2LVHA

Solution structure of the zinc finger afv1p06 protein from the hyperthermophilic archaeal virus afv1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
45
structure length
45
Chain Sequence
MERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an archaeal DNA binding protein with an eukaryotic zinc finger fold.
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Metal binding protein
molecule keywords Putative zinc finger protein ORF59a
total genus 10
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2012-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lvhA00
2JPAA 2WBUA 2LV2A 2DLKA 2YRMA 2J7JA 4IJDA 1LLMC 1A1HA 2M9AA 1WJPA 2YU5A 1P47A 2LO3A 2YTGA 1BB8A 2EOQA 2I13A 2EMAA 1F2IG 1KJKA 2YTQA 2EPUA 2EM2A 3VHTB 1BBOA 2EP3A 1X5WA 2WBSA 2CTDA 2ELYA 2EMYA 2EOMA 2YTPA 2EQ0A 2EE8A 2ENAA 2EPZA 1DGCA 1RMDA 2YRKA 4R2CA 2EOSA 2YRHA 3EPHA 5KL2A 2YTOA 2EN2A 4R2EA 2PRTA 2MDGA 3EPLA 2EM9A 1UBDC 2JP9A 4R2AA 2ENCA 5KL6A 1Z1BA 2EN4A 2YTDA 1ZAAC 2DMIA 2ELZA 4FK5C 5KL4A 2EM4A 1X6EA 2LVHA 2DGCA 2VRDA 2EMFA 2YTJA 2EL5A 2YTIA 1UN6B 3EPJA 2EMLA 1A1LA 2WCC3 2EN3A 2EM5A 2EOJA 2EPCA 2EMCA 2EM7A 2BB8A 4R2SA 1TN9A 4WSGA 2HGHA 2RPCA 1A1KA 2EM0A 2YTNA 1JK2A 1X6HA 2EM6A 2MKNA 4F6NA 3MHHC 2EMKA 2CSHA 2GHFA 2WBTA 2NABA 2EQ1A 2YSPA 3EPKA 2EMHA 2EORA 5KL3A 1A1GA 1NCSA 2EM8A 2EN6A 2EOFA 1X3CA 4IS1C 1G2FC 3M99B 2YU8A 2EMBA 2GLIA 4R2PA 2YSOA 2EPPA 3MHSC 4M9VC 2LCEA 2EM3A 2LT7A 1A1IA 1YUJA 2YTEA 1AAYA 2EN1A 2EOZA 1MEYC 2EMZA 1A1JA 3UK3C 1ZU1A 2A25A 2D9HA 2CT1A 2EPAA 2EOEA 4F2JC 1ZR9A 1A1FA 1JK1A 2MKDA 2EOOA 4F6MA 4GZNC 2EQ3A 4R2DA 2EOHA 2EMXA 1TF3A 4X9JA 2EJ4A 1X6FA 2E72A 2RSIA 5KL7A 2YTFA 2EN8A 2EMIA 2EN7A 1B69A 2EL6A 1YUIA 2DRPA 2EOXA 2EOYA 2EPRA 4R2QA 2EMGA 2DLQA 2ENHA 2EPXA 2EMWA 1G2DC 4R2RA 2EOIA 5KL5A 1YSAC 2EL4A 2R1FA 2ADRA 1TF6A
chains in the Genus database with same CATH superfamily
2KHXA 4LF5E 2LV2A 2EZ6A 4F9CB 4IJDA 1XMQE 1LLMC 4MLQA 5DNYA 5LMUE 1WJPA 4LTYA 3J7AG 1AH5A 2GPIA 1T4LB 1P47A 2LO3A 2L2NA 2RS7A 2I13A 2EMAA 1T4OA 5TSEA 2M4IA 2IHR1 1F2IG 1KJKA 3VHTB 1BBOA 2CTDA 2EMYA 2EOMA 1N36E 2UU9E 3VYXA 1EH8A 2ENAA 2EPZA 3ZOQB 1PJSA 2YRHA 2EPKX 1STUA 4WX9A 4Q28A 1DI2A 1T38A 1EH7A 4R2AA 3J7Yp 4DV0E 1N33E 4NXNE 2YPNA 2M7QA 3AUZA 5KL4A 2EM4A 1X6EA 1HR0E 2YTJA 4LF9E 2M1SA 1NEIA 4GKJE 2HJJA 2EMLA 4I8OA 2EN3A 2EM5A 3ADJA 2NUFA 2BBGA 4JI3E 5AC4A 3F6HA 2V8QB 2LUPB 2UXCE 2EM6A 2I9IA 2GHFA 5LL6R 4NZVA 1SFEA 4YHHE 5KL3A 1NCSA 5AASA 4LFAE 1YZ9A 2CPNA 2NUEA 3M99B 2YU8A 4R2PA 1RQ0A 4BBYA 4M9VC 3BIDA 1A1IA 2YTEA 2LUQA 3KZZA 1AAYA 2EMZA 1A1JA 2LTRA 3DJWA 1ZU1A 2A25A 2D9HA 4KHPE 2CT1A 4F54A 1WHQA 2EOEA 4B3ME 1XNRE 1EKZA 2EPLX 3BF2A 4DKKA 2EMXA 4F9AB 4X9JA 1YYOA 4KZSA 2EMIA 1QNTA 4B3RE 2EPRA 4Q35B 2ENHA 1GQEA 3L00A 2JWOA 2EWLA 2MC6A 2R76A 1PJQA 3HTXA 4DUYE 2JY9A 3JU0A 1A1HA 4WYQB 4JI7E 2LRSA 3KZYA 4HTGA 3THNA 3C6KA 5T6JA 4J8ZA 2L92A 2EM2A 4DMIA 5IXMB 4TUGA 2WBSA 2FTXB 3OMLA 2FGGA 2EQ0A 1J5EE 2EE8A 4R8OA 3VK6A 4R2CA 2EOSA 2UUAE 5KL2A 2EN2A 4L8NA 3EPLA 3EQ1A 4DV2E 5A2QC 3OTOE 1Z1BA 1WXRA 4X65E 2YTDA 1N32E 2DB2A 3BBGA 4FK5C 2YT4A 4N4RB 4DV6E 2LVHA 2VRDA 2EMFA 2JR1A 1X47A 2K4VA 4DV1E 2EL5A 2YTIA 4JI2E 1UHZA 1A1LA 5A6KA 4WPYA 2V88A 2JYAA 2HC5A 2VF1A 2EOJA 2EMCA 3J81C 4DR3E 4DV3E 4K0KE 2EM0A 1JK2A 4JI5E 2LE2A 3P1XA 2YSPA 5LLQA 2EMHA 2RS6A 2EORA 1QU6A 4M2ZA 1A1GA 3F6GA 2K7IA 2LJHA 4BHBA 2JOBA 1O0WA 4DR2E 1G2FC 3QG5C 2NA2A 5A6BA 2VE7C 2MDRA 2V86A 4NXME 1YUJA 2EN1A 1RC7A 2UXDE 4O43A 4BHCA 4HEIA 4DR7E 4ZYHA 2EOOA 4GEQB 4JI6E 2EJ4A 3KWRA 4MLVA 2EN7A 4ZYEA 1B69A 2EL6A 4WXCA 2YZTA 3ADGA 2EOXA 1BBGA 1N3GA 2DLQA 3RMPA 5AE2A 4F9BB 2EPOA 2N3GA 4BCAA 4DR4E 4B3TE 5IWAE 4JI0E 1T39A 1TF6A 4BMJA 2WBUA 2JPAA 2DLKA 2NUGA 4DV5E 2J7JA 4OOGC 1PJTA 4P7DA 2L3CA 1T4NA 5AC5A 1YFHA 2YU5A 4WXDA 4X62E 1BB8A 3LMLA 5FLXC 5CFFE 3THOB 1GTKA 2EP3A 1X5WA 2ELYA 3HPZA 2YTPA 3IWDA 3JTZA 1DGCA 2V83A 1RMDA 2YRKA 4LU9A 3EPHA 4X8WA 2YTOA 2PRTA 2MDGA 5F3WA 3ADIA 1IBKE 1UBDC 3T1YE 4JYAE 1YYWA 2F8BA 2L2MA 1ZAAC 3BGHA 2EPNA 3ECRA 3J80C 2L33A 1FJGE 1YPNA 1PKPA 3VYYA 1UN6B 3EPJA 2WCC3 2MC5A 2ODRC 2EPCA 2EM7A 2BB8A 4R2SA 4WSGA 2HGHA 1A1KA 2V89A 1X6HA 5AE1A 1J26A 1X49A 4WSPA 4BC9A 4R03A 5LMNE 1X48A 2KONA 1ZBQA 2NABA 2EQ1A 2WBTA 2WZOA 4AQYE 2H36X 4JI8E 3C4BA 5A6AA 2EN6A 3JAMC 2UUBE 1X3CA 3HQ1A 4IS1C 3H09A 1MGTA 2EPMX 3DF6A 2YSOA 2UXBE 2EPPA 5BR8E 1DQ3A 2LCEA 2EM3A 2EOZA 1PDAA 1N34E 1MEYC 3UK3C 2DSYA 2RTXA 2L6MA 2EPAA 3IWBA 2V85A 2VQFE 2F4VE 1JK1A 3C4TA 2MKDA 4X64E 4DV4E 4JI1E 2EOHA 1TF3A 1WRJA 4O24A 5A6BD 5KL7A 2EN8A 1HNXE 4DR5E 4LF7E 1YUIA 2EOYA 4NHRA 4R2QA 4LF6E 2B9DA 1HNZE 2EOIA 1IMUA 2ODRD 2JXPA 4X66E 2EL4A 2DIXA 1IQOA 2R1FA 2ADRA 2E5LE 2MKNA 3IWCA 4LF8E 1XNQE 2V87A 4LFCE 2YRMA 1KYQA 2M9AA 5ADZA 2B7TA 5IT9C 2YTGA 1FKAE 4WFTA 2L2KB 2EOQA 4ZYGA 2N3HA 1L4SA 1HNWE 2YTQA 5IV8B 2EPUA 4ZYDA 1WHNA 2LJUA 3HXLA 3C6MA 2JOXA 2LBSB 1YYKA 4R2EA 5AE3A 2G7HA 4L5NC 1UILA 3K6QA 4YY3E 2EM9A 2JP9A 2ENCA 5KL6A 2EN4A 2DMIA 2ELZA 5A69A 1GZ6A 5A6JA 3TQMA 4B3SE 1ZBTA 1I94E 2DGCA 2HHHE 4LFBE 4O4KA 3ADLA 4RHBB 1EH6A 4KWYA 4OX9E 1TN9A 1IBLE 2RPCA 2YTNA 2VQEE 2DMYA 4F6NA 3MHHC 2RQLA 2EMKA 2CSHA 4P78A 4JI4E 2JVAA 3EPKA 2Q8UA 4TUIA 2LMZA 2EM8A 2EOFA 2L8TA 3HPSA 2YWQA 4RH8A 2EMBA 4BC7A 2GLIA 1IQSA 3MHSC 2ZM6E 2LTSA 4O5GA 2B7VA 2LT7A 3LLHA 4M30A 4M0VA 2FV4B 4LF4E 4DR1E 4F2JC 1ZR9A 1A1FA 4BS9A 4F6MA 4GZNC 2N8XA 1IBME 2EQ3A 4R2DA 2E1MA 1X6FA 2E72A 2KOUA 2RSIA 4JV5E 2YTFA 4DV7E 4GKKE 2L3JA 2B3TB 2UUCE 3T1HE 2DRPA 2EMGA 2EPXA 4DUZE 2RSMA 1SR9A 2EMWA 1G2DC 4R2RA 5KL5A 3MSWA 1YSAC 4DR6E 3AV0A 1XMOE 3FIGA
chains in the Genus database with same CATH topology
2JPAA 2WBUA 2LV2A 2DLKA 2YRMA 2J7JA 4IJDA 1LLMC 1A1HA 2M9AA 1WJPA 2YU5A 1P47A 2LO3A 2YTGA 1BB8A 2EOQA 2I13A 2EMAA 1F2IG 1KJKA 2YTQA 2EPUA 2EM2A 3VHTB 1BBOA 2EP3A 1X5WA 2WBSA 2CTDA 2ELYA 2EMYA 2EOMA 2YTPA 2EQ0A 2EE8A 2ENAA 2EPZA 1DGCA 1RMDA 2YRKA 4R2CA 2EOSA 2YRHA 3EPHA 5KL2A 2YTOA 2EN2A 4R2EA 2PRTA 2MDGA 3EPLA 2EM9A 1UBDC 2JP9A 4R2AA 2ENCA 5KL6A 1Z1BA 2EN4A 2YTDA 1ZAAC 2DMIA 2ELZA 4FK5C 5KL4A 2EM4A 1X6EA 2LVHA 2DGCA 2VRDA 2EMFA 2YTJA 2EL5A 2YTIA 1UN6B 3EPJA 2EMLA 1A1LA 2WCC3 2EN3A 2EM5A 2EOJA 2EPCA 2EMCA 2EM7A 2BB8A 4R2SA 1TN9A 4WSGA 2HGHA 2RPCA 1A1KA 2EM0A 2YTNA 1JK2A 1X6HA 2EM6A 2MKNA 4F6NA 3MHHC 2EMKA 2CSHA 2GHFA 2WBTA 2NABA 2EQ1A 2YSPA 3EPKA 2EMHA 2EORA 5KL3A 1A1GA 1NCSA 2EM8A 2EN6A 2EOFA 1X3CA 4IS1C 1G2FC 3M99B 2YU8A 2EMBA 2GLIA 4R2PA 2YSOA 2EPPA 3MHSC 4M9VC 2LCEA 2EM3A 2LT7A 1A1IA 1YUJA 2YTEA 1AAYA 2EN1A 2EOZA 1MEYC 2EMZA 1A1JA 3UK3C 1ZU1A 2A25A 2D9HA 2CT1A 2EPAA 2EOEA 4F2JC 1ZR9A 1A1FA 1JK1A 2MKDA 2EOOA 4F6MA 4GZNC 2EQ3A 4R2DA 2EOHA 2EMXA 1TF3A 4X9JA 2EJ4A 1X6FA 2E72A 2RSIA 5KL7A 2YTFA 2EN8A 2EMIA 2EN7A 1B69A 2EL6A 1YUIA 2DRPA 2EOXA 2EOYA 2EPRA 4R2QA 2EMGA 2DLQA 2ENHA 2EPXA 2EMWA 1G2DC 4R2RA 2EOIA 5KL5A 1YSAC 2EL4A 2R1FA 2ADRA 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPA A;  2WBU A;  2LV2 A;  2DLK A;  2YRM A;  2J7J A;  4IJD A;  1LLM C;  1A1H A;  2M9A A;  1WJP A;  2YU5 A;  1P47 A;  2LO3 A;  2YTG A;  1BB8 A;  2EOQ A;  2I13 A;  2EMA A;  1F2I G;  1KJK A;  2YTQ A;  2EPU A;  2EM2 A;  3VHT B;  1BBO A;  2EP3 A;  1X5W A;  2WBS A;  2CTD A;  2ELY A;  2EMY A;  2EOM A;  2YTP A;  2EQ0 A;  2EE8 A;  2ENA A;  2EPZ A;  1DGC A;  1RMD A;  2YRK A;  4R2C A;  2EOS A;  2YRH A;  3EPH A;  5KL2 A;  2YTO A;  2EN2 A;  4R2E A;  2PRT A;  2MDG A;  3EPL A;  2EM9 A;  1UBD C;  2JP9 A;  4R2A A;  2ENC A;  5KL6 A;  1Z1B A;  2EN4 A;  2YTD A;  1ZAA C;  2DMI A;  2ELZ A;  4FK5 C;  5KL4 A;  2EM4 A;  1X6E A;  2LVH A;  2DGC A;  2VRD A;  2EMF A;  2YTJ A;  2EL5 A;  2YTI A;  1UN6 B;  3EPJ A;  2EML A;  1A1L A;  2WCC 3;  2EN3 A;  2EM5 A;  2EOJ A;  2EPC A;  2EMC A;  2EM7 A;  2BB8 A;  4R2S A;  1TN9 A;  4WSG A;  2HGH A;  2RPC A;  1A1K A;  2EM0 A;  2YTN A;  1JK2 A;  1X6H A;  2EM6 A;  2MKN A;  4F6N A;  3MHH C;  2EMK A;  2CSH A;  2GHF A;  2WBT A;  2NAB A;  2EQ1 A;  2YSP A;  3EPK A;  2EMH A;  2EOR A;  5KL3 A;  1A1G A;  1NCS A;  2EM8 A;  2EN6 A;  2EOF A;  1X3C A;  4IS1 C;  1G2F C;  3M99 B;  2YU8 A;  2EMB A;  2GLI A;  4R2P A;  2YSO A;  2EPP A;  3MHS C;  4M9V C;  2LCE A;  2EM3 A;  2LT7 A;  1A1I A;  1YUJ A;  2YTE A;  1AAY A;  2EN1 A;  2EOZ A;  1MEY C;  2EMZ A;  1A1J A;  3UK3 C;  1ZU1 A;  2A25 A;  2D9H A;  2CT1 A;  2EPA A;  2EOE A;  4F2J C;  1ZR9 A;  1A1F A;  1JK1 A;  2MKD A;  2EOO A;  4F6M A;  4GZN C;  2EQ3 A;  4R2D A;  2EOH A;  2EMX A;  1TF3 A;  4X9J A;  2EJ4 A;  1X6F A;  2E72 A;  2RSI A;  5KL7 A;  2YTF A;  2EN8 A;  2EMI A;  2EN7 A;  1B69 A;  2EL6 A;  1YUI A;  2DRP A;  2EOX A;  2EOY A;  2EPR A;  4R2Q A;  2EMG A;  2DLQ A;  2ENH A;  2EPX A;  2EMW A;  1G2D C;  4R2R A;  2EOI A;  5KL5 A;  1YSA C;  2EL4 A;  2R1F A;  2ADR A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 2KHX A;  4LF5 E;  2LV2 A;  2EZ6 A;  4F9C B;  4IJD A;  1XMQ E;  1LLM C;  4MLQ A;  5DNY A;  5LMU E;  1WJP A;  4LTY A;  3J7A G;  1AH5 A;  2GPI A;  1T4L B;  1P47 A;  2LO3 A;  2L2N A;  2RS7 A;  2I13 A;  2EMA A;  1T4O A;  5TSE A;  2M4I A;  2IHR 1;  1F2I G;  1KJK A;  3VHT B;  1BBO A;  2CTD A;  2EMY A;  2EOM A;  1N36 E;  2UU9 E;  3VYX A;  1EH8 A;  2ENA A;  2EPZ A;  3ZOQ B;  1PJS A;  2YRH A;  2EPK X;  1STU A;  4WX9 A;  4Q28 A;  1DI2 A;  1T38 A;  1EH7 A;  4R2A A;  3J7Y p;  4DV0 E;  1N33 E;  4NXN E;  2YPN A;  2M7Q A;  3AUZ A;  5KL4 A;  2EM4 A;  1X6E A;  1HR0 E;  2YTJ A;  4LF9 E;  2M1S A;  1NEI A;  4GKJ E;  2HJJ A;  2EML A;  4I8O A;  2EN3 A;  2EM5 A;  3ADJ A;  2NUF A;  2BBG A;  4JI3 E;  5AC4 A;  3F6H A;  2V8Q B;  2LUP B;  2UXC E;  2EM6 A;  2I9I A;  2GHF A;  5LL6 R;  4NZV A;  1SFE A;  4YHH E;  5KL3 A;  1NCS A;  5AAS A;  4LFA E;  1YZ9 A;  2CPN A;  2NUE A;  3M99 B;  2YU8 A;  4R2P A;  1RQ0 A;  4BBY A;  4M9V C;  3BID A;  1A1I A;  2YTE A;  2LUQ A;  3KZZ A;  1AAY A;  2EMZ A;  1A1J A;  2LTR A;  3DJW A;  1ZU1 A;  2A25 A;  2D9H A;  4KHP E;  2CT1 A;  4F54 A;  1WHQ A;  2EOE A;  4B3M E;  1XNR E;  1EKZ A;  2EPL X;  3BF2 A;  4DKK A;  2EMX A;  4F9A B;  4X9J A;  1YYO A;  4KZS A;  2EMI A;  1QNT A;  4B3R E;  2EPR A;  4Q35 B;  2ENH A;  1GQE A;  3L00 A;  2JWO A;  2EWL A;  2MC6 A;  2R76 A;  1PJQ A;  3HTX A;  4DUY E;  2JY9 A;  3JU0 A;  1A1H A;  4WYQ B;  4JI7 E;  2LRS A;  3KZY A;  4HTG A;  3THN A;  3C6K A;  5T6J A;  4J8Z A;  2L92 A;  2EM2 A;  4DMI A;  5IXM B;  4TUG A;  2WBS A;  2FTX B;  3OML A;  2FGG A;  2EQ0 A;  1J5E E;  2EE8 A;  4R8O A;  3VK6 A;  4R2C A;  2EOS A;  2UUA E;  5KL2 A;  2EN2 A;  4L8N A;  3EPL A;  3EQ1 A;  4DV2 E;  5A2Q C;  3OTO E;  1Z1B A;  1WXR A;  4X65 E;  2YTD A;  1N32 E;  2DB2 A;  3BBG A;  4FK5 C;  2YT4 A;  4N4R B;  4DV6 E;  2LVH A;  2VRD A;  2EMF A;  2JR1 A;  1X47 A;  2K4V A;  4DV1 E;  2EL5 A;  2YTI A;  4JI2 E;  1UHZ A;  1A1L A;  5A6K A;  4WPY A;  2V88 A;  2JYA A;  2HC5 A;  2VF1 A;  2EOJ A;  2EMC A;  3J81 C;  4DR3 E;  4DV3 E;  4K0K E;  2EM0 A;  1JK2 A;  4JI5 E;  2LE2 A;  3P1X A;  2YSP A;  5LLQ A;  2EMH A;  2RS6 A;  2EOR A;  1QU6 A;  4M2Z A;  1A1G A;  3F6G A;  2K7I A;  2LJH A;  4BHB A;  2JOB A;  1O0W A;  4DR2 E;  1G2F C;  3QG5 C;  2NA2 A;  5A6B A;  2VE7 C;  2MDR A;  2V86 A;  4NXM E;  1YUJ A;  2EN1 A;  1RC7 A;  2UXD E;  4O43 A;  4BHC A;  4HEI A;  4DR7 E;  4ZYH A;  2EOO A;  4GEQ B;  4JI6 E;  2EJ4 A;  3KWR A;  4MLV A;  2EN7 A;  4ZYE A;  1B69 A;  2EL6 A;  4WXC A;  2YZT A;  3ADG A;  2EOX A;  1BBG A;  1N3G A;  2DLQ A;  3RMP A;  5AE2 A;  4F9B B;  2EPO A;  2N3G A;  4BCA A;  4DR4 E;  4B3T E;  5IWA E;  4JI0 E;  1T39 A;  1TF6 A;  4BMJ A;  2WBU A;  2JPA A;  2DLK A;  2NUG A;  4DV5 E;  2J7J A;  4OOG C;  1PJT A;  4P7D A;  2L3C A;  1T4N A;  5AC5 A;  1YFH A;  2YU5 A;  4WXD A;  4X62 E;  1BB8 A;  3LML A;  5FLX C;  5CFF E;  3THO B;  1GTK A;  2EP3 A;  1X5W A;  2ELY A;  3HPZ A;  2YTP A;  3IWD A;  3JTZ A;  1DGC A;  2V83 A;  1RMD A;  2YRK A;  4LU9 A;  3EPH A;  4X8W A;  2YTO A;  2PRT A;  2MDG A;  5F3W A;  3ADI A;  1IBK E;  1UBD C;  3T1Y E;  4JYA E;  1YYW A;  2F8B A;  2L2M A;  1ZAA C;  3BGH A;  2EPN A;  3ECR A;  3J80 C;  2L33 A;  1FJG E;  1YPN A;  1PKP A;  3VYY A;  1UN6 B;  3EPJ A;  2WCC 3;  2MC5 A;  2ODR C;  2EPC A;  2EM7 A;  2BB8 A;  4R2S A;  4WSG A;  2HGH A;  1A1K A;  2V89 A;  1X6H A;  5AE1 A;  1J26 A;  1X49 A;  4WSP A;  4BC9 A;  4R03 A;  5LMN E;  1X48 A;  2KON A;  1ZBQ A;  2NAB A;  2EQ1 A;  2WBT A;  2WZO A;  4AQY E;  2H36 X;  4JI8 E;  3C4B A;  5A6A A;  2EN6 A;  3JAM C;  2UUB E;  1X3C A;  3HQ1 A;  4IS1 C;  3H09 A;  1MGT A;  2EPM X;  3DF6 A;  2YSO A;  2UXB E;  2EPP A;  5BR8 E;  1DQ3 A;  2LCE A;  2EM3 A;  2EOZ A;  1PDA A;  1N34 E;  1MEY C;  3UK3 C;  2DSY A;  2RTX A;  2L6M A;  2EPA A;  3IWB A;  2V85 A;  2VQF E;  2F4V E;  1JK1 A;  3C4T A;  2MKD A;  4X64 E;  4DV4 E;  4JI1 E;  2EOH A;  1TF3 A;  1WRJ A;  4O24 A;  5A6B D;  5KL7 A;  2EN8 A;  1HNX E;  4DR5 E;  4LF7 E;  1YUI A;  2EOY A;  4NHR A;  4R2Q A;  4LF6 E;  2B9D A;  1HNZ E;  2EOI A;  1IMU A;  2ODR D;  2JXP A;  4X66 E;  2EL4 A;  2DIX A;  1IQO A;  2R1F A;  2ADR A;  2E5L E;  2MKN A;  3IWC A;  4LF8 E;  1XNQ E;  2V87 A;  4LFC E;  2YRM A;  1KYQ A;  2M9A A;  5ADZ A;  2B7T A;  5IT9 C;  2YTG A;  1FKA E;  4WFT A;  2L2K B;  2EOQ A;  4ZYG A;  2N3H A;  1L4S A;  1HNW E;  2YTQ A;  5IV8 B;  2EPU A;  4ZYD A;  1WHN A;  2LJU A;  3HXL A;  3C6M A;  2JOX A;  2LBS B;  1YYK A;  4R2E A;  5AE3 A;  2G7H A;  4L5N C;  1UIL A;  3K6Q A;  4YY3 E;  2EM9 A;  2JP9 A;  2ENC A;  5KL6 A;  2EN4 A;  2DMI A;  2ELZ A;  5A69 A;  1GZ6 A;  5A6J A;  3TQM A;  4B3S E;  1ZBT A;  1I94 E;  2DGC A;  2HHH E;  4LFB E;  4O4K A;  3ADL A;  4RHB B;  1EH6 A;  4KWY A;  4OX9 E;  1TN9 A;  1IBL E;  2RPC A;  2YTN A;  2VQE E;  2DMY A;  4F6N A;  3MHH C;  2RQL A;  2EMK A;  2CSH A;  4P78 A;  4JI4 E;  2JVA A;  3EPK A;  2Q8U A;  4TUI A;  2LMZ A;  2EM8 A;  2EOF A;  2L8T A;  3HPS A;  2YWQ A;  4RH8 A;  2EMB A;  4BC7 A;  2GLI A;  1IQS A;  3MHS C;  2ZM6 E;  2LTS A;  4O5G A;  2B7V A;  2LT7 A;  3LLH A;  4M30 A;  4M0V A;  2FV4 B;  4LF4 E;  4DR1 E;  4F2J C;  1ZR9 A;  1A1F A;  4BS9 A;  4F6M A;  4GZN C;  2N8X A;  1IBM E;  2EQ3 A;  4R2D A;  2E1M A;  1X6F A;  2E72 A;  2KOU A;  2RSI A;  4JV5 E;  2YTF A;  4DV7 E;  4GKK E;  2L3J A;  2B3T B;  2UUC E;  3T1H E;  2DRP A;  2EMG A;  2EPX A;  4DUZ E;  2RSM A;  1SR9 A;  2EMW A;  1G2D C;  4R2R A;  5KL5 A;  3MSW A;  1YSA C;  4DR6 E;  3AV0 A;  1XMO E;  3FIG A; 
#chains in the Genus database with same CATH homology
 2JPA A;  2WBU A;  2LV2 A;  2DLK A;  2YRM A;  2J7J A;  4IJD A;  1LLM C;  1A1H A;  2M9A A;  1WJP A;  2YU5 A;  1P47 A;  2LO3 A;  2YTG A;  1BB8 A;  2EOQ A;  2I13 A;  2EMA A;  1F2I G;  1KJK A;  2YTQ A;  2EPU A;  2EM2 A;  3VHT B;  1BBO A;  2EP3 A;  1X5W A;  2WBS A;  2CTD A;  2ELY A;  2EMY A;  2EOM A;  2YTP A;  2EQ0 A;  2EE8 A;  2ENA A;  2EPZ A;  1DGC A;  1RMD A;  2YRK A;  4R2C A;  2EOS A;  2YRH A;  3EPH A;  5KL2 A;  2YTO A;  2EN2 A;  4R2E A;  2PRT A;  2MDG A;  3EPL A;  2EM9 A;  1UBD C;  2JP9 A;  4R2A A;  2ENC A;  5KL6 A;  1Z1B A;  2EN4 A;  2YTD A;  1ZAA C;  2DMI A;  2ELZ A;  4FK5 C;  5KL4 A;  2EM4 A;  1X6E A;  2LVH A;  2DGC A;  2VRD A;  2EMF A;  2YTJ A;  2EL5 A;  2YTI A;  1UN6 B;  3EPJ A;  2EML A;  1A1L A;  2WCC 3;  2EN3 A;  2EM5 A;  2EOJ A;  2EPC A;  2EMC A;  2EM7 A;  2BB8 A;  4R2S A;  1TN9 A;  4WSG A;  2HGH A;  2RPC A;  1A1K A;  2EM0 A;  2YTN A;  1JK2 A;  1X6H A;  2EM6 A;  2MKN A;  4F6N A;  3MHH C;  2EMK A;  2CSH A;  2GHF A;  2WBT A;  2NAB A;  2EQ1 A;  2YSP A;  3EPK A;  2EMH A;  2EOR A;  5KL3 A;  1A1G A;  1NCS A;  2EM8 A;  2EN6 A;  2EOF A;  1X3C A;  4IS1 C;  1G2F C;  3M99 B;  2YU8 A;  2EMB A;  2GLI A;  4R2P A;  2YSO A;  2EPP A;  3MHS C;  4M9V C;  2LCE A;  2EM3 A;  2LT7 A;  1A1I A;  1YUJ A;  2YTE A;  1AAY A;  2EN1 A;  2EOZ A;  1MEY C;  2EMZ A;  1A1J A;  3UK3 C;  1ZU1 A;  2A25 A;  2D9H A;  2CT1 A;  2EPA A;  2EOE A;  4F2J C;  1ZR9 A;  1A1F A;  1JK1 A;  2MKD A;  2EOO A;  4F6M A;  4GZN C;  2EQ3 A;  4R2D A;  2EOH A;  2EMX A;  1TF3 A;  4X9J A;  2EJ4 A;  1X6F A;  2E72 A;  2RSI A;  5KL7 A;  2YTF A;  2EN8 A;  2EMI A;  2EN7 A;  1B69 A;  2EL6 A;  1YUI A;  2DRP A;  2EOX A;  2EOY A;  2EPR A;  4R2Q A;  2EMG A;  2DLQ A;  2ENH A;  2EPX A;  2EMW A;  1G2D C;  4R2R A;  2EOI A;  5KL5 A;  1YSA C;  2EL4 A;  2R1F A;  2ADR A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...