2LVHA

Solution structure of the zinc finger afv1p06 protein from the hyperthermophilic archaeal virus afv1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
45
structure length
45
Chain Sequence
MERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative zinc finger protein ORF59a
publication title Solution structure of an archaeal DNA binding protein with an eukaryotic zinc finger fold.
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Metal binding protein
total genus 10
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2012-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lvhA00
2RSIA 2D9HA 1UBDC 1A1GA 2YTPA 4R2AA 2EMHA 1JK1A 1X6FA 4F6NA 1G2DC 2EPAA 2HGHA 1A1IA 2EOZA 2YTIA 2DLKA 2J7JA 2ELYA 2DRPA 2EN7A 1G2FC 1DGCA 1RMDA 2YTGA 2MKDA 5KL6A 1AAYA 2EOHA 2EN6A 1YSAC 1WJPA 2EN3A 2EM0A 2CTDA 2LVHA 1YUIA 2EOOA 2EOEA 2LT7A 2EM3A 2EM9A 2ENAA 5KL5A 1KJKA 4FK5C 1ZAAC 2EMGA 1A1FA 2M9AA 2GHFA 2EPXA 2CT1A 2EMBA 2DGCA 2EJ4A 4R2PA 1X5WA 2EM2A 2EOQA 2EMYA 4F6MA 1JK2A 2EN1A 2EOFA 2NABA 2EMFA 3EPJA 1LLMC 2EOXA 2EOMA 1A1JA 5KL7A 2YTNA 2EQ3A 2WBTA 1MEYC 1ZU1A 2YSOA 3VHTB 2GLIA 2YTEA 1X6EA 4R2CA 1YUJA 2E72A 1X6HA 2DLQA 2BB8A 2LO3A 1TF3A 2CSHA 2EMLA 4M9VC 1P47A 2EOIA 2JP9A 2EPPA 2ENCA 2EPZA 1A1LA 5KL4A 2MDGA 1BB8A 2EOSA 1ZR9A 2JPAA 2YTOA 2MKNA 2ENHA 1Z1BA 3MHHC 4R2EA 2EMIA 2VRDA 4GZNC 2A25A 1UN6B 2EOJA 2R1FA 3EPHA 2YTFA 2EOYA 1X3CA 4R2RA 2EPRA 2EP3A 1NCSA 3EPKA 2EM6A 2WBUA 2YRHA 2EN8A 1F2IG 3UK3C 2EL4A 1TN9A 2YTQA 2EMWA 4WSGA 4IS1C 3M99B 5KL3A 1TF6A 2EMAA 2ADRA 2PRTA 2YRMA 2EMKA 2YRKA 4R2QA 2EE8A 2EL6A 2YTDA 1A1HA 1B69A 2EM8A 2EPCA 2EM7A 3MHSC 2DMIA 2EMZA 2EORA 2YTJA 2YU8A 3EPLA 4R2SA 2EM5A 2YSPA 2EN2A 2YU5A 2EM4A 2EQ1A 2EN4A 4IJDA 2WBSA 2RPCA 2LCEA 2LV2A 5KL2A 1A1KA 1BBOA 2EPUA 4R2DA 4X9JA 2EMCA 4F2JC 2ELZA 2I13A 2EMXA 2EL5A 2WCC3 2EQ0A
chains in the Genus database with same CATH superfamily
2BBGA 1UBDC 1YPNA 2EZ6A 2KHXA 2EMHA 4I8OA 2HGHA 3H09A 3K6QA 1EKZA 2LTRA 4JI4E 4WXCA 2DLKA 2EN7A 1G2FC 4R8OA 2GPIA 1YZ9A 4DR1E 4HEIA 2EN6A 1GZ6A 2ODRC 2JR1A 1WJPA 3J81C 3MSWA 2L2MA 3EQ1A 1IQSA 5FLXC 2EM3A 2EPKX 2EMGA 2LMZA 2L92A 2NA2A 5A6BA 1FKAE 4R2PA 1EH8A 2EMYA 2EOFA 4NZVA 1WHQA 5A6KA 2EOXA 4O24A 2EOMA 2EPMX 2V86A 4NXNE 1MEYC 2JOXA 4LF4E 2JVAA 2K7IA 1YFHA 2UUBE 4DKKA 3P1XA 2FGGA 2EMLA 2YZTA 4TUGA 4N4RB 2EPZA 2LE2A 5KL4A 2MDGA 1WHNA 1BB8A 1Z1BA 5AC5A 4DR7E 2V85A 4P7DA 4TUIA 2LUPB 2EOYA 4BMJA 1NCSA 5AASA 1TN9A 2MC6A 4IS1C 2RS7A 1SFEA 1IBLE 1STUA 1TF6A 2EMKA 4R2QA 1A1HA 1B69A 4NXME 3C4BA 2EM8A 3IWBA 4ZYHA 1YYKA 2EPCA 3JTZA 2M7QA 4M30A 2EM7A 4JI3E 4WXDA 5LMNE 1FJGE 2EMZA 2YU8A 2JY9A 2LTSA 4M2ZA 4DV6E 1X48A 2YSPA 2EM4A 2EQ1A 1IBKE 1SR9A 1T4OA 1N3GA 1X49A 4JI7E 5KL2A 5ADZA 2EMCA 2G7HA 2EMXA 2EL5A 2L3CA 2L8TA 3LLHA 2LBSB 1A1GA 2DMYA 2YTPA 5CFFE 4LF7E 1X6FA 4X8WA 2EPAA 2YWQA 3FIGA 2H36X 2V87A 1ZBTA 2J7JA 4JI8E 1XMQE 1DGCA 2ODRD 2YTGA 2VQEE 2L6MA 2MKDA 5A6AA 5KL6A 1AAYA 1HNXE 2EOHA 1YSAC 1WRJA 2EN3A 2EOEA 2LT7A 5IV8B 3KZZA 3HQ1A 4FK5C 3C4TA 2VE7C 4R03A 1ZAAC 1HNZE 1GQEA 3F6GA 4O4KA 2B9DA 2CT1A 4B3TE 2DGCA 3VYXA 1GTKA 1X5WA 5F3WA 2EM2A 2CPNA 5LL6R 2EN1A 5AE3A 1O0WA 1IQOA 5KL7A 2JWOA 2EQ3A 2WBTA 2YSOA 4DR6E 1EH6A 3VHTB 4KHPE 2GLIA 2K4VA 2RTXA 1X6HA 4ZYDA 3HPSA 2M1SA 4BHCA 4M9VC 2UUAE 1L4SA 4KWYA 4WPYA 2N3HA 2UUCE 3AV0A 2ENHA 4DV3E 2F8BA 2LJHA 1UILA 2YT4A 2VRDA 4DV1E 2IHR1 4DR4E 4BC9A 2A25A 1EH7A 4NHRA 4LTYA 3T1HE 4L8NA 2EPRA 3EPKA 1KYQA 2EM6A 2FV4B 4O5GA 2JOBA 2WBUA 2NUEA 1YYWA 2B7TA 1QNTA 2ZM6E 5KL3A 2ADRA 2PRTA 2YRMA 2YRKA 2EE8A 4WYQB 3ZOQB 3MHSC 1UHZA 2EORA 3EPLA 2V8QB 4DV2E 3ADIA 2YU5A 2RSMA 4LFBE 1N36E 2LCEA 3HXLA 5IXMB 4X65E 2UXBE 2ELZA 3RMPA 3J7AG 4DMIA 2WCC3 1X47A 3T1YE 3VK6A 2DIXA 2HHHE 4Q35B 4GKJE 5A6BD 5AE1A 4YHHE 1A1IA 2EOZA 2DRPA 2UXCE 2V89A 5BR8E 4DR3E 4RHBB 4BS9A 5AC4A 1RMDA 3KZYA 3THOB 4DV7E 4BBYA 4LF6E 2EPLX 5T6JA 2JXPA 2EM0A 2LVHA 5IWAE 1YUIA 2EOOA 4LFAE 4DR5E 2EM9A 5KL5A 2E5LE 1XNRE 2EWLA 4MLQA 4RH8A 3HPZA 2KONA 2GHFA 1N33E 2EMBA 3OMLA 1XMOE 1YYOA 4YY3E 2EOQA 2YPNA 4F6MA 4ZYEA 2L2NA 4LF5E 5A6JA 2RS6A 1DI2A 4JI1E 2LUQA 1DQ3A 3EPJA 3DF6A 2E1MA 2LRSA 2Q8UA 4AQYE 2YTEA 1IBME 1X6EA 2F4VE 4R2CA 1N32E 2KOUA 2UXDE 1QU6A 2BB8A 4F9AB 3AUZA 1TF3A 4OOGC 3C6KA 1P47A 1NEIA 2EOIA 2EPPA 2ENCA 4JI0E 3OTOE 1A1LA 2EOSA 3C6MA 4DUYE 4R2EA 2EMIA 1ZBQA 4F9BB 1UN6B 3EPHA 2EOJA 2R1FA 3BBGA 5AE2A 2YTFA 1X3CA 4R2RA 2EP3A 3JU0A 2YRHA 2B7VA 4JV5E 3UK3C 4WSGA 4LFCE 2EMAA 2VF1A 1N34E 4HTGA 2EL6A 3LMLA 3KWRA 2VQFE 4DV5E 4DR2E 2HC5A 1PJSA 2YTJA 4JI2E 4R2SA 1RC7A 1IMUA 4IJDA 1PDAA 1MGTA 2EN4A 2L2KB 3VYYA 2RQLA 2LV2A 2R76A 1I94E 5LMUE 1XNQE 2EPUA 4R2DA 4DV4E 3BF2A 2I13A 4OX9E 2V83A 2NUGA 3ADLA 1AH5A 2RSIA 2D9HA 4K0KE 2EPNA 5DNYA 4X62E 2N3GA 1HNWE 4R2AA 1J5EE 1JK1A 2UU9E 4LF8E 4F6NA 1G2DC 3HTXA 4O43A 4B3ME 1T4LB 2V88A 2YTIA 1PKPA 3BGHA 2ELYA 4P78A 2L33A 4Q28A 5LLQA 1T4NA 2WZOA 2CTDA 3L00A 2I9IA 2ENAA 2HJJA 1KJKA 1A1FA 3TQMA 2N8XA 2M9AA 4DV0E 1J26A 2EPXA 4B3SE 2EJ4A 2JYAA 2L3JA 1JK2A 4M0VA 2NABA 2EMFA 4KZSA 1LLMC 1RQ0A 1A1JA 3BIDA 2DSYA 2YTNA 1ZU1A 4B3RE 4X64E 4F9CB 3F6HA 1T39A 4L5NC 2B3TB 3IWDA 1YUJA 2E72A 2LJUA 2DLQA 4BCAA 2LO3A 1PJTA 3THNA 2MC5A 2NUFA 2CSHA 4MLVA 3QG5C 3JAMC 4JYAE 2JP9A 3J80C 4JI6E 5A69A 1ZR9A 4F54A 4JI5E 4WSPA 4BHBA 2YTOA 2JPAA 4WX9A 2MKNA 2M4IA 3MHHC 4LF9E 3ECRA 4LU9A 4GZNC 4J8ZA 2MDRA 2EN8A 1F2IG 2EL4A 3IWCA 2YTQA 2EMWA 5IT9C 3M99B 1PJQA 5A2QC 2YTDA 3ADJA 1T38A 2DMIA 4ZYGA 4GKKE 1BBGA 4DUZE 3J7Yp 2FTXB 2EM5A 2EN2A 4GEQB 4WFTA 2WBSA 2RPCA 3ADGA 3DJWA 1A1KA 1BBOA 4BC7A 2EPOA 4X9JA 1WXRA 2DB2A 1HR0E 5TSEA 4F2JC 4X66E 2EQ0A
chains in the Genus database with same CATH topology
2RSIA 2D9HA 1UBDC 1A1GA 2YTPA 4R2AA 2EMHA 1JK1A 1X6FA 4F6NA 1G2DC 2EPAA 2HGHA 1A1IA 2EOZA 2YTIA 2DLKA 2J7JA 2ELYA 2DRPA 2EN7A 1G2FC 1DGCA 1RMDA 2YTGA 2MKDA 5KL6A 1AAYA 2EOHA 2EN6A 1YSAC 1WJPA 2EN3A 2EM0A 2CTDA 2LVHA 1YUIA 2EOOA 2EOEA 2LT7A 2EM3A 2EM9A 2ENAA 5KL5A 1KJKA 4FK5C 1ZAAC 2EMGA 1A1FA 2M9AA 2GHFA 2EPXA 2CT1A 2EMBA 2DGCA 2EJ4A 4R2PA 1X5WA 2EM2A 2EOQA 2EMYA 4F6MA 1JK2A 2EN1A 2EOFA 2NABA 2EMFA 3EPJA 1LLMC 2EOXA 2EOMA 1A1JA 5KL7A 2YTNA 2EQ3A 2WBTA 1MEYC 1ZU1A 2YSOA 3VHTB 2GLIA 2YTEA 1X6EA 4R2CA 1YUJA 2E72A 1X6HA 2DLQA 2BB8A 2LO3A 1TF3A 2CSHA 2EMLA 4M9VC 1P47A 2EOIA 2JP9A 2EPPA 2ENCA 2EPZA 1A1LA 5KL4A 2MDGA 1BB8A 2EOSA 1ZR9A 2JPAA 2YTOA 2MKNA 2ENHA 1Z1BA 3MHHC 4R2EA 2EMIA 2VRDA 4GZNC 2A25A 1UN6B 2EOJA 2R1FA 3EPHA 2YTFA 2EOYA 1X3CA 4R2RA 2EPRA 2EP3A 1NCSA 3EPKA 2EM6A 2WBUA 2YRHA 2EN8A 1F2IG 3UK3C 2EL4A 1TN9A 2YTQA 2EMWA 4WSGA 4IS1C 3M99B 5KL3A 1TF6A 2EMAA 2ADRA 2PRTA 2YRMA 2EMKA 2YRKA 4R2QA 2EE8A 2EL6A 2YTDA 1A1HA 1B69A 2EM8A 2EPCA 2EM7A 3MHSC 2DMIA 2EMZA 2EORA 2YTJA 2YU8A 3EPLA 4R2SA 2EM5A 2YSPA 2EN2A 2YU5A 2EM4A 2EQ1A 2EN4A 4IJDA 2WBSA 2RPCA 2LCEA 2LV2A 5KL2A 1A1KA 1BBOA 2EPUA 4R2DA 4X9JA 2EMCA 4F2JC 2ELZA 2I13A 2EMXA 2EL5A 2WCC3 2EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSI A;  2D9H A;  1UBD C;  1A1G A;  2YTP A;  4R2A A;  2EMH A;  1JK1 A;  1X6F A;  4F6N A;  1G2D C;  2EPA A;  2HGH A;  1A1I A;  2EOZ A;  2YTI A;  2DLK A;  2J7J A;  2ELY A;  2DRP A;  2EN7 A;  1G2F C;  1DGC A;  1RMD A;  2YTG A;  2MKD A;  5KL6 A;  1AAY A;  2EOH A;  2EN6 A;  1YSA C;  1WJP A;  2EN3 A;  2EM0 A;  2CTD A;  2LVH A;  1YUI A;  2EOO A;  2EOE A;  2LT7 A;  2EM3 A;  2EM9 A;  2ENA A;  5KL5 A;  1KJK A;  4FK5 C;  1ZAA C;  2EMG A;  1A1F A;  2M9A A;  2GHF A;  2EPX A;  2CT1 A;  2EMB A;  2DGC A;  2EJ4 A;  4R2P A;  1X5W A;  2EM2 A;  2EOQ A;  2EMY A;  4F6M A;  1JK2 A;  2EN1 A;  2EOF A;  2NAB A;  2EMF A;  3EPJ A;  1LLM C;  2EOX A;  2EOM A;  1A1J A;  5KL7 A;  2YTN A;  2EQ3 A;  2WBT A;  1MEY C;  1ZU1 A;  2YSO A;  3VHT B;  2GLI A;  2YTE A;  1X6E A;  4R2C A;  1YUJ A;  2E72 A;  1X6H A;  2DLQ A;  2BB8 A;  2LO3 A;  1TF3 A;  2CSH A;  2EML A;  4M9V C;  1P47 A;  2EOI A;  2JP9 A;  2EPP A;  2ENC A;  2EPZ A;  1A1L A;  5KL4 A;  2MDG A;  1BB8 A;  2EOS A;  1ZR9 A;  2JPA A;  2YTO A;  2MKN A;  2ENH A;  1Z1B A;  3MHH C;  4R2E A;  2EMI A;  2VRD A;  4GZN C;  2A25 A;  1UN6 B;  2EOJ A;  2R1F A;  3EPH A;  2YTF A;  2EOY A;  1X3C A;  4R2R A;  2EPR A;  2EP3 A;  1NCS A;  3EPK A;  2EM6 A;  2WBU A;  2YRH A;  2EN8 A;  1F2I G;  3UK3 C;  2EL4 A;  1TN9 A;  2YTQ A;  2EMW A;  4WSG A;  4IS1 C;  3M99 B;  5KL3 A;  1TF6 A;  2EMA A;  2ADR A;  2PRT A;  2YRM A;  2EMK A;  2YRK A;  4R2Q A;  2EE8 A;  2EL6 A;  2YTD A;  1A1H A;  1B69 A;  2EM8 A;  2EPC A;  2EM7 A;  3MHS C;  2DMI A;  2EMZ A;  2EOR A;  2YTJ A;  2YU8 A;  3EPL A;  4R2S A;  2EM5 A;  2YSP A;  2EN2 A;  2YU5 A;  2EM4 A;  2EQ1 A;  2EN4 A;  4IJD A;  2WBS A;  2RPC A;  2LCE A;  2LV2 A;  5KL2 A;  1A1K A;  1BBO A;  2EPU A;  4R2D A;  4X9J A;  2EMC A;  4F2J C;  2ELZ A;  2I13 A;  2EMX A;  2EL5 A;  2WCC 3;  2EQ0 A; 
#chains in the Genus database with same CATH topology
 2BBG A;  1UBD C;  1YPN A;  2EZ6 A;  2KHX A;  2EMH A;  4I8O A;  2HGH A;  3H09 A;  3K6Q A;  1EKZ A;  2LTR A;  4JI4 E;  4WXC A;  2DLK A;  2EN7 A;  1G2F C;  4R8O A;  2GPI A;  1YZ9 A;  4DR1 E;  4HEI A;  2EN6 A;  1GZ6 A;  2ODR C;  2JR1 A;  1WJP A;  3J81 C;  3MSW A;  2L2M A;  3EQ1 A;  1IQS A;  5FLX C;  2EM3 A;  2EPK X;  2EMG A;  2LMZ A;  2L92 A;  2NA2 A;  5A6B A;  1FKA E;  4R2P A;  1EH8 A;  2EMY A;  2EOF A;  4NZV A;  1WHQ A;  5A6K A;  2EOX A;  4O24 A;  2EOM A;  2EPM X;  2V86 A;  4NXN E;  1MEY C;  2JOX A;  4LF4 E;  2JVA A;  2K7I A;  1YFH A;  2UUB E;  4DKK A;  3P1X A;  2FGG A;  2EML A;  2YZT A;  4TUG A;  4N4R B;  2EPZ A;  2LE2 A;  5KL4 A;  2MDG A;  1WHN A;  1BB8 A;  1Z1B A;  5AC5 A;  4DR7 E;  2V85 A;  4P7D A;  4TUI A;  2LUP B;  2EOY A;  4BMJ A;  1NCS A;  5AAS A;  1TN9 A;  2MC6 A;  4IS1 C;  2RS7 A;  1SFE A;  1IBL E;  1STU A;  1TF6 A;  2EMK A;  4R2Q A;  1A1H A;  1B69 A;  4NXM E;  3C4B A;  2EM8 A;  3IWB A;  4ZYH A;  1YYK A;  2EPC A;  3JTZ A;  2M7Q A;  4M30 A;  2EM7 A;  4JI3 E;  4WXD A;  5LMN E;  1FJG E;  2EMZ A;  2YU8 A;  2JY9 A;  2LTS A;  4M2Z A;  4DV6 E;  1X48 A;  2YSP A;  2EM4 A;  2EQ1 A;  1IBK E;  1SR9 A;  1T4O A;  1N3G A;  1X49 A;  4JI7 E;  5KL2 A;  5ADZ A;  2EMC A;  2G7H A;  2EMX A;  2EL5 A;  2L3C A;  2L8T A;  3LLH A;  2LBS B;  1A1G A;  2DMY A;  2YTP A;  5CFF E;  4LF7 E;  1X6F A;  4X8W A;  2EPA A;  2YWQ A;  3FIG A;  2H36 X;  2V87 A;  1ZBT A;  2J7J A;  4JI8 E;  1XMQ E;  1DGC A;  2ODR D;  2YTG A;  2VQE E;  2L6M A;  2MKD A;  5A6A A;  5KL6 A;  1AAY A;  1HNX E;  2EOH A;  1YSA C;  1WRJ A;  2EN3 A;  2EOE A;  2LT7 A;  5IV8 B;  3KZZ A;  3HQ1 A;  4FK5 C;  3C4T A;  2VE7 C;  4R03 A;  1ZAA C;  1HNZ E;  1GQE A;  3F6G A;  4O4K A;  2B9D A;  2CT1 A;  4B3T E;  2DGC A;  3VYX A;  1GTK A;  1X5W A;  5F3W A;  2EM2 A;  2CPN A;  5LL6 R;  2EN1 A;  5AE3 A;  1O0W A;  1IQO A;  5KL7 A;  2JWO A;  2EQ3 A;  2WBT A;  2YSO A;  4DR6 E;  1EH6 A;  3VHT B;  4KHP E;  2GLI A;  2K4V A;  2RTX A;  1X6H A;  4ZYD A;  3HPS A;  2M1S A;  4BHC A;  4M9V C;  2UUA E;  1L4S A;  4KWY A;  4WPY A;  2N3H A;  2UUC E;  3AV0 A;  2ENH A;  4DV3 E;  2F8B A;  2LJH A;  1UIL A;  2YT4 A;  2VRD A;  4DV1 E;  2IHR 1;  4DR4 E;  4BC9 A;  2A25 A;  1EH7 A;  4NHR A;  4LTY A;  3T1H E;  4L8N A;  2EPR A;  3EPK A;  1KYQ A;  2EM6 A;  2FV4 B;  4O5G A;  2JOB A;  2WBU A;  2NUE A;  1YYW A;  2B7T A;  1QNT A;  2ZM6 E;  5KL3 A;  2ADR A;  2PRT A;  2YRM A;  2YRK A;  2EE8 A;  4WYQ B;  3ZOQ B;  3MHS C;  1UHZ A;  2EOR A;  3EPL A;  2V8Q B;  4DV2 E;  3ADI A;  2YU5 A;  2RSM A;  4LFB E;  1N36 E;  2LCE A;  3HXL A;  5IXM B;  4X65 E;  2UXB E;  2ELZ A;  3RMP A;  3J7A G;  4DMI A;  2WCC 3;  1X47 A;  3T1Y E;  3VK6 A;  2DIX A;  2HHH E;  4Q35 B;  4GKJ E;  5A6B D;  5AE1 A;  4YHH E;  1A1I A;  2EOZ A;  2DRP A;  2UXC E;  2V89 A;  5BR8 E;  4DR3 E;  4RHB B;  4BS9 A;  5AC4 A;  1RMD A;  3KZY A;  3THO B;  4DV7 E;  4BBY A;  4LF6 E;  2EPL X;  5T6J A;  2JXP A;  2EM0 A;  2LVH A;  5IWA E;  1YUI A;  2EOO A;  4LFA E;  4DR5 E;  2EM9 A;  5KL5 A;  2E5L E;  1XNR E;  2EWL A;  4MLQ A;  4RH8 A;  3HPZ A;  2KON A;  2GHF A;  1N33 E;  2EMB A;  3OML A;  1XMO E;  1YYO A;  4YY3 E;  2EOQ A;  2YPN A;  4F6M A;  4ZYE A;  2L2N A;  4LF5 E;  5A6J A;  2RS6 A;  1DI2 A;  4JI1 E;  2LUQ A;  1DQ3 A;  3EPJ A;  3DF6 A;  2E1M A;  2LRS A;  2Q8U A;  4AQY E;  2YTE A;  1IBM E;  1X6E A;  2F4V E;  4R2C A;  1N32 E;  2KOU A;  2UXD E;  1QU6 A;  2BB8 A;  4F9A B;  3AUZ A;  1TF3 A;  4OOG C;  3C6K A;  1P47 A;  1NEI A;  2EOI A;  2EPP A;  2ENC A;  4JI0 E;  3OTO E;  1A1L A;  2EOS A;  3C6M A;  4DUY E;  4R2E A;  2EMI A;  1ZBQ A;  4F9B B;  1UN6 B;  3EPH A;  2EOJ A;  2R1F A;  3BBG A;  5AE2 A;  2YTF A;  1X3C A;  4R2R A;  2EP3 A;  3JU0 A;  2YRH A;  2B7V A;  4JV5 E;  3UK3 C;  4WSG A;  4LFC E;  2EMA A;  2VF1 A;  1N34 E;  4HTG A;  2EL6 A;  3LML A;  3KWR A;  2VQF E;  4DV5 E;  4DR2 E;  2HC5 A;  1PJS A;  2YTJ A;  4JI2 E;  4R2S A;  1RC7 A;  1IMU A;  4IJD A;  1PDA A;  1MGT A;  2EN4 A;  2L2K B;  3VYY A;  2RQL A;  2LV2 A;  2R76 A;  1I94 E;  5LMU E;  1XNQ E;  2EPU A;  4R2D A;  4DV4 E;  3BF2 A;  2I13 A;  4OX9 E;  2V83 A;  2NUG A;  3ADL A;  1AH5 A;  2RSI A;  2D9H A;  4K0K E;  2EPN A;  5DNY A;  4X62 E;  2N3G A;  1HNW E;  4R2A A;  1J5E E;  1JK1 A;  2UU9 E;  4LF8 E;  4F6N A;  1G2D C;  3HTX A;  4O43 A;  4B3M E;  1T4L B;  2V88 A;  2YTI A;  1PKP A;  3BGH A;  2ELY A;  4P78 A;  2L33 A;  4Q28 A;  5LLQ A;  1T4N A;  2WZO A;  2CTD A;  3L00 A;  2I9I A;  2ENA A;  2HJJ A;  1KJK A;  1A1F A;  3TQM A;  2N8X A;  2M9A A;  4DV0 E;  1J26 A;  2EPX A;  4B3S E;  2EJ4 A;  2JYA A;  2L3J A;  1JK2 A;  4M0V A;  2NAB A;  2EMF A;  4KZS A;  1LLM C;  1RQ0 A;  1A1J A;  3BID A;  2DSY A;  2YTN A;  1ZU1 A;  4B3R E;  4X64 E;  4F9C B;  3F6H A;  1T39 A;  4L5N C;  2B3T B;  3IWD A;  1YUJ A;  2E72 A;  2LJU A;  2DLQ A;  4BCA A;  2LO3 A;  1PJT A;  3THN A;  2MC5 A;  2NUF A;  2CSH A;  4MLV A;  3QG5 C;  3JAM C;  4JYA E;  2JP9 A;  3J80 C;  4JI6 E;  5A69 A;  1ZR9 A;  4F54 A;  4JI5 E;  4WSP A;  4BHB A;  2YTO A;  2JPA A;  4WX9 A;  2MKN A;  2M4I A;  3MHH C;  4LF9 E;  3ECR A;  4LU9 A;  4GZN C;  4J8Z A;  2MDR A;  2EN8 A;  1F2I G;  2EL4 A;  3IWC A;  2YTQ A;  2EMW A;  5IT9 C;  3M99 B;  1PJQ A;  5A2Q C;  2YTD A;  3ADJ A;  1T38 A;  2DMI A;  4ZYG A;  4GKK E;  1BBG A;  4DUZ E;  3J7Y p;  2FTX B;  2EM5 A;  2EN2 A;  4GEQ B;  4WFT A;  2WBS A;  2RPC A;  3ADG A;  3DJW A;  1A1K A;  1BBO A;  4BC7 A;  2EPO A;  4X9J A;  1WXR A;  2DB2 A;  1HR0 E;  5TSE A;  4F2J C;  4X66 E;  2EQ0 A; 
#chains in the Genus database with same CATH homology
 2RSI A;  2D9H A;  1UBD C;  1A1G A;  2YTP A;  4R2A A;  2EMH A;  1JK1 A;  1X6F A;  4F6N A;  1G2D C;  2EPA A;  2HGH A;  1A1I A;  2EOZ A;  2YTI A;  2DLK A;  2J7J A;  2ELY A;  2DRP A;  2EN7 A;  1G2F C;  1DGC A;  1RMD A;  2YTG A;  2MKD A;  5KL6 A;  1AAY A;  2EOH A;  2EN6 A;  1YSA C;  1WJP A;  2EN3 A;  2EM0 A;  2CTD A;  2LVH A;  1YUI A;  2EOO A;  2EOE A;  2LT7 A;  2EM3 A;  2EM9 A;  2ENA A;  5KL5 A;  1KJK A;  4FK5 C;  1ZAA C;  2EMG A;  1A1F A;  2M9A A;  2GHF A;  2EPX A;  2CT1 A;  2EMB A;  2DGC A;  2EJ4 A;  4R2P A;  1X5W A;  2EM2 A;  2EOQ A;  2EMY A;  4F6M A;  1JK2 A;  2EN1 A;  2EOF A;  2NAB A;  2EMF A;  3EPJ A;  1LLM C;  2EOX A;  2EOM A;  1A1J A;  5KL7 A;  2YTN A;  2EQ3 A;  2WBT A;  1MEY C;  1ZU1 A;  2YSO A;  3VHT B;  2GLI A;  2YTE A;  1X6E A;  4R2C A;  1YUJ A;  2E72 A;  1X6H A;  2DLQ A;  2BB8 A;  2LO3 A;  1TF3 A;  2CSH A;  2EML A;  4M9V C;  1P47 A;  2EOI A;  2JP9 A;  2EPP A;  2ENC A;  2EPZ A;  1A1L A;  5KL4 A;  2MDG A;  1BB8 A;  2EOS A;  1ZR9 A;  2JPA A;  2YTO A;  2MKN A;  2ENH A;  1Z1B A;  3MHH C;  4R2E A;  2EMI A;  2VRD A;  4GZN C;  2A25 A;  1UN6 B;  2EOJ A;  2R1F A;  3EPH A;  2YTF A;  2EOY A;  1X3C A;  4R2R A;  2EPR A;  2EP3 A;  1NCS A;  3EPK A;  2EM6 A;  2WBU A;  2YRH A;  2EN8 A;  1F2I G;  3UK3 C;  2EL4 A;  1TN9 A;  2YTQ A;  2EMW A;  4WSG A;  4IS1 C;  3M99 B;  5KL3 A;  1TF6 A;  2EMA A;  2ADR A;  2PRT A;  2YRM A;  2EMK A;  2YRK A;  4R2Q A;  2EE8 A;  2EL6 A;  2YTD A;  1A1H A;  1B69 A;  2EM8 A;  2EPC A;  2EM7 A;  3MHS C;  2DMI A;  2EMZ A;  2EOR A;  2YTJ A;  2YU8 A;  3EPL A;  4R2S A;  2EM5 A;  2YSP A;  2EN2 A;  2YU5 A;  2EM4 A;  2EQ1 A;  2EN4 A;  4IJD A;  2WBS A;  2RPC A;  2LCE A;  2LV2 A;  5KL2 A;  1A1K A;  1BBO A;  2EPU A;  4R2D A;  4X9J A;  2EMC A;  4F2J C;  2ELZ A;  2I13 A;  2EMX A;  2EL5 A;  2WCC 3;  2EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...