2LVHA

Solution structure of the zinc finger afv1p06 protein from the hyperthermophilic archaeal virus afv1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
45
structure length
45
Chain Sequence
MERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an archaeal DNA binding protein with an eukaryotic zinc finger fold.
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Metal binding protein
molecule keywords Putative zinc finger protein ORF59a
total genus 10
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2012-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lvhA00
1G2DC 1UN6B 1LLMC 2EM4A 2EPRA 2EOOA 2WBUA 2ADRA 2YRHA 2YTQA 1JK2A 1YSAC 2J7JA 2GHFA 1X6FA 2EORA 1TF6A 2A25A 2YSPA 1X3CA 4R2DA 2EOMA 2YTDA 2EPUA 2EOSA 1KJKA 2EOQA 2EMWA 2EM3A 2RPCA 2EQ0A 1YUIA 2EM0A 4R2EA 2ELZA 3M99B 2EMLA 2LCEA 5KL4A 2CSHA 1BBOA 2EOHA 1A1LA 2YU8A 2EMBA 2LV2A 1WJPA 1A1JA 2EMHA 1G2FC 2EN4A 1P47A 1B69A 2EM9A 2EQ1A 2LO3A 4X9JA 4FK5C 2EQ3A 1A1KA 2D9HA 1F2IG 2EN6A 2E72A 2GLIA 2RSIA 2EL5A 2DMIA 4R2CA 1X5WA 3UK3C 4R2AA 1JK1A 1TN9A 2EE8A 2M9AA 2YRKA 5KL5A 3EPHA 2EOXA 2LT7A 5KL7A 2EMAA 2YTPA 2YTNA 2EL6A 4R2PA 2BB8A 2EJ4A 5KL2A 2R1FA 4IS1C 2MKDA 1YUJA 3EPJA 2EN7A 1UBDC 1X6HA 4WSGA 1ZAAC 2MDGA 2WBTA 2EMKA 2EPCA 4R2RA 2EMCA 2EMIA 5KL3A 1AAYA 2JPAA 2HGHA 5KL6A 2EPPA 2YTOA 1MEYC 2EMXA 2EP3A 4IJDA 1RMDA 2EMYA 2EMFA 4F6MA 2YTEA 2JP9A 2EN1A 1BB8A 2DRPA 1DGCA 2EOZA 2EPXA 2YTFA 1TF3A 2EM8A 4F2JC 1A1IA 2EN8A 2EM7A 2PRTA 2EMGA 2EPZA 2VRDA 2EN2A 2CTDA 3VHTB 2DLQA 4GZNC 3MHHC 2EOYA 1ZR9A 2EOFA 2YTGA 2YRMA 3EPKA 4M9VC 2ENAA 2EL4A 1A1GA 2EM6A 1A1FA 4R2SA 4F6NA 1Z1BA 2DLKA 2ENHA 1ZU1A 2LVHA 2EN3A 2YTJA 4R2QA 2ENCA 2YSOA 2YU5A 2ELYA 1NCSA 1A1HA 2YTIA 2WBSA 2CT1A 2EPAA 2I13A 2DGCA 2EM2A 1X6EA 2EM5A 2EOIA 2WCC3 2EMZA 2EOEA 2NABA 2MKNA 3MHSC 2EOJA 3EPLA
chains in the Genus database with same CATH superfamily
1LLMC 2EM4A 2EPRA 4BCAA 2EOOA 3ECRA 2RS7A 2EORA 2YSPA 5A2QC 1T4LB 1WHQA 2B7VA 2YTDA 2EOSA 2L33A 5FLXC 4DR6E 2EM3A 2EQ0A 2N3GA 4DR7E 4WX9A 3THOB 4JYAE 5IV8B 3VYYA 5KL4A 2EZ6A 1J26A 1A1LA 2YU8A 4WFTA 2EMBA 5AC5A 4JI3E 2LV2A 5AE1A 2EMHA 2GPIA 1P47A 1NEIA 2DMYA 2L2KB 2EPNA 2EQ3A 2M1SA 1F2IG 5ADZA 3KZZA 4WXDA 4LF5E 4DR3E 2RSIA 1WRJA 2LTSA 3P1XA 3UK3C 4JI5E 1JK1A 4O4KA 2MC6A 5KL5A 1XNQE 3HQ1A 2LUPB 2UUCE 1XMOE 3ADJA 4WSPA 3AV0A 1YUJA 2G7HA 4TUIA 2UXCE 2EMKA 4R2RA 2EMIA 3LMLA 5KL6A 4JI8E 2EPPA 4TUGA 4RHBB 3RMPA 2HHHE 2EMXA 4JI7E 3LLHA 4DUYE 1T4OA 2DRPA 1DGCA 4B3TE 2EOZA 4DMIA 4WPYA 2EM8A 4JI6E 4O5GA 4F2JC 1A1IA 2EN8A 4F9CB 1RQ0A 1BBGA 2EN2A 3J7AG 1IBKE 3KZYA 4O43A 4JI2E 1ZR9A 4X62E 4DKKA 4F54A 2VQFE 4LTYA 1EKZA 2EM6A 4R2SA 2EPOA 2UXBE 4Q28A 2YTJA 2YWQA 2LJUA 2RS6A 3JAMC 1QNTA 4BC9A 4R8OA 2WBSA 2V86A 2EPAA 3VK6A 2EM2A 1X6EA 2EMZA 2EOEA 2JXPA 3HPSA 4NHRA 4DV2E 3IWDA 2WBUA 4LFCE 1JK2A 1N34E 1X6FA 3HPZA 1WHNA 2JVAA 1T38A 1RC7A 2RPCA 3THNA 3ADIA 2ELZA 3M99B 4X66E 4DV7E 1HNXE 2CSHA 5IWAE 1PJSA 3OMLA 1YFHA 2WZOA 4ZYEA 2V89A 2E5LE 1B69A 1QU6A 4X9JA 4FK5C 4L8NA 1A1KA 5T6JA 2NUEA 2UU9E 1MGTA 2E72A 2LMZA 4LU9A 4M2ZA 2NUGA 4WXCA 4M0VA 1HNZE 2EOXA 3EPHA 2EMAA 3C4BA 1YYOA 3KWRA 1DI2A 4R2PA 5KL2A 2ZM6E 2H36X 1EH7A 2HC5A 1X6HA 1I94E 2EPLX 2RQLA 4BC7A 3J80C 1ZAAC 4LF4E 1IBME 4K0KE 1N3GA 2EMCA 5KL3A 4ZYDA 2HGHA 3C6MA 1X48A 4MLQA 1PDAA 2YZTA 4JI4E 2EMYA 1PJTA 2EMFA 4F6MA 1T4NA 2YTEA 5A6BD 2JP9A 4GKJE 2EPXA 1TF3A 2L92A 4I8OA 2ODRC 2V88A 2R76A 1WXRA 4F9BB 2FTXB 2CTDA 2DLQA 4LFBE 4WYQB 3MHHC 1UHZA 4DR2E 2LUQA 4LF7E 1GZ6A 2ENAA 2EWLA 5LLQA 1YYKA 1A1FA 5IXMB 2ENHA 4B3ME 2LVHA 1XNRE 5LMNE 2E1MA 4R2QA 1T39A 1EH8A 1A1HA 4Q35B 1YZ9A 2CT1A 2WCC3 2EOIA 2MKNA 2NABA 3MHSC 1YYWA 2UXDE 1G2DC 3HXLA 2B9DA 2J7JA 2GHFA 1TF6A 1X3CA 2I9IA 3H09A 2JWOA 1KJKA 2EMWA 4B3RE 3T1YE 2M7QA 4NXME 1YPNA 1N32E 1YUIA 4P7DA 2JY9A 2EM0A 2HJJA 4R2EA 2LJHA 1O0WA 2EMLA 2KOUA 3IWCA 5A69A 2L6MA 3MSWA 1EH6A 2EOHA 4YY3E 1BBOA 2RTXA 3DJWA 4DV5E 2EPMX 2V8QB 2F8BA 4JI1E 1A1JA 5A6KA 3TQMA 1G2FC 2LTRA 2EM9A 5A6JA 4N4RB 2L2NA 5BR8E 1KYQA 3FIGA 2ODRD 4R2CA 1X5WA 4R2AA 3BGHA 1TN9A 4BS9A 2YRKA 1L4SA 2JR1A 2LRSA 5CFFE 2LBSB 4BHBA 1HNWE 2B7TA 2YTNA 2BB8A 2R1FA 3EPJA 1UBDC 4WSGA 3L00A 2MDGA 2WBTA 2EPCA 4DV6E 4R03A 2YTOA 4M30A 1PJQA 1MEYC 4IJDA 4DUZE 2NUFA 5IT9C 2EN1A 5AASA 1BB8A 1N33E 2KONA 2N3HA 2K4VA 1ZBTA 4BMJA 4DV0E 2EM7A 2PRTA 2EPZA 2FV4B 3VHTB 2F4VE 2N8XA 3QG5C 1XMQE 3AUZA 2EOFA 1IQSA 3K6QA 3F6HA 2V85A 2IHR1 3BBGA 2CPNA 4DV3E 4M9VC 4AQYE 3JTZA 1Z1BA 3BF2A 1FKAE 5F3WA 3ADGA 2EN3A 1HR0E 4JI0E 2ENCA 4KWYA 5A6AA 2ELYA 4JV5E 2DB2A 4J8ZA 3J7Yp 2KHXA 2MDRA 3EQ1A 4KHPE 4GEQB 2EOJA 1UN6B 3JU0A 1ZBQA 1X47A 2VQEE 2ADRA 2BBGA 2YRHA 2YTQA 1YSAC 3ZOQB 2A25A 5AE3A 3J81C 4R2DA 1IMUA 2EOMA 4LF8E 2EPUA 3ADLA 4NXNE 2EOQA 2VF1A 2LE2A 2V83A 5TSEA 2K7IA 4OOGC 4OX9E 5AE2A 2LCEA 2M4IA 4X64E 4X8WA 2L8TA 1WJPA 4B3SE 5DNYA 2Q8UA 2EN4A 4ZYGA 3C4TA 2EQ1A 2JOBA 2LO3A 2D9HA 4DR4E 2EN6A 3OTOE 4LFAE 4L5NC 4DR5E 2GLIA 1J5EE 4HTGA 2DSYA 2EL5A 2DMIA 4DV1E 4MLVA 2FGGA 3F6GA 1STUA 2EE8A 2M9AA 2L2MA 4ZYHA 4X65E 2LT7A 1AH5A 5KL7A 5A6BA 2YTPA 2L3JA 2EL6A 5LL6R 2EJ4A 4IS1C 2YPNA 2MKDA 2EN7A 1GQEA 1SFEA 1DQ3A 2YT4A 2UUAE 2L3CA 3HTXA 2B3TB 1FJGE 1AAYA 2JPAA 4BHCA 4HEIA 4GKKE 2JYAA 1GTKA 2EP3A 1UILA 4BBYA 1IQOA 1RMDA 5AC4A 2YTFA 1X49A 2RSMA 4NZVA 3DF6A 2UUBE 4O24A 2EMGA 2JOXA 2VRDA 5LMUE 3VYXA 3BIDA 4DV4E 4RH8A 2V87A 4LF6E 4GZNC 1SR9A 3T1HE 4F9AB 2EOYA 2EPKX 2YTGA 4P78A 2YRMA 3EPKA 2VE7C 2EL4A 1A1GA 4DR1E 4LF9E 4F6NA 2DIXA 2DLKA 1ZU1A 2NA2A 1PKPA 2MC5A 2YSOA 2YU5A 1NCSA 2YTIA 4KZSA 2I13A 2DGCA 4YHHE 2EM5A 3IWBA 1IBLE 1N36E 3C6KA 3EPLA
chains in the Genus database with same CATH topology
1G2DC 1UN6B 1LLMC 2EM4A 2EPRA 2EOOA 2WBUA 2ADRA 2YRHA 2YTQA 1JK2A 1YSAC 2J7JA 2GHFA 1X6FA 2EORA 1TF6A 2A25A 2YSPA 1X3CA 4R2DA 2EOMA 2YTDA 2EPUA 2EOSA 1KJKA 2EOQA 2EMWA 2EM3A 2RPCA 2EQ0A 1YUIA 2EM0A 4R2EA 2ELZA 3M99B 2EMLA 2LCEA 5KL4A 2CSHA 1BBOA 2EOHA 1A1LA 2YU8A 2EMBA 2LV2A 1WJPA 1A1JA 2EMHA 1G2FC 2EN4A 1P47A 1B69A 2EM9A 2EQ1A 2LO3A 4X9JA 4FK5C 2EQ3A 1A1KA 2D9HA 1F2IG 2EN6A 2E72A 2GLIA 2RSIA 2EL5A 2DMIA 4R2CA 1X5WA 3UK3C 4R2AA 1JK1A 1TN9A 2EE8A 2M9AA 2YRKA 5KL5A 3EPHA 2EOXA 2LT7A 5KL7A 2EMAA 2YTPA 2YTNA 2EL6A 4R2PA 2BB8A 2EJ4A 5KL2A 2R1FA 4IS1C 2MKDA 1YUJA 3EPJA 2EN7A 1UBDC 1X6HA 4WSGA 1ZAAC 2MDGA 2WBTA 2EMKA 2EPCA 4R2RA 2EMCA 2EMIA 5KL3A 1AAYA 2JPAA 2HGHA 5KL6A 2EPPA 2YTOA 1MEYC 2EMXA 2EP3A 4IJDA 1RMDA 2EMYA 2EMFA 4F6MA 2YTEA 2JP9A 2EN1A 1BB8A 2DRPA 1DGCA 2EOZA 2EPXA 2YTFA 1TF3A 2EM8A 4F2JC 1A1IA 2EN8A 2EM7A 2PRTA 2EMGA 2EPZA 2VRDA 2EN2A 2CTDA 3VHTB 2DLQA 4GZNC 3MHHC 2EOYA 1ZR9A 2EOFA 2YTGA 2YRMA 3EPKA 4M9VC 2ENAA 2EL4A 1A1GA 2EM6A 1A1FA 4R2SA 4F6NA 1Z1BA 2DLKA 2ENHA 1ZU1A 2LVHA 2EN3A 2YTJA 4R2QA 2ENCA 2YSOA 2YU5A 2ELYA 1NCSA 1A1HA 2YTIA 2WBSA 2CT1A 2EPAA 2I13A 2DGCA 2EM2A 1X6EA 2EM5A 2EOIA 2WCC3 2EMZA 2EOEA 2NABA 2MKNA 3MHSC 2EOJA 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2D C;  1UN6 B;  1LLM C;  2EM4 A;  2EPR A;  2EOO A;  2WBU A;  2ADR A;  2YRH A;  2YTQ A;  1JK2 A;  1YSA C;  2J7J A;  2GHF A;  1X6F A;  2EOR A;  1TF6 A;  2A25 A;  2YSP A;  1X3C A;  4R2D A;  2EOM A;  2YTD A;  2EPU A;  2EOS A;  1KJK A;  2EOQ A;  2EMW A;  2EM3 A;  2RPC A;  2EQ0 A;  1YUI A;  2EM0 A;  4R2E A;  2ELZ A;  3M99 B;  2EML A;  2LCE A;  5KL4 A;  2CSH A;  1BBO A;  2EOH A;  1A1L A;  2YU8 A;  2EMB A;  2LV2 A;  1WJP A;  1A1J A;  2EMH A;  1G2F C;  2EN4 A;  1P47 A;  1B69 A;  2EM9 A;  2EQ1 A;  2LO3 A;  4X9J A;  4FK5 C;  2EQ3 A;  1A1K A;  2D9H A;  1F2I G;  2EN6 A;  2E72 A;  2GLI A;  2RSI A;  2EL5 A;  2DMI A;  4R2C A;  1X5W A;  3UK3 C;  4R2A A;  1JK1 A;  1TN9 A;  2EE8 A;  2M9A A;  2YRK A;  5KL5 A;  3EPH A;  2EOX A;  2LT7 A;  5KL7 A;  2EMA A;  2YTP A;  2YTN A;  2EL6 A;  4R2P A;  2BB8 A;  2EJ4 A;  5KL2 A;  2R1F A;  4IS1 C;  2MKD A;  1YUJ A;  3EPJ A;  2EN7 A;  1UBD C;  1X6H A;  4WSG A;  1ZAA C;  2MDG A;  2WBT A;  2EMK A;  2EPC A;  4R2R A;  2EMC A;  2EMI A;  5KL3 A;  1AAY A;  2JPA A;  2HGH A;  5KL6 A;  2EPP A;  2YTO A;  1MEY C;  2EMX A;  2EP3 A;  4IJD A;  1RMD A;  2EMY A;  2EMF A;  4F6M A;  2YTE A;  2JP9 A;  2EN1 A;  1BB8 A;  2DRP A;  1DGC A;  2EOZ A;  2EPX A;  2YTF A;  1TF3 A;  2EM8 A;  4F2J C;  1A1I A;  2EN8 A;  2EM7 A;  2PRT A;  2EMG A;  2EPZ A;  2VRD A;  2EN2 A;  2CTD A;  3VHT B;  2DLQ A;  4GZN C;  3MHH C;  2EOY A;  1ZR9 A;  2EOF A;  2YTG A;  2YRM A;  3EPK A;  4M9V C;  2ENA A;  2EL4 A;  1A1G A;  2EM6 A;  1A1F A;  4R2S A;  4F6N A;  1Z1B A;  2DLK A;  2ENH A;  1ZU1 A;  2LVH A;  2EN3 A;  2YTJ A;  4R2Q A;  2ENC A;  2YSO A;  2YU5 A;  2ELY A;  1NCS A;  1A1H A;  2YTI A;  2WBS A;  2CT1 A;  2EPA A;  2I13 A;  2DGC A;  2EM2 A;  1X6E A;  2EM5 A;  2EOI A;  2WCC 3;  2EMZ A;  2EOE A;  2NAB A;  2MKN A;  3MHS C;  2EOJ A;  3EPL A; 
#chains in the Genus database with same CATH topology
 1LLM C;  2EM4 A;  2EPR A;  4BCA A;  2EOO A;  3ECR A;  2RS7 A;  2EOR A;  2YSP A;  5A2Q C;  1T4L B;  1WHQ A;  2B7V A;  2YTD A;  2EOS A;  2L33 A;  5FLX C;  4DR6 E;  2EM3 A;  2EQ0 A;  2N3G A;  4DR7 E;  4WX9 A;  3THO B;  4JYA E;  5IV8 B;  3VYY A;  5KL4 A;  2EZ6 A;  1J26 A;  1A1L A;  2YU8 A;  4WFT A;  2EMB A;  5AC5 A;  4JI3 E;  2LV2 A;  5AE1 A;  2EMH A;  2GPI A;  1P47 A;  1NEI A;  2DMY A;  2L2K B;  2EPN A;  2EQ3 A;  2M1S A;  1F2I G;  5ADZ A;  3KZZ A;  4WXD A;  4LF5 E;  4DR3 E;  2RSI A;  1WRJ A;  2LTS A;  3P1X A;  3UK3 C;  4JI5 E;  1JK1 A;  4O4K A;  2MC6 A;  5KL5 A;  1XNQ E;  3HQ1 A;  2LUP B;  2UUC E;  1XMO E;  3ADJ A;  4WSP A;  3AV0 A;  1YUJ A;  2G7H A;  4TUI A;  2UXC E;  2EMK A;  4R2R A;  2EMI A;  3LML A;  5KL6 A;  4JI8 E;  2EPP A;  4TUG A;  4RHB B;  3RMP A;  2HHH E;  2EMX A;  4JI7 E;  3LLH A;  4DUY E;  1T4O A;  2DRP A;  1DGC A;  4B3T E;  2EOZ A;  4DMI A;  4WPY A;  2EM8 A;  4JI6 E;  4O5G A;  4F2J C;  1A1I A;  2EN8 A;  4F9C B;  1RQ0 A;  1BBG A;  2EN2 A;  3J7A G;  1IBK E;  3KZY A;  4O43 A;  4JI2 E;  1ZR9 A;  4X62 E;  4DKK A;  4F54 A;  2VQF E;  4LTY A;  1EKZ A;  2EM6 A;  4R2S A;  2EPO A;  2UXB E;  4Q28 A;  2YTJ A;  2YWQ A;  2LJU A;  2RS6 A;  3JAM C;  1QNT A;  4BC9 A;  4R8O A;  2WBS A;  2V86 A;  2EPA A;  3VK6 A;  2EM2 A;  1X6E A;  2EMZ A;  2EOE A;  2JXP A;  3HPS A;  4NHR A;  4DV2 E;  3IWD A;  2WBU A;  4LFC E;  1JK2 A;  1N34 E;  1X6F A;  3HPZ A;  1WHN A;  2JVA A;  1T38 A;  1RC7 A;  2RPC A;  3THN A;  3ADI A;  2ELZ A;  3M99 B;  4X66 E;  4DV7 E;  1HNX E;  2CSH A;  5IWA E;  1PJS A;  3OML A;  1YFH A;  2WZO A;  4ZYE A;  2V89 A;  2E5L E;  1B69 A;  1QU6 A;  4X9J A;  4FK5 C;  4L8N A;  1A1K A;  5T6J A;  2NUE A;  2UU9 E;  1MGT A;  2E72 A;  2LMZ A;  4LU9 A;  4M2Z A;  2NUG A;  4WXC A;  4M0V A;  1HNZ E;  2EOX A;  3EPH A;  2EMA A;  3C4B A;  1YYO A;  3KWR A;  1DI2 A;  4R2P A;  5KL2 A;  2ZM6 E;  2H36 X;  1EH7 A;  2HC5 A;  1X6H A;  1I94 E;  2EPL X;  2RQL A;  4BC7 A;  3J80 C;  1ZAA C;  4LF4 E;  1IBM E;  4K0K E;  1N3G A;  2EMC A;  5KL3 A;  4ZYD A;  2HGH A;  3C6M A;  1X48 A;  4MLQ A;  1PDA A;  2YZT A;  4JI4 E;  2EMY A;  1PJT A;  2EMF A;  4F6M A;  1T4N A;  2YTE A;  5A6B D;  2JP9 A;  4GKJ E;  2EPX A;  1TF3 A;  2L92 A;  4I8O A;  2ODR C;  2V88 A;  2R76 A;  1WXR A;  4F9B B;  2FTX B;  2CTD A;  2DLQ A;  4LFB E;  4WYQ B;  3MHH C;  1UHZ A;  4DR2 E;  2LUQ A;  4LF7 E;  1GZ6 A;  2ENA A;  2EWL A;  5LLQ A;  1YYK A;  1A1F A;  5IXM B;  2ENH A;  4B3M E;  2LVH A;  1XNR E;  5LMN E;  2E1M A;  4R2Q A;  1T39 A;  1EH8 A;  1A1H A;  4Q35 B;  1YZ9 A;  2CT1 A;  2WCC 3;  2EOI A;  2MKN A;  2NAB A;  3MHS C;  1YYW A;  2UXD E;  1G2D C;  3HXL A;  2B9D A;  2J7J A;  2GHF A;  1TF6 A;  1X3C A;  2I9I A;  3H09 A;  2JWO A;  1KJK A;  2EMW A;  4B3R E;  3T1Y E;  2M7Q A;  4NXM E;  1YPN A;  1N32 E;  1YUI A;  4P7D A;  2JY9 A;  2EM0 A;  2HJJ A;  4R2E A;  2LJH A;  1O0W A;  2EML A;  2KOU A;  3IWC A;  5A69 A;  2L6M A;  3MSW A;  1EH6 A;  2EOH A;  4YY3 E;  1BBO A;  2RTX A;  3DJW A;  4DV5 E;  2EPM X;  2V8Q B;  2F8B A;  4JI1 E;  1A1J A;  5A6K A;  3TQM A;  1G2F C;  2LTR A;  2EM9 A;  5A6J A;  4N4R B;  2L2N A;  5BR8 E;  1KYQ A;  3FIG A;  2ODR D;  4R2C A;  1X5W A;  4R2A A;  3BGH A;  1TN9 A;  4BS9 A;  2YRK A;  1L4S A;  2JR1 A;  2LRS A;  5CFF E;  2LBS B;  4BHB A;  1HNW E;  2B7T A;  2YTN A;  2BB8 A;  2R1F A;  3EPJ A;  1UBD C;  4WSG A;  3L00 A;  2MDG A;  2WBT A;  2EPC A;  4DV6 E;  4R03 A;  2YTO A;  4M30 A;  1PJQ A;  1MEY C;  4IJD A;  4DUZ E;  2NUF A;  5IT9 C;  2EN1 A;  5AAS A;  1BB8 A;  1N33 E;  2KON A;  2N3H A;  2K4V A;  1ZBT A;  4BMJ A;  4DV0 E;  2EM7 A;  2PRT A;  2EPZ A;  2FV4 B;  3VHT B;  2F4V E;  2N8X A;  3QG5 C;  1XMQ E;  3AUZ A;  2EOF A;  1IQS A;  3K6Q A;  3F6H A;  2V85 A;  2IHR 1;  3BBG A;  2CPN A;  4DV3 E;  4M9V C;  4AQY E;  3JTZ A;  1Z1B A;  3BF2 A;  1FKA E;  5F3W A;  3ADG A;  2EN3 A;  1HR0 E;  4JI0 E;  2ENC A;  4KWY A;  5A6A A;  2ELY A;  4JV5 E;  2DB2 A;  4J8Z A;  3J7Y p;  2KHX A;  2MDR A;  3EQ1 A;  4KHP E;  4GEQ B;  2EOJ A;  1UN6 B;  3JU0 A;  1ZBQ A;  1X47 A;  2VQE E;  2ADR A;  2BBG A;  2YRH A;  2YTQ A;  1YSA C;  3ZOQ B;  2A25 A;  5AE3 A;  3J81 C;  4R2D A;  1IMU A;  2EOM A;  4LF8 E;  2EPU A;  3ADL A;  4NXN E;  2EOQ A;  2VF1 A;  2LE2 A;  2V83 A;  5TSE A;  2K7I A;  4OOG C;  4OX9 E;  5AE2 A;  2LCE A;  2M4I A;  4X64 E;  4X8W A;  2L8T A;  1WJP A;  4B3S E;  5DNY A;  2Q8U A;  2EN4 A;  4ZYG A;  3C4T A;  2EQ1 A;  2JOB A;  2LO3 A;  2D9H A;  4DR4 E;  2EN6 A;  3OTO E;  4LFA E;  4L5N C;  4DR5 E;  2GLI A;  1J5E E;  4HTG A;  2DSY A;  2EL5 A;  2DMI A;  4DV1 E;  4MLV A;  2FGG A;  3F6G A;  1STU A;  2EE8 A;  2M9A A;  2L2M A;  4ZYH A;  4X65 E;  2LT7 A;  1AH5 A;  5KL7 A;  5A6B A;  2YTP A;  2L3J A;  2EL6 A;  5LL6 R;  2EJ4 A;  4IS1 C;  2YPN A;  2MKD A;  2EN7 A;  1GQE A;  1SFE A;  1DQ3 A;  2YT4 A;  2UUA E;  2L3C A;  3HTX A;  2B3T B;  1FJG E;  1AAY A;  2JPA A;  4BHC A;  4HEI A;  4GKK E;  2JYA A;  1GTK A;  2EP3 A;  1UIL A;  4BBY A;  1IQO A;  1RMD A;  5AC4 A;  2YTF A;  1X49 A;  2RSM A;  4NZV A;  3DF6 A;  2UUB E;  4O24 A;  2EMG A;  2JOX A;  2VRD A;  5LMU E;  3VYX A;  3BID A;  4DV4 E;  4RH8 A;  2V87 A;  4LF6 E;  4GZN C;  1SR9 A;  3T1H E;  4F9A B;  2EOY A;  2EPK X;  2YTG A;  4P78 A;  2YRM A;  3EPK A;  2VE7 C;  2EL4 A;  1A1G A;  4DR1 E;  4LF9 E;  4F6N A;  2DIX A;  2DLK A;  1ZU1 A;  2NA2 A;  1PKP A;  2MC5 A;  2YSO A;  2YU5 A;  1NCS A;  2YTI A;  4KZS A;  2I13 A;  2DGC A;  4YHH E;  2EM5 A;  3IWB A;  1IBL E;  1N36 E;  3C6K A;  3EPL A; 
#chains in the Genus database with same CATH homology
 1G2D C;  1UN6 B;  1LLM C;  2EM4 A;  2EPR A;  2EOO A;  2WBU A;  2ADR A;  2YRH A;  2YTQ A;  1JK2 A;  1YSA C;  2J7J A;  2GHF A;  1X6F A;  2EOR A;  1TF6 A;  2A25 A;  2YSP A;  1X3C A;  4R2D A;  2EOM A;  2YTD A;  2EPU A;  2EOS A;  1KJK A;  2EOQ A;  2EMW A;  2EM3 A;  2RPC A;  2EQ0 A;  1YUI A;  2EM0 A;  4R2E A;  2ELZ A;  3M99 B;  2EML A;  2LCE A;  5KL4 A;  2CSH A;  1BBO A;  2EOH A;  1A1L A;  2YU8 A;  2EMB A;  2LV2 A;  1WJP A;  1A1J A;  2EMH A;  1G2F C;  2EN4 A;  1P47 A;  1B69 A;  2EM9 A;  2EQ1 A;  2LO3 A;  4X9J A;  4FK5 C;  2EQ3 A;  1A1K A;  2D9H A;  1F2I G;  2EN6 A;  2E72 A;  2GLI A;  2RSI A;  2EL5 A;  2DMI A;  4R2C A;  1X5W A;  3UK3 C;  4R2A A;  1JK1 A;  1TN9 A;  2EE8 A;  2M9A A;  2YRK A;  5KL5 A;  3EPH A;  2EOX A;  2LT7 A;  5KL7 A;  2EMA A;  2YTP A;  2YTN A;  2EL6 A;  4R2P A;  2BB8 A;  2EJ4 A;  5KL2 A;  2R1F A;  4IS1 C;  2MKD A;  1YUJ A;  3EPJ A;  2EN7 A;  1UBD C;  1X6H A;  4WSG A;  1ZAA C;  2MDG A;  2WBT A;  2EMK A;  2EPC A;  4R2R A;  2EMC A;  2EMI A;  5KL3 A;  1AAY A;  2JPA A;  2HGH A;  5KL6 A;  2EPP A;  2YTO A;  1MEY C;  2EMX A;  2EP3 A;  4IJD A;  1RMD A;  2EMY A;  2EMF A;  4F6M A;  2YTE A;  2JP9 A;  2EN1 A;  1BB8 A;  2DRP A;  1DGC A;  2EOZ A;  2EPX A;  2YTF A;  1TF3 A;  2EM8 A;  4F2J C;  1A1I A;  2EN8 A;  2EM7 A;  2PRT A;  2EMG A;  2EPZ A;  2VRD A;  2EN2 A;  2CTD A;  3VHT B;  2DLQ A;  4GZN C;  3MHH C;  2EOY A;  1ZR9 A;  2EOF A;  2YTG A;  2YRM A;  3EPK A;  4M9V C;  2ENA A;  2EL4 A;  1A1G A;  2EM6 A;  1A1F A;  4R2S A;  4F6N A;  1Z1B A;  2DLK A;  2ENH A;  1ZU1 A;  2LVH A;  2EN3 A;  2YTJ A;  4R2Q A;  2ENC A;  2YSO A;  2YU5 A;  2ELY A;  1NCS A;  1A1H A;  2YTI A;  2WBS A;  2CT1 A;  2EPA A;  2I13 A;  2DGC A;  2EM2 A;  1X6E A;  2EM5 A;  2EOI A;  2WCC 3;  2EMZ A;  2EOE A;  2NAB A;  2MKN A;  3MHS C;  2EOJ A;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...