2LVHA

Solution structure of the zinc finger afv1p06 protein from the hyperthermophilic archaeal virus afv1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
45
structure length
45
Chain Sequence
MERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative zinc finger protein ORF59a
publication title Solution structure of an archaeal DNA binding protein with an eukaryotic zinc finger fold.
pubmed doi rcsb
source organism Acidianus filamentous virus 1
total genus 10
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2012-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lvhA00
1MEYC 2EL5A 2GLIA 2EOMA 2YRKA 2EM6A 2HGHA 5KL5A 4R2PA 1ZAAC 2WCC3 2A25A 1YUIA 2WBSA 2YU8A 1ZR9A 2EM3A 2ELZA 2EOQA 2EQ3A 4F6MA 2EMYA 2EOZA 4R2CA 3MHHC 1X6FA 2ADRA 2WBTA 2CTDA 1KJKA 2YTOA 2YSOA 2EOJA 2YTGA 2D9HA 2VRDA 4X9JA 2EMAA 2EMFA 1F2IG 2EN1A 2WBUA 1AAYA 2I13A 1X5WA 2EOEA 2M9AA 2DMIA 2EMBA 2DGCA 1BB8A 2EPPA 2EMXA 1ZU1A 2EMLA 2JPAA 2DRPA 5KL2A 3EPJA 4IS1C 2NABA 1JK1A 1G2FC 1YSAC 1A1JA 1Z1BA 2EOIA 2YTQA 2LVHA 1A1HA 1TF3A 2EOHA 3M99B 1LLMC 2PRTA 1RMDA 2MKDA 2YU5A 2EPZA 2BB8A 4M9VC 2ENCA 4WSGA 2EM7A 1X3CA 1X6EA 1A1GA 2ENAA 2EN4A 2LV2A 2EPUA 2EN7A 2EORA 1UN6B 2EM2A 2DLKA 2YTIA 1A1IA 1JK2A 1TN9A 2GHFA 2LO3A 2EN3A 2EMHA 2RPCA 1X6HA 4R2QA 2R1FA 1NCSA 2EOXA 2EOFA 2EJ4A 2ENHA 2EMKA 2EM9A 4R2DA 1A1FA 1UBDC 4R2AA 1P47A 2MKNA 2EM4A 2EN8A 2EM8A 2YTDA 2EMIA 2ELYA 3EPKA 2EPXA 2JP9A 2LCEA 2CT1A 2EL6A 2MDGA 3VHTB 2EM0A 2EQ1A 4GZNC 4F2JC 2RSIA 2YSPA 5KL4A 2EMGA 1WJPA 4R2SA 5KL7A 4FK5C 3UK3C 2EP3A 2YRHA 2J7JA 1A1LA 1DGCA 2YTEA 2EE8A 2EMCA 3EPHA 2EPCA 4R2EA 4IJDA 2E72A 4F6NA 2EL4A 2EOYA 2CSHA 2EN6A 1YUJA 2YTJA 2YRMA 2EOOA 1G2DC 1BBOA 2EMWA 2EPRA 1TF6A 2YTFA 1B69A 2EQ0A 2YTNA 2EM5A 3MHSC 2EOSA 2DLQA 2EMZA 5KL3A 5KL6A 2EPAA 3EPLA 2YTPA 1A1KA 2LT7A 4R2RA 2EN2A
chains in the Genus database with same CATH superfamily
1MEYC 1QNTA 4BHBA 1IQSA 4ZYGA 2UUAE 5A6AA 1WHNA 4LFCE 2L92A 2EQ3A 4RH8A 4M2ZA 2HC5A 2LE2A 2EOZA 4R2CA 4YY3E 3MHHC 1J5EE 1XMQE 1X6FA 1X47A 4DV6E 1XNRE 2F8BA 2RS6A 2JY9A 2YTGA 3L00A 4X9JA 4WXDA 1MGTA 2EMFA 2K4VA 2MDRA 4X66E 4P78A 1RC7A 1N36E 2M4IA 2JPAA 2DRPA 4LF9E 1HNXE 4L5NC 2L2MA 1A1JA 4HTGA 4F54A 1Z1BA 2EOIA 1TF3A 3HQ1A 4DKKA 3M99B 2PRTA 2MKDA 2ENCA 2V8QB 4WSGA 2UXDE 2V86A 1A1GA 2JR1A 2ENAA 3KWRA 2EM2A 2G7HA 1X6HA 2E5LE 2R1FA 1NCSA 2EOFA 4LU9A 1GZ6A 2IHR1 2EMKA 2EM9A 3THOB 4R2DA 4R2AA 1P47A 4K0KE 2MKNA 2B9DA 4DR7E 4JI8E 1SR9A 3KZZA 1DI2A 4BC7A 4HEIA 2CT1A 4BC9A 2MDGA 4GZNC 2YSPA 3FIGA 2V85A 5AASA 5KL4A 1PJTA 2EMGA 4BCAA 2UXCE 1HR0E 2EPOA 2YRHA 2NUGA 2EMCA 4ZYDA 2L3CA 2EOYA 3JAMC 1YUJA 2YRMA 1BBOA 2EMWA 5T6JA 1B69A 2EQ0A 2EM5A 4DR3E 1DQ3A 5KL6A 2UUCE 2EPAA 3EPLA 4MLQA 2RSMA 3DF6A 1UBDC 2GLIA 2EM6A 5IV8B 5KL5A 2YWQA 2H36X 2WCC3 1IBKE 1ZAAC 1STUA 2N3HA 5AC5A 3DJWA 2FGGA 4DV4E 4O5GA 4NXME 4LF5E 5FLXC 2ELZA 5ADZA 4O4KA 2M1SA 4BBYA 2ADRA 4WPYA 2YTOA 2EOJA 2GPIA 4ZYEA 2I13A 3H09A 1J26A 3F6HA 2DMIA 5IWAE 2DGCA 1EH8A 4GEQB 4LFBE 3QG5C 1ZU1A 4L8NA 5IT9C 4JI3E 4F9BB 3EPJA 1JK1A 3KZYA 2F4VE 2YTQA 2CPNA 2EZ6A 2EOHA 2L2KB 4LFAE 1LLMC 4LF8E 1BBGA 1WXRA 4KZSA 3OTOE 4MLVA 1X6EA 4LF7E 2V89A 3TQMA 4JI0E 2Q8UA 2EN4A 2DIXA 4JV5E 2EN7A 2E1MA 1KYQA 1XNQE 1YYOA 1IBME 2L8TA 2HHHE 4LF6E 2RPCA 3J7AG 2B3TB 3IWBA 4JYAE 2EOXA 2FV4B 4WYQB 5LMNE 1EKZA 3LLHA 1N34E 5AE2A 4WSPA 2EN8A 3IWCA 3C4TA 2YTDA 2V87A 2EPXA 1EH6A 4JI1E 1WJPA 5A6JA 2RS7A 3K6QA 2LJHA 2EP3A 2J7JA 1DGCA 4R8OA 2EE8A 4N4RB 2EPCA 2JVAA 4IJDA 5AE1A 2E72A 2UUBE 2MC6A 2EL4A 5A2QC 2LUPB 1N3GA 1T38A 2HJJA 2YTJA 1AH5A 2FTXB 2EPRA 2JOBA 2YTFA 1HNWE 3J80C 2YTNA 2RQLA 2EOSA 2DLQA 2EMZA 5KL3A 4DV2E 2JOXA 2LT7A 4WXCA 3BGHA 4X65E 2EOMA 3MSWA 2YRKA 2HGHA 4NZVA 4R2PA 2YT4A 2A25A 5DNYA 1YUIA 2WBSA 4RHBB 1ZR9A 4WFTA 1GTKA 2EOQA 5F3WA 3THNA 1IMUA 2WBTA 4GKKE 4J8ZA 2CTDA 2YSOA 3C4BA 2LJUA 5TSEA 2VRDA 1YYWA 4AQYE 3HXLA 2BBGA 2WBUA 2VQEE 1PKPA 2M9AA 1T4OA 2JWOA 3VYXA 4TUGA 2LRSA 3C6KA 4Q28A 1NEIA 2EMLA 1YZ9A 5KL2A 4TUIA 1RQ0A 3JU0A 1YSAC 1FJGE 1A1HA 2KONA 4BHCA 3VYYA 1IBLE 4OOGC 4DR5E 4B3ME 4JI2E 2EPZA 5A6BA 2LMZA 1QU6A 4M9VC 5LMUE 4DV0E 3HTXA 2EM7A 1X3CA 1UILA 2L6MA 4O24A 3LMLA 1O0WA 4X62E 4I8OA 2LV2A 2EPUA 4B3TE 4F9CB 3ADLA 1A1IA 1JK2A 2GHFA 2LO3A 2EMHA 3BIDA 1N33E 4R2QA 2DMYA 2EJ4A 2ENHA 3ADGA 4JI7E 1L4SA 4Q35B 4DV1E 3AUZA 2EPMX 1YFHA 2L2NA 2EM8A 2EMIA 4R03A 3EPKA 4DV5E 2JP9A 4F9AB 3P1XA 2EL6A 3VHTB 2EM0A 2EQ1A 1IQOA 2KHXA 4F2JC 1ZBTA 3ZOQB 2N8XA 4DV7E 3UK3C 2L3JA 1I94E 2L33A 1EH7A 3EPHA 4R2EA 2K7IA 4F6NA 2LTSA 2CSHA 2V83A 3ADIA 4KWYA 4YHHE 1G2DC 4DMIA 3J81C 2EWLA 3HPSA 1TF6A 4ZYHA 5LL6R 3T1HE 4X8WA 4DUZE 2N3GA 3BF2A 1YPNA 3ADJA 5CFFE 4DR1E 1WHQA 2EN2A 2EL5A 3AV0A 3ECRA 2JYAA 4JI6E 3IWDA 2EPKX 2YU8A 3EQ1A 2EM3A 4F6MA 2EMYA 4DUYE 4P7DA 2NUFA 1KJKA 1UHZA 1FKAE 2WZOA 2D9HA 1N32E 2EMAA 4JI4E 1PJSA 4JI5E 1F2IG 2EN1A 2MC5A 3OMLA 1AAYA 1X5WA 2EOEA 2EMBA 2VQFE 2ZM6E 5LLQA 4WX9A 1BB8A 5A6KA 2EPPA 2EMXA 4LTYA 4IS1C 1XMOE 2DB2A 2NABA 1G2FC 1X48A 2LVHA 1T4NA 1RMDA 2EPNA 4DR4E 1WRJA 2YU5A 1X49A 2BB8A 2NUEA 4NHRA 4BS9A 2I9IA 4O43A 3RMPA 5AC4A 4M30A 4GKJE 2NA2A 2RTXA 2EORA 1UN6B 2YTIA 2DLKA 3J7Yp 4LF4E 1PDAA 4BMJA 4KHPE 2LUQA 1TN9A 1T4LB 2EN3A 1PJQA 2LBSB 2VE7C 2EPLX 4X64E 2ODRC 2M7QA 4DR6E 1A1FA 2VF1A 2R76A 2YPNA 4DV3E 2EM4A 3T1YE 5BR8E 1SFEA 2ELYA 2YZTA 2ODRD 2V88A 2LCEA 4DR2E 2LTRA 3BBGA 3JTZA 2RSIA 5A6BD 3C6MA 4R2SA 5KL7A 4B3SE 4FK5C 1YYKA 1ZBQA 4B3RE 1A1LA 2JXPA 2YTEA 1HNZE 1GQEA 4NXNE 2EN6A 5A69A 2EOOA 2DSYA 2B7VA 3VK6A 2B7TA 2UU9E 2KOUA 5AE3A 1T39A 4OX9E 3MHSC 5IXMB 3F6GA 4M0VA 2UXBE 2YTPA 3HPZA 1A1KA 4R2RA
chains in the Genus database with same CATH topology
1MEYC 2EL5A 2GLIA 2EOMA 2YRKA 2EM6A 2HGHA 5KL5A 4R2PA 1ZAAC 2WCC3 2A25A 1YUIA 2WBSA 2YU8A 1ZR9A 2EM3A 2ELZA 2EOQA 2EQ3A 4F6MA 2EMYA 2EOZA 4R2CA 3MHHC 1X6FA 2ADRA 2WBTA 2CTDA 1KJKA 2YTOA 2YSOA 2EOJA 2YTGA 2D9HA 2VRDA 4X9JA 2EMAA 2EMFA 1F2IG 2EN1A 2WBUA 1AAYA 2I13A 1X5WA 2EOEA 2M9AA 2DMIA 2EMBA 2DGCA 1BB8A 2EPPA 2EMXA 1ZU1A 2EMLA 2JPAA 2DRPA 5KL2A 3EPJA 4IS1C 2NABA 1JK1A 1G2FC 1YSAC 1A1JA 1Z1BA 2EOIA 2YTQA 2LVHA 1A1HA 1TF3A 2EOHA 3M99B 1LLMC 2PRTA 1RMDA 2MKDA 2YU5A 2EPZA 2BB8A 4M9VC 2ENCA 4WSGA 2EM7A 1X3CA 1X6EA 1A1GA 2ENAA 2EN4A 2LV2A 2EPUA 2EN7A 2EORA 1UN6B 2EM2A 2DLKA 2YTIA 1A1IA 1JK2A 1TN9A 2GHFA 2LO3A 2EN3A 2EMHA 2RPCA 1X6HA 4R2QA 2R1FA 1NCSA 2EOXA 2EOFA 2EJ4A 2ENHA 2EMKA 2EM9A 4R2DA 1A1FA 1UBDC 4R2AA 1P47A 2MKNA 2EM4A 2EN8A 2EM8A 2YTDA 2EMIA 2ELYA 3EPKA 2EPXA 2JP9A 2LCEA 2CT1A 2EL6A 2MDGA 3VHTB 2EM0A 2EQ1A 4GZNC 4F2JC 2RSIA 2YSPA 5KL4A 2EMGA 1WJPA 4R2SA 5KL7A 4FK5C 3UK3C 2EP3A 2YRHA 2J7JA 1A1LA 1DGCA 2YTEA 2EE8A 2EMCA 3EPHA 2EPCA 4R2EA 4IJDA 2E72A 4F6NA 2EL4A 2EOYA 2CSHA 2EN6A 1YUJA 2YTJA 2YRMA 2EOOA 1G2DC 1BBOA 2EMWA 2EPRA 1TF6A 2YTFA 1B69A 2EQ0A 2YTNA 2EM5A 3MHSC 2EOSA 2DLQA 2EMZA 5KL3A 5KL6A 2EPAA 3EPLA 2YTPA 1A1KA 2LT7A 4R2RA 2EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEY C;  2EL5 A;  2GLI A;  2EOM A;  2YRK A;  2EM6 A;  2HGH A;  5KL5 A;  4R2P A;  1ZAA C;  2WCC 3;  2A25 A;  1YUI A;  2WBS A;  2YU8 A;  1ZR9 A;  2EM3 A;  2ELZ A;  2EOQ A;  2EQ3 A;  4F6M A;  2EMY A;  2EOZ A;  4R2C A;  3MHH C;  1X6F A;  2ADR A;  2WBT A;  2CTD A;  1KJK A;  2YTO A;  2YSO A;  2EOJ A;  2YTG A;  2D9H A;  2VRD A;  4X9J A;  2EMA A;  2EMF A;  1F2I G;  2EN1 A;  2WBU A;  1AAY A;  2I13 A;  1X5W A;  2EOE A;  2M9A A;  2DMI A;  2EMB A;  2DGC A;  1BB8 A;  2EPP A;  2EMX A;  1ZU1 A;  2EML A;  2JPA A;  2DRP A;  5KL2 A;  3EPJ A;  4IS1 C;  2NAB A;  1JK1 A;  1G2F C;  1YSA C;  1A1J A;  1Z1B A;  2EOI A;  2YTQ A;  2LVH A;  1A1H A;  1TF3 A;  2EOH A;  3M99 B;  1LLM C;  2PRT A;  1RMD A;  2MKD A;  2YU5 A;  2EPZ A;  2BB8 A;  4M9V C;  2ENC A;  4WSG A;  2EM7 A;  1X3C A;  1X6E A;  1A1G A;  2ENA A;  2EN4 A;  2LV2 A;  2EPU A;  2EN7 A;  2EOR A;  1UN6 B;  2EM2 A;  2DLK A;  2YTI A;  1A1I A;  1JK2 A;  1TN9 A;  2GHF A;  2LO3 A;  2EN3 A;  2EMH A;  2RPC A;  1X6H A;  4R2Q A;  2R1F A;  1NCS A;  2EOX A;  2EOF A;  2EJ4 A;  2ENH A;  2EMK A;  2EM9 A;  4R2D A;  1A1F A;  1UBD C;  4R2A A;  1P47 A;  2MKN A;  2EM4 A;  2EN8 A;  2EM8 A;  2YTD A;  2EMI A;  2ELY A;  3EPK A;  2EPX A;  2JP9 A;  2LCE A;  2CT1 A;  2EL6 A;  2MDG A;  3VHT B;  2EM0 A;  2EQ1 A;  4GZN C;  4F2J C;  2RSI A;  2YSP A;  5KL4 A;  2EMG A;  1WJP A;  4R2S A;  5KL7 A;  4FK5 C;  3UK3 C;  2EP3 A;  2YRH A;  2J7J A;  1A1L A;  1DGC A;  2YTE A;  2EE8 A;  2EMC A;  3EPH A;  2EPC A;  4R2E A;  4IJD A;  2E72 A;  4F6N A;  2EL4 A;  2EOY A;  2CSH A;  2EN6 A;  1YUJ A;  2YTJ A;  2YRM A;  2EOO A;  1G2D C;  1BBO A;  2EMW A;  2EPR A;  1TF6 A;  2YTF A;  1B69 A;  2EQ0 A;  2YTN A;  2EM5 A;  3MHS C;  2EOS A;  2DLQ A;  2EMZ A;  5KL3 A;  5KL6 A;  2EPA A;  3EPL A;  2YTP A;  1A1K A;  2LT7 A;  4R2R A;  2EN2 A; 
#chains in the Genus database with same CATH topology
 1MEY C;  1QNT A;  4BHB A;  1IQS A;  4ZYG A;  2UUA E;  5A6A A;  1WHN A;  4LFC E;  2L92 A;  2EQ3 A;  4RH8 A;  4M2Z A;  2HC5 A;  2LE2 A;  2EOZ A;  4R2C A;  4YY3 E;  3MHH C;  1J5E E;  1XMQ E;  1X6F A;  1X47 A;  4DV6 E;  1XNR E;  2F8B A;  2RS6 A;  2JY9 A;  2YTG A;  3L00 A;  4X9J A;  4WXD A;  1MGT A;  2EMF A;  2K4V A;  2MDR A;  4X66 E;  4P78 A;  1RC7 A;  1N36 E;  2M4I A;  2JPA A;  2DRP A;  4LF9 E;  1HNX E;  4L5N C;  2L2M A;  1A1J A;  4HTG A;  4F54 A;  1Z1B A;  2EOI A;  1TF3 A;  3HQ1 A;  4DKK A;  3M99 B;  2PRT A;  2MKD A;  2ENC A;  2V8Q B;  4WSG A;  2UXD E;  2V86 A;  1A1G A;  2JR1 A;  2ENA A;  3KWR A;  2EM2 A;  2G7H A;  1X6H A;  2E5L E;  2R1F A;  1NCS A;  2EOF A;  4LU9 A;  1GZ6 A;  2IHR 1;  2EMK A;  2EM9 A;  3THO B;  4R2D A;  4R2A A;  1P47 A;  4K0K E;  2MKN A;  2B9D A;  4DR7 E;  4JI8 E;  1SR9 A;  3KZZ A;  1DI2 A;  4BC7 A;  4HEI A;  2CT1 A;  4BC9 A;  2MDG A;  4GZN C;  2YSP A;  3FIG A;  2V85 A;  5AAS A;  5KL4 A;  1PJT A;  2EMG A;  4BCA A;  2UXC E;  1HR0 E;  2EPO A;  2YRH A;  2NUG A;  2EMC A;  4ZYD A;  2L3C A;  2EOY A;  3JAM C;  1YUJ A;  2YRM A;  1BBO A;  2EMW A;  5T6J A;  1B69 A;  2EQ0 A;  2EM5 A;  4DR3 E;  1DQ3 A;  5KL6 A;  2UUC E;  2EPA A;  3EPL A;  4MLQ A;  2RSM A;  3DF6 A;  1UBD C;  2GLI A;  2EM6 A;  5IV8 B;  5KL5 A;  2YWQ A;  2H36 X;  2WCC 3;  1IBK E;  1ZAA C;  1STU A;  2N3H A;  5AC5 A;  3DJW A;  2FGG A;  4DV4 E;  4O5G A;  4NXM E;  4LF5 E;  5FLX C;  2ELZ A;  5ADZ A;  4O4K A;  2M1S A;  4BBY A;  2ADR A;  4WPY A;  2YTO A;  2EOJ A;  2GPI A;  4ZYE A;  2I13 A;  3H09 A;  1J26 A;  3F6H A;  2DMI A;  5IWA E;  2DGC A;  1EH8 A;  4GEQ B;  4LFB E;  3QG5 C;  1ZU1 A;  4L8N A;  5IT9 C;  4JI3 E;  4F9B B;  3EPJ A;  1JK1 A;  3KZY A;  2F4V E;  2YTQ A;  2CPN A;  2EZ6 A;  2EOH A;  2L2K B;  4LFA E;  1LLM C;  4LF8 E;  1BBG A;  1WXR A;  4KZS A;  3OTO E;  4MLV A;  1X6E A;  4LF7 E;  2V89 A;  3TQM A;  4JI0 E;  2Q8U A;  2EN4 A;  2DIX A;  4JV5 E;  2EN7 A;  2E1M A;  1KYQ A;  1XNQ E;  1YYO A;  1IBM E;  2L8T A;  2HHH E;  4LF6 E;  2RPC A;  3J7A G;  2B3T B;  3IWB A;  4JYA E;  2EOX A;  2FV4 B;  4WYQ B;  5LMN E;  1EKZ A;  3LLH A;  1N34 E;  5AE2 A;  4WSP A;  2EN8 A;  3IWC A;  3C4T A;  2YTD A;  2V87 A;  2EPX A;  1EH6 A;  4JI1 E;  1WJP A;  5A6J A;  2RS7 A;  3K6Q A;  2LJH A;  2EP3 A;  2J7J A;  1DGC A;  4R8O A;  2EE8 A;  4N4R B;  2EPC A;  2JVA A;  4IJD A;  5AE1 A;  2E72 A;  2UUB E;  2MC6 A;  2EL4 A;  5A2Q C;  2LUP B;  1N3G A;  1T38 A;  2HJJ A;  2YTJ A;  1AH5 A;  2FTX B;  2EPR A;  2JOB A;  2YTF A;  1HNW E;  3J80 C;  2YTN A;  2RQL A;  2EOS A;  2DLQ A;  2EMZ A;  5KL3 A;  4DV2 E;  2JOX A;  2LT7 A;  4WXC A;  3BGH A;  4X65 E;  2EOM A;  3MSW A;  2YRK A;  2HGH A;  4NZV A;  4R2P A;  2YT4 A;  2A25 A;  5DNY A;  1YUI A;  2WBS A;  4RHB B;  1ZR9 A;  4WFT A;  1GTK A;  2EOQ A;  5F3W A;  3THN A;  1IMU A;  2WBT A;  4GKK E;  4J8Z A;  2CTD A;  2YSO A;  3C4B A;  2LJU A;  5TSE A;  2VRD A;  1YYW A;  4AQY E;  3HXL A;  2BBG A;  2WBU A;  2VQE E;  1PKP A;  2M9A A;  1T4O A;  2JWO A;  3VYX A;  4TUG A;  2LRS A;  3C6K A;  4Q28 A;  1NEI A;  2EML A;  1YZ9 A;  5KL2 A;  4TUI A;  1RQ0 A;  3JU0 A;  1YSA C;  1FJG E;  1A1H A;  2KON A;  4BHC A;  3VYY A;  1IBL E;  4OOG C;  4DR5 E;  4B3M E;  4JI2 E;  2EPZ A;  5A6B A;  2LMZ A;  1QU6 A;  4M9V C;  5LMU E;  4DV0 E;  3HTX A;  2EM7 A;  1X3C A;  1UIL A;  2L6M A;  4O24 A;  3LML A;  1O0W A;  4X62 E;  4I8O A;  2LV2 A;  2EPU A;  4B3T E;  4F9C B;  3ADL A;  1A1I A;  1JK2 A;  2GHF A;  2LO3 A;  2EMH A;  3BID A;  1N33 E;  4R2Q A;  2DMY A;  2EJ4 A;  2ENH A;  3ADG A;  4JI7 E;  1L4S A;  4Q35 B;  4DV1 E;  3AUZ A;  2EPM X;  1YFH A;  2L2N A;  2EM8 A;  2EMI A;  4R03 A;  3EPK A;  4DV5 E;  2JP9 A;  4F9A B;  3P1X A;  2EL6 A;  3VHT B;  2EM0 A;  2EQ1 A;  1IQO A;  2KHX A;  4F2J C;  1ZBT A;  3ZOQ B;  2N8X A;  4DV7 E;  3UK3 C;  2L3J A;  1I94 E;  2L33 A;  1EH7 A;  3EPH A;  4R2E A;  2K7I A;  4F6N A;  2LTS A;  2CSH A;  2V83 A;  3ADI A;  4KWY A;  4YHH E;  1G2D C;  4DMI A;  3J81 C;  2EWL A;  3HPS A;  1TF6 A;  4ZYH A;  5LL6 R;  3T1H E;  4X8W A;  4DUZ E;  2N3G A;  3BF2 A;  1YPN A;  3ADJ A;  5CFF E;  4DR1 E;  1WHQ A;  2EN2 A;  2EL5 A;  3AV0 A;  3ECR A;  2JYA A;  4JI6 E;  3IWD A;  2EPK X;  2YU8 A;  3EQ1 A;  2EM3 A;  4F6M A;  2EMY A;  4DUY E;  4P7D A;  2NUF A;  1KJK A;  1UHZ A;  1FKA E;  2WZO A;  2D9H A;  1N32 E;  2EMA A;  4JI4 E;  1PJS A;  4JI5 E;  1F2I G;  2EN1 A;  2MC5 A;  3OML A;  1AAY A;  1X5W A;  2EOE A;  2EMB A;  2VQF E;  2ZM6 E;  5LLQ A;  4WX9 A;  1BB8 A;  5A6K A;  2EPP A;  2EMX A;  4LTY A;  4IS1 C;  1XMO E;  2DB2 A;  2NAB A;  1G2F C;  1X48 A;  2LVH A;  1T4N A;  1RMD A;  2EPN A;  4DR4 E;  1WRJ A;  2YU5 A;  1X49 A;  2BB8 A;  2NUE A;  4NHR A;  4BS9 A;  2I9I A;  4O43 A;  3RMP A;  5AC4 A;  4M30 A;  4GKJ E;  2NA2 A;  2RTX A;  2EOR A;  1UN6 B;  2YTI A;  2DLK A;  3J7Y p;  4LF4 E;  1PDA A;  4BMJ A;  4KHP E;  2LUQ A;  1TN9 A;  1T4L B;  2EN3 A;  1PJQ A;  2LBS B;  2VE7 C;  2EPL X;  4X64 E;  2ODR C;  2M7Q A;  4DR6 E;  1A1F A;  2VF1 A;  2R76 A;  2YPN A;  4DV3 E;  2EM4 A;  3T1Y E;  5BR8 E;  1SFE A;  2ELY A;  2YZT A;  2ODR D;  2V88 A;  2LCE A;  4DR2 E;  2LTR A;  3BBG A;  3JTZ A;  2RSI A;  5A6B D;  3C6M A;  4R2S A;  5KL7 A;  4B3S E;  4FK5 C;  1YYK A;  1ZBQ A;  4B3R E;  1A1L A;  2JXP A;  2YTE A;  1HNZ E;  1GQE A;  4NXN E;  2EN6 A;  5A69 A;  2EOO A;  2DSY A;  2B7V A;  3VK6 A;  2B7T A;  2UU9 E;  2KOU A;  5AE3 A;  1T39 A;  4OX9 E;  3MHS C;  5IXM B;  3F6G A;  4M0V A;  2UXB E;  2YTP A;  3HPZ A;  1A1K A;  4R2R A; 
#chains in the Genus database with same CATH homology
 1MEY C;  2EL5 A;  2GLI A;  2EOM A;  2YRK A;  2EM6 A;  2HGH A;  5KL5 A;  4R2P A;  1ZAA C;  2WCC 3;  2A25 A;  1YUI A;  2WBS A;  2YU8 A;  1ZR9 A;  2EM3 A;  2ELZ A;  2EOQ A;  2EQ3 A;  4F6M A;  2EMY A;  2EOZ A;  4R2C A;  3MHH C;  1X6F A;  2ADR A;  2WBT A;  2CTD A;  1KJK A;  2YTO A;  2YSO A;  2EOJ A;  2YTG A;  2D9H A;  2VRD A;  4X9J A;  2EMA A;  2EMF A;  1F2I G;  2EN1 A;  2WBU A;  1AAY A;  2I13 A;  1X5W A;  2EOE A;  2M9A A;  2DMI A;  2EMB A;  2DGC A;  1BB8 A;  2EPP A;  2EMX A;  1ZU1 A;  2EML A;  2JPA A;  2DRP A;  5KL2 A;  3EPJ A;  4IS1 C;  2NAB A;  1JK1 A;  1G2F C;  1YSA C;  1A1J A;  1Z1B A;  2EOI A;  2YTQ A;  2LVH A;  1A1H A;  1TF3 A;  2EOH A;  3M99 B;  1LLM C;  2PRT A;  1RMD A;  2MKD A;  2YU5 A;  2EPZ A;  2BB8 A;  4M9V C;  2ENC A;  4WSG A;  2EM7 A;  1X3C A;  1X6E A;  1A1G A;  2ENA A;  2EN4 A;  2LV2 A;  2EPU A;  2EN7 A;  2EOR A;  1UN6 B;  2EM2 A;  2DLK A;  2YTI A;  1A1I A;  1JK2 A;  1TN9 A;  2GHF A;  2LO3 A;  2EN3 A;  2EMH A;  2RPC A;  1X6H A;  4R2Q A;  2R1F A;  1NCS A;  2EOX A;  2EOF A;  2EJ4 A;  2ENH A;  2EMK A;  2EM9 A;  4R2D A;  1A1F A;  1UBD C;  4R2A A;  1P47 A;  2MKN A;  2EM4 A;  2EN8 A;  2EM8 A;  2YTD A;  2EMI A;  2ELY A;  3EPK A;  2EPX A;  2JP9 A;  2LCE A;  2CT1 A;  2EL6 A;  2MDG A;  3VHT B;  2EM0 A;  2EQ1 A;  4GZN C;  4F2J C;  2RSI A;  2YSP A;  5KL4 A;  2EMG A;  1WJP A;  4R2S A;  5KL7 A;  4FK5 C;  3UK3 C;  2EP3 A;  2YRH A;  2J7J A;  1A1L A;  1DGC A;  2YTE A;  2EE8 A;  2EMC A;  3EPH A;  2EPC A;  4R2E A;  4IJD A;  2E72 A;  4F6N A;  2EL4 A;  2EOY A;  2CSH A;  2EN6 A;  1YUJ A;  2YTJ A;  2YRM A;  2EOO A;  1G2D C;  1BBO A;  2EMW A;  2EPR A;  1TF6 A;  2YTF A;  1B69 A;  2EQ0 A;  2YTN A;  2EM5 A;  3MHS C;  2EOS A;  2DLQ A;  2EMZ A;  5KL3 A;  5KL6 A;  2EPA A;  3EPL A;  2YTP A;  1A1K A;  2LT7 A;  4R2R A;  2EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...