZAA C;  2EN3 A;  2YTN A;  1G2F C;  2EE8 A;  2EM2 A;  2YTE A;  5KL4 A;  4R2R A;  2LCE A;  2EPX A;  2YSO A;  2EN7 A;  3EPK A;  1DGC A;  2EMF A;  2EN8 A;  4R2P A;  2EMG A;  5KL2 A;  2EM3 A;  2EOY A;  1YSA C;  2EOQ A;  2EL6 A;  4R2Q A;  2WCC 3;  1X6H A;  2EMK A;  2ENH A;  2YTP A;  3MHH C;  2EM0 A;  2YRM A;  1A1F A;  5KL6 A;  1A1H A;  1F2I G;  1G2D C;  4F2J C;  2EML A;  1X6F A;  2EM5 A;  1UBD C;  2ELY A;  2MKD A;  1MEY C;  2LO3 A;  2YTI A;  2DGC A;  2YU5 A;  2EMB A;  2EOM A;  1YUJ A;  2MDG A;  4F6M A;  2YTO A;  2EMY A;  4IS1 C;  2CSH A;  2YSP A;  4R2C A;  2GLI A;  2YTD A;  2M9A A;  2EQ1 A;  2EMC A;  2EL4 A;  5KL3 A;  2EOJ A;  3EPL A;  2EMX A;  2YTJ A;  1Z1B A;  4M9V C;  2EN1 A;  2EMZ A;  1BB8 A;  2MKN A;  2A25 A;  1LLM C;  2YRH A;  2EJ4 A;  2EM6 A;  3UK3 C;  2EPA A;  1TF6 A;  2RSI A;  2EOX A;  1X6E A;  2WBS A;  2EMH A;  2EM4 A;  3VHT B;  4FK5 C;  2EMI A;  4R2A A;  3EPJ A;  1ZU1 A;  2CT1 A;  2ELZ A;  2EM7 A;  4WSG A;  1P47 A;  4R2D A;  1A1K A;  2LT7 A;  4X9J A;  2ENA A;  1KJK A;  1A1L A;  1BBO A;  2JP9 A;  2EPU A;  2YRK A;  2EOH A;  2EMW A;  2EQ3 A;  4IJD A;  1B69 A;  2E72 A;  2EOI A;  5KL5 A;  1JK1 A;  2BB8 A;  1ZR9 A;  1WJP A;  2EOS A;  2RPC A;  2YU8 A;  2R1F A;  2EP3 A;  3MHS C;  2PRT A;  2J7J A;  2EMA A;  2VRD A;  2EPR A;  2EOR A;  2HGH A;  2EOZ A;  2YTQ A;  5KL7 A;  2ENC A;  2EOF A;  2EOO A;  2NAB A;  1X5W A;  1TN9 A;  1UN6 B;  2DMI A;  4F6N A;  2EN4 A;  2EOE A;  2DLK A;  1JK2 A;  2ADR A;  1A1J A;  2EQ0 A;  1AAY A;  2GHF A;  2JPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...