2EOSA

Solution structure of the c2h2 type zinc finger (region 626-654) of human b-cell lymphoma 6 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYPCEICGTRFRHLQTLKSHLRIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 6 protein
publication title Solution structure of the C2H2 type zinc finger (region 626-654) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eosA01
2MDGA 2YRKA 2M9AA 1MEYC 2EJ4A 1G2FC 2EM5A 2DGCA 1WJPA 1YUJA 2J7JA 2WCC3 2EN6A 1X6HA 2EL4A 2EN1A 5KL3A 1A1LA 2EPXA 1ZAAC 5KL5A 2CTDA 2E72A 2EM8A 1BB8A 2EP3A 2CSHA 2EM6A 1F2IG 2CT1A 2YTDA 2ENHA 1P47A 1A1HA 2EOYA 3EPJA 2EE8A 2YTFA 3EPHA 2YTJA 1ZR9A 2EM0A 2EL6A 2YTEA 2EOSA 4IJDA 2EN7A 2YSOA 2DLQA 4R2QA 2EN3A 4X9JA 1DGCA 2DLKA 2EMGA 2YTNA 1G2DC 2YU8A 2EOJA 1YUIA 2EM7A 2EOZA 2YTPA 4WSGA 2R1FA 2VRDA 2WBSA 3EPLA 2EOIA 1TN9A 4F6MA 2EORA 2YU5A 2I13A 2D9HA 1TF3A 2ENAA 2EQ1A 3VHTB 2PRTA 1RMDA 2EPPA 1B69A 2EM9A 2EPAA 5KL6A 2GLIA 2EM2A 2EOEA 5KL2A 5KL4A 4IS1C 2EMBA 2EPCA 4R2CA 1X6EA 4R2RA 2EQ3A 5KL7A 2EMZA 2EOOA 2EOXA 2EOMA 1TF6A 2EMHA 2YRHA 2ADRA 4R2SA 3UK3C 4F6NA 1A1GA 2HGHA 2RSIA 2LV2A 4FK5C 2EN2A 2EMWA 2EPRA 2LO3A 2JPAA 1NCSA 2EM3A 2YSPA 2EPZA 2YTIA 2YTQA 1JK2A 2EN4A 2DMIA 3MHSC 1X5WA 4GZNC 2A25A 2NABA 2YTOA 2EMIA 1Z1BA 2WBUA 1A1IA 2EQ0A 2MKNA 1X6FA 1A1JA 4R2EA 2EMYA 2ELYA 1LLMC 1KJKA 3M99B 4R2DA 1JK1A 2EOHA 1BBOA 2EL5A 2EM4A 2YRMA 2EMKA 1A1FA 2EMFA 2LVHA 2BB8A 2YTGA 2RPCA 1UBDC 4R2AA 4M9VC 3EPKA 2ENCA 2EN8A 2MKDA 2DRPA 2EPUA 2LCEA 2EMCA 2EMXA 1UN6B 2LT7A 4R2PA 1AAYA 2ELZA 2EMLA 2EMAA 2EOQA 4F2JC 1ZU1A 3MHHC 2EOFA 1YSAC 1X3CA 2JP9A 1A1KA 2WBTA 2GHFA
chains in the Genus database with same CATH superfamily
2MDGA 2YRKA 5AASA 3FIGA 2EJ4A 2LUQA 4DV7E 1SR9A 2F8BA 2EM5A 3ADLA 1YUJA 1J26A 1GTKA 2KHXA 4LFBE 3THOB 2LMZA 1SFEA 1F2IG 1T38A 2RTXA 2CT1A 1PKPA 2ODRD 4B3SE 2EOYA 3EPJA 2V88A 2K4VA 4LF6E 3KZZA 3THNA 2YTEA 2EOSA 1WXRA 2VE7C 1YYOA 1BBGA 4O4KA 2EN3A 2B7VA 3OMLA 4X9JA 4Q28A 2EMGA 2YTNA 5TSEA 1QNTA 4B3ME 2EOJA 2B7TA 2EOZA 4DR2E 2YTPA 3F6HA 2VRDA 3J7AG 2WBSA 4X62E 1NEIA 5AE3A 1X48A 2VQEE 3DJWA 2UUBE 2EPPA 4P7DA 1B69A 1YYWA 2V87A 4HEIA 2YPNA 4GEQB 4DKKA 4RH8A 4DMIA 5KL2A 5KL4A 4IS1C 5FLXC 2EPCA 1PJSA 1FJGE 2UUAE 1IQOA 2FV4B 2EOXA 2BBGA 1TF6A 2YRHA 1A1GA 4LF4E 1QU6A 3HXLA 3DF6A 4FK5C 4DR4E 2EMWA 3BIDA 4M30A 4ZYHA 2DMIA 4NZVA 5IXMB 4WXCA 2YTOA 1STUA 4L5NC 4O24A 4ZYGA 1A1JA 2RQLA 1LLMC 1KJKA 2JVAA 3JU0A 2YRMA 2EMKA 4X66E 2LVHA 3IWDA 2GPIA 2MDRA 1UBDC 2YT4A 2EN8A 4L8NA 2EPUA 4J8ZA 4ZYDA 2HC5A 5BR8E 2UUCE 2UU9E 4R2PA 1AAYA 2EMAA 3L00A 4WPYA 3ADJA 4TUGA 4DR5E 4F2JC 3BGHA 1YZ9A 2I9IA 1X3CA 2JP9A 1A1KA 2L2MA 4DV1E 3EQ1A 3J7Yp 2WBTA 3JTZA 2M9AA 4LTYA 1MEYC 1T4LB 2N3GA 5IT9C 2JY9A 4DV6E 4GKKE 2EPXA 2DB2A 1ZAAC 4LF8E 2LJHA 3RMPA 1WHNA 2YTFA 2DMYA 1ZR9A 2EM0A 5IV8B 4O43A 2DLQA 5T6JA 4JI0E 5A6BA 3VK6A 1DGCA 1G2DC 1PJTA 2NA2A 1YUIA 2EM7A 1I94E 4KZSA 4WFTA 1N32E 4LFAE 4NXME 4WSPA 2R76A 3VYXA 2JWOA 1TN9A 4F6MA 2V86A 2YU5A 2ENAA 2EQ1A 3VHTB 2E1MA 1IBKE 1RMDA 2RS6A 1RC7A 2EM2A 1EH6A 2L3JA 2EMBA 3ADGA 4WYQB 4F9BB 2WZOA 4X8WA 2EQ3A 4ZYEA 5LMUE 2EOOA 2EOMA 2EMHA 4BC9A 1YPNA 4F6NA 2RSIA 2LV2A 1IBLE 1GZ6A 5A6KA 4JI6E 2LO3A 1NCSA 4BMJA 2EN4A 4F9CB 5LMNE 1YYKA 3MHSC 1X5WA 5IWAE 5AC4A 3T1YE 4R2EA 4AQYE 1PJQA 5F3WA 2VF1A 2BB8A 1UILA 2YTGA 4R2AA 4BHCA 4NXNE 4YHHE 2ZM6E 2LCEA 2M7QA 4GKJE 2EMXA 1UN6B 4LF9E 2ELZA 3JAMC 1EH7A 4JI2E 3MHHC 1YSAC 1ZBTA 2JXPA 2JOBA 2NUFA 2GHFA 3J80C 2Q8UA 4LF7E 4JI3E 4DV2E 3LLHA 2DGCA 4BC7A 1WJPA 2J7JA 1X6HA 5LLQA 1A1LA 1XNRE 5KL5A 2CTDA 2E72A 1BB8A 2MC6A 2CSHA 2EM6A 2YTDA 3H09A 1AH5A 2ENHA 1P47A 1A1HA 4JYAE 2EE8A 3EPHA 2EPKX 4WX9A 2JR1A 2YZTA 2YSOA 3C6KA 4R2QA 1L4SA 2V8QB 2LRSA 2L2NA 2YU8A 4DR1E 3J81C 1IBME 3F6GA 4WSGA 1HNWE 2R1FA 2KOUA 3EPLA 4DR3E 1PDAA 2EOIA 2CPNA 4N4RB 1T39A 3KZYA 2EORA 4OOGC 2I13A 2NUEA 2D9HA 1TF3A 3AV0A 4WXDA 4M2ZA 2N3HA 4KWYA 4BHBA 5AC5A 2EM9A 2EPAA 1HR0E 5KL6A 2GLIA 2EOEA 1HNXE 2KONA 2EPNA 1WRJA 4YY3E 2EWLA 1X47A 4DV4E 1X6EA 4R2RA 3ADIA 2EZ6A 4MLQA 2EMZA 3P1XA 4JI5E 3UK3C 2UXBE 1DI2A 2LE2A 2G7HA 2K7IA 4M0VA 2JPAA 2EM3A 2EPZA 1XMQE 2YTQA 4LU9A 5CFFE 3OTOE 4DUYE 4GZNC 2A25A 3BBGA 2NABA 4TUIA 3MSWA 2EPLX 3TQMA 2EQ0A 2MKNA 4OX9E 2EMYA 4JI7E 1BBOA 2EL5A 2L3CA 1A1FA 2H36X 4HTGA 2L92A 4BS9A 3ZOQB 2RPCA 2RS7A 2DIXA 1KYQA 2L33A 2ENCA 4K0KE 3KWRA 2FTXB 2V85A 2LT7A 4F54A 3HTXA 2EOQA 2JOXA 2LJUA 2EOFA 3C4BA 4KHPE 4B3RE 1MGTA 1GQEA 1XMOE 3HQ1A 1G2FC 4JI8E 2WCC3 2EN6A 2EN1A 2EL4A 2VQFE 2F4VE 5KL3A 5ADZA 1XNQE 2EM8A 4X64E 1ZBQA 2EP3A 2UXDE 4JI4E 2RSMA 3T1HE 4I8OA 2YTJA 2YWQA 2EPMX 2EL6A 4MLVA 3IWBA 1N36E 4IJDA 2EN7A 5A69A 2E5LE 2V89A 1T4OA 1N34E 5A6JA 2DLKA 2HHHE 4LF5E 2DSYA 4Q35B 4BBYA 4LFCE 1IQSA 4DV0E 5A2QC 3IWCA 2UXCE 5AE2A 2L6MA 5A6BD 2FGGA 3LMLA 2PRTA 3ECRA 4P78A 5LL6R 3HPZA 5A6AA 1N33E 4R03A 3VYYA 2NUGA 1UHZA 4JI1E 3C4TA 4R2CA 2L2KB 2LTSA 2ODRC 4O5GA 5AE1A 5KL7A 5DNYA 1EH8A 2M1SA 2ADRA 4R2SA 2JYAA 1YFHA 2HGHA 1N3GA 4RHBB 1WHQA 2EN2A 3BF2A 2EPRA 2YSPA 1FKAE 2YTIA 2V83A 1JK2A 3K6QA 2LBSB 1X49A 4JV5E 2EMIA 3HPSA 1Z1BA 1EKZA 2WBUA 1A1IA 1HNZE 1X6FA 1RQ0A 3QG5C 1T4NA 2ELYA 4NHRA 3M99B 4R2DA 1JK1A 2EOHA 4B3TE 2EM4A 1IMUA 2EMFA 1DQ3A 4F9AB 4M9VC 2MC5A 3EPKA 4DR7E 2LTRA 3AUZA 4DV3E 1O0WA 2MKDA 2DRPA 2HJJA 2B3TB 1J5EE 2EMCA 2L8TA 4X65E 4DUZE 2EPOA 2IHR1 2N8XA 2EMLA 4BCAA 2B9DA 4DV5E 4DR6E 1ZU1A 4R8OA 2M4IA 2LUPB 3C6MA
chains in the Genus database with same CATH topology
2MDGA 2YRKA 2M9AA 1MEYC 2EJ4A 1G2FC 2EM5A 2DGCA 1WJPA 1YUJA 2J7JA 2WCC3 2EN6A 1X6HA 2EL4A 2EN1A 5KL3A 1A1LA 2EPXA 1ZAAC 5KL5A 2CTDA 2E72A 2EM8A 1BB8A 2EP3A 2CSHA 2EM6A 1F2IG 2CT1A 2YTDA 2ENHA 1P47A 1A1HA 2EOYA 3EPJA 2EE8A 2YTFA 3EPHA 2YTJA 1ZR9A 2EM0A 2EL6A 2YTEA 2EOSA 4IJDA 2EN7A 2YSOA 2DLQA 4R2QA 2EN3A 4X9JA 1DGCA 2DLKA 2EMGA 2YTNA 1G2DC 2YU8A 2EOJA 1YUIA 2EM7A 2EOZA 2YTPA 4WSGA 2R1FA 2VRDA 2WBSA 3EPLA 2EOIA 1TN9A 4F6MA 2EORA 2YU5A 2I13A 2D9HA 1TF3A 2ENAA 2EQ1A 3VHTB 2PRTA 1RMDA 2EPPA 1B69A 2EM9A 2EPAA 5KL6A 2GLIA 2EM2A 2EOEA 5KL2A 5KL4A 4IS1C 2EMBA 2EPCA 4R2CA 1X6EA 4R2RA 2EQ3A 5KL7A 2EMZA 2EOOA 2EOXA 2EOMA 1TF6A 2EMHA 2YRHA 2ADRA 4R2SA 3UK3C 4F6NA 1A1GA 2HGHA 2RSIA 2LV2A 4FK5C 2EN2A 2EMWA 2EPRA 2LO3A 2JPAA 1NCSA 2EM3A 2YSPA 2EPZA 2YTIA 2YTQA 1JK2A 2EN4A 2DMIA 3MHSC 1X5WA 4GZNC 2A25A 2NABA 2YTOA 2EMIA 1Z1BA 2WBUA 1A1IA 2EQ0A 2MKNA 1X6FA 1A1JA 4R2EA 2EMYA 2ELYA 1LLMC 1KJKA 3M99B 4R2DA 1JK1A 2EOHA 1BBOA 2EL5A 2EM4A 2YRMA 2EMKA 1A1FA 2EMFA 2LVHA 2BB8A 2YTGA 2RPCA 1UBDC 4R2AA 4M9VC 3EPKA 2ENCA 2EN8A 2MKDA 2DRPA 2EPUA 2LCEA 2EMCA 2EMXA 1UN6B 2LT7A 4R2PA 1AAYA 2ELZA 2EMLA 2EMAA 2EOQA 4F2JC 1ZU1A 3MHHC 2EOFA 1YSAC 1X3CA 2JP9A 1A1KA 2WBTA 2GHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDG A;  2YRK A;  2M9A A;  1MEY C;  2EJ4 A;  1G2F C;  2EM5 A;  2DGC A;  1WJP A;  1YUJ A;  2J7J A;  2WCC 3;  2EN6 A;  1X6H A;  2EL4 A;  2EN1 A;  5KL3 A;  1A1L A;  2EPX A;  1ZAA C;  5KL5 A;  2CTD A;  2E72 A;  2EM8 A;  1BB8 A;  2EP3 A;  2CSH A;  2EM6 A;  1F2I G;  2CT1 A;  2YTD A;  2ENH A;  1P47 A;  1A1H A;  2EOY A;  3EPJ A;  2EE8 A;  2YTF A;  3EPH A;  2YTJ A;  1ZR9 A;  2EM0 A;  2EL6 A;  2YTE A;  2EOS A;  4IJD A;  2EN7 A;  2YSO A;  2DLQ A;  4R2Q A;  2EN3 A;  4X9J A;  1DGC A;  2DLK A;  2EMG A;  2YTN A;  1G2D C;  2YU8 A;  2EOJ A;  1YUI A;  2EM7 A;  2EOZ A;  2YTP A;  4WSG A;  2R1F A;  2VRD A;  2WBS A;  3EPL A;  2EOI A;  1TN9 A;  4F6M A;  2EOR A;  2YU5 A;  2I13 A;  2D9H A;  1TF3 A;  2ENA A;  2EQ1 A;  3VHT B;  2PRT A;  1RMD A;  2EPP A;  1B69 A;  2EM9 A;  2EPA A;  5KL6 A;  2GLI A;  2EM2 A;  2EOE A;  5KL2 A;  5KL4 A;  4IS1 C;  2EMB A;  2EPC A;  4R2C A;  1X6E A;  4R2R A;  2EQ3 A;  5KL7 A;  2EMZ A;  2EOO A;  2EOX A;  2EOM A;  1TF6 A;  2EMH A;  2YRH A;  2ADR A;  4R2S A;  3UK3 C;  4F6N A;  1A1G A;  2HGH A;  2RSI A;  2LV2 A;  4FK5 C;  2EN2 A;  2EMW A;  2EPR A;  2LO3 A;  2JPA A;  1NCS A;  2EM3 A;  2YSP A;  2EPZ A;  2YTI A;  2YTQ A;  1JK2 A;  2EN4 A;  2DMI A;  3MHS C;  1X5W A;  4GZN C;  2A25 A;  2NAB A;  2YTO A;  2EMI A;  1Z1B A;  2WBU A;  1A1I A;  2EQ0 A;  2MKN A;  1X6F A;  1A1J A;  4R2E A;  2EMY A;  2ELY A;  1LLM C;  1KJK A;  3M99 B;  4R2D A;  1JK1 A;  2EOH A;  1BBO A;  2EL5 A;  2EM4 A;  2YRM A;  2EMK A;  1A1F A;  2EMF A;  2LVH A;  2BB8 A;  2YTG A;  2RPC A;  1UBD C;  4R2A A;  4M9V C;  3EPK A;  2ENC A;  2EN8 A;  2MKD A;  2DRP A;  2EPU A;  2LCE A;  2EMC A;  2EMX A;  1UN6 B;  2LT7 A;  4R2P A;  1AAY A;  2ELZ A;  2EML A;  2EMA A;  2EOQ A;  4F2J C;  1ZU1 A;  3MHH C;  2EOF A;  1YSA C;  1X3C A;  2JP9 A;  1A1K A;  2WBT A;  2GHF A; 
#chains in the Genus database with same CATH topology
 2MDG A;  2YRK A;  5AAS A;  3FIG A;  2EJ4 A;  2LUQ A;  4DV7 E;  1SR9 A;  2F8B A;  2EM5 A;  3ADL A;  1YUJ A;  1J26 A;  1GTK A;  2KHX A;  4LFB E;  3THO B;  2LMZ A;  1SFE A;  1F2I G;  1T38 A;  2RTX A;  2CT1 A;  1PKP A;  2ODR D;  4B3S E;  2EOY A;  3EPJ A;  2V88 A;  2K4V A;  4LF6 E;  3KZZ A;  3THN A;  2YTE A;  2EOS A;  1WXR A;  2VE7 C;  1YYO A;  1BBG A;  4O4K A;  2EN3 A;  2B7V A;  3OML A;  4X9J A;  4Q28 A;  2EMG A;  2YTN A;  5TSE A;  1QNT A;  4B3M E;  2EOJ A;  2B7T A;  2EOZ A;  4DR2 E;  2YTP A;  3F6H A;  2VRD A;  3J7A G;  2WBS A;  4X62 E;  1NEI A;  5AE3 A;  1X48 A;  2VQE E;  3DJW A;  2UUB E;  2EPP A;  4P7D A;  1B69 A;  1YYW A;  2V87 A;  4HEI A;  2YPN A;  4GEQ B;  4DKK A;  4RH8 A;  4DMI A;  5KL2 A;  5KL4 A;  4IS1 C;  5FLX C;  2EPC A;  1PJS A;  1FJG E;  2UUA E;  1IQO A;  2FV4 B;  2EOX A;  2BBG A;  1TF6 A;  2YRH A;  1A1G A;  4LF4 E;  1QU6 A;  3HXL A;  3DF6 A;  4FK5 C;  4DR4 E;  2EMW A;  3BID A;  4M30 A;  4ZYH A;  2DMI A;  4NZV A;  5IXM B;  4WXC A;  2YTO A;  1STU A;  4L5N C;  4O24 A;  4ZYG A;  1A1J A;  2RQL A;  1LLM C;  1KJK A;  2JVA A;  3JU0 A;  2YRM A;  2EMK A;  4X66 E;  2LVH A;  3IWD A;  2GPI A;  2MDR A;  1UBD C;  2YT4 A;  2EN8 A;  4L8N A;  2EPU A;  4J8Z A;  4ZYD A;  2HC5 A;  5BR8 E;  2UUC E;  2UU9 E;  4R2P A;  1AAY A;  2EMA A;  3L00 A;  4WPY A;  3ADJ A;  4TUG A;  4DR5 E;  4F2J C;  3BGH A;  1YZ9 A;  2I9I A;  1X3C A;  2JP9 A;  1A1K A;  2L2M A;  4DV1 E;  3EQ1 A;  3J7Y p;  2WBT A;  3JTZ A;  2M9A A;  4LTY A;  1MEY C;  1T4L B;  2N3G A;  5IT9 C;  2JY9 A;  4DV6 E;  4GKK E;  2EPX A;  2DB2 A;  1ZAA C;  4LF8 E;  2LJH A;  3RMP A;  1WHN A;  2YTF A;  2DMY A;  1ZR9 A;  2EM0 A;  5IV8 B;  4O43 A;  2DLQ A;  5T6J A;  4JI0 E;  5A6B A;  3VK6 A;  1DGC A;  1G2D C;  1PJT A;  2NA2 A;  1YUI A;  2EM7 A;  1I94 E;  4KZS A;  4WFT A;  1N32 E;  4LFA E;  4NXM E;  4WSP A;  2R76 A;  3VYX A;  2JWO A;  1TN9 A;  4F6M A;  2V86 A;  2YU5 A;  2ENA A;  2EQ1 A;  3VHT B;  2E1M A;  1IBK E;  1RMD A;  2RS6 A;  1RC7 A;  2EM2 A;  1EH6 A;  2L3J A;  2EMB A;  3ADG A;  4WYQ B;  4F9B B;  2WZO A;  4X8W A;  2EQ3 A;  4ZYE A;  5LMU E;  2EOO A;  2EOM A;  2EMH A;  4BC9 A;  1YPN A;  4F6N A;  2RSI A;  2LV2 A;  1IBL E;  1GZ6 A;  5A6K A;  4JI6 E;  2LO3 A;  1NCS A;  4BMJ A;  2EN4 A;  4F9C B;  5LMN E;  1YYK A;  3MHS C;  1X5W A;  5IWA E;  5AC4 A;  3T1Y E;  4R2E A;  4AQY E;  1PJQ A;  5F3W A;  2VF1 A;  2BB8 A;  1UIL A;  2YTG A;  4R2A A;  4BHC A;  4NXN E;  4YHH E;  2ZM6 E;  2LCE A;  2M7Q A;  4GKJ E;  2EMX A;  1UN6 B;  4LF9 E;  2ELZ A;  3JAM C;  1EH7 A;  4JI2 E;  3MHH C;  1YSA C;  1ZBT A;  2JXP A;  2JOB A;  2NUF A;  2GHF A;  3J80 C;  2Q8U A;  4LF7 E;  4JI3 E;  4DV2 E;  3LLH A;  2DGC A;  4BC7 A;  1WJP A;  2J7J A;  1X6H A;  5LLQ A;  1A1L A;  1XNR E;  5KL5 A;  2CTD A;  2E72 A;  1BB8 A;  2MC6 A;  2CSH A;  2EM6 A;  2YTD A;  3H09 A;  1AH5 A;  2ENH A;  1P47 A;  1A1H A;  4JYA E;  2EE8 A;  3EPH A;  2EPK X;  4WX9 A;  2JR1 A;  2YZT A;  2YSO A;  3C6K A;  4R2Q A;  1L4S A;  2V8Q B;  2LRS A;  2L2N A;  2YU8 A;  4DR1 E;  3J81 C;  1IBM E;  3F6G A;  4WSG A;  1HNW E;  2R1F A;  2KOU A;  3EPL A;  4DR3 E;  1PDA A;  2EOI A;  2CPN A;  4N4R B;  1T39 A;  3KZY A;  2EOR A;  4OOG C;  2I13 A;  2NUE A;  2D9H A;  1TF3 A;  3AV0 A;  4WXD A;  4M2Z A;  2N3H A;  4KWY A;  4BHB A;  5AC5 A;  2EM9 A;  2EPA A;  1HR0 E;  5KL6 A;  2GLI A;  2EOE A;  1HNX E;  2KON A;  2EPN A;  1WRJ A;  4YY3 E;  2EWL A;  1X47 A;  4DV4 E;  1X6E A;  4R2R A;  3ADI A;  2EZ6 A;  4MLQ A;  2EMZ A;  3P1X A;  4JI5 E;  3UK3 C;  2UXB E;  1DI2 A;  2LE2 A;  2G7H A;  2K7I A;  4M0V A;  2JPA A;  2EM3 A;  2EPZ A;  1XMQ E;  2YTQ A;  4LU9 A;  5CFF E;  3OTO E;  4DUY E;  4GZN C;  2A25 A;  3BBG A;  2NAB A;  4TUI A;  3MSW A;  2EPL X;  3TQM A;  2EQ0 A;  2MKN A;  4OX9 E;  2EMY A;  4JI7 E;  1BBO A;  2EL5 A;  2L3C A;  1A1F A;  2H36 X;  4HTG A;  2L92 A;  4BS9 A;  3ZOQ B;  2RPC A;  2RS7 A;  2DIX A;  1KYQ A;  2L33 A;  2ENC A;  4K0K E;  3KWR A;  2FTX B;  2V85 A;  2LT7 A;  4F54 A;  3HTX A;  2EOQ A;  2JOX A;  2LJU A;  2EOF A;  3C4B A;  4KHP E;  4B3R E;  1MGT A;  1GQE A;  1XMO E;  3HQ1 A;  1G2F C;  4JI8 E;  2WCC 3;  2EN6 A;  2EN1 A;  2EL4 A;  2VQF E;  2F4V E;  5KL3 A;  5ADZ A;  1XNQ E;  2EM8 A;  4X64 E;  1ZBQ A;  2EP3 A;  2UXD E;  4JI4 E;  2RSM A;  3T1H E;  4I8O A;  2YTJ A;  2YWQ A;  2EPM X;  2EL6 A;  4MLV A;  3IWB A;  1N36 E;  4IJD A;  2EN7 A;  5A69 A;  2E5L E;  2V89 A;  1T4O A;  1N34 E;  5A6J A;  2DLK A;  2HHH E;  4LF5 E;  2DSY A;  4Q35 B;  4BBY A;  4LFC E;  1IQS A;  4DV0 E;  5A2Q C;  3IWC A;  2UXC E;  5AE2 A;  2L6M A;  5A6B D;  2FGG A;  3LML A;  2PRT A;  3ECR A;  4P78 A;  5LL6 R;  3HPZ A;  5A6A A;  1N33 E;  4R03 A;  3VYY A;  2NUG A;  1UHZ A;  4JI1 E;  3C4T A;  4R2C A;  2L2K B;  2LTS A;  2ODR C;  4O5G A;  5AE1 A;  5KL7 A;  5DNY A;  1EH8 A;  2M1S A;  2ADR A;  4R2S A;  2JYA A;  1YFH A;  2HGH A;  1N3G A;  4RHB B;  1WHQ A;  2EN2 A;  3BF2 A;  2EPR A;  2YSP A;  1FKA E;  2YTI A;  2V83 A;  1JK2 A;  3K6Q A;  2LBS B;  1X49 A;  4JV5 E;  2EMI A;  3HPS A;  1Z1B A;  1EKZ A;  2WBU A;  1A1I A;  1HNZ E;  1X6F A;  1RQ0 A;  3QG5 C;  1T4N A;  2ELY A;  4NHR A;  3M99 B;  4R2D A;  1JK1 A;  2EOH A;  4B3T E;  2EM4 A;  1IMU A;  2EMF A;  1DQ3 A;  4F9A B;  4M9V C;  2MC5 A;  3EPK A;  4DR7 E;  2LTR A;  3AUZ A;  4DV3 E;  1O0W A;  2MKD A;  2DRP A;  2HJJ A;  2B3T B;  1J5E E;  2EMC A;  2L8T A;  4X65 E;  4DUZ E;  2EPO A;  2IHR 1;  2N8X A;  2EML A;  4BCA A;  2B9D A;  4DV5 E;  4DR6 E;  1ZU1 A;  4R8O A;  2M4I A;  2LUP B;  3C6M A; 
#chains in the Genus database with same CATH homology
 2MDG A;  2YRK A;  2M9A A;  1MEY C;  2EJ4 A;  1G2F C;  2EM5 A;  2DGC A;  1WJP A;  1YUJ A;  2J7J A;  2WCC 3;  2EN6 A;  1X6H A;  2EL4 A;  2EN1 A;  5KL3 A;  1A1L A;  2EPX A;  1ZAA C;  5KL5 A;  2CTD A;  2E72 A;  2EM8 A;  1BB8 A;  2EP3 A;  2CSH A;  2EM6 A;  1F2I G;  2CT1 A;  2YTD A;  2ENH A;  1P47 A;  1A1H A;  2EOY A;  3EPJ A;  2EE8 A;  2YTF A;  3EPH A;  2YTJ A;  1ZR9 A;  2EM0 A;  2EL6 A;  2YTE A;  2EOS A;  4IJD A;  2EN7 A;  2YSO A;  2DLQ A;  4R2Q A;  2EN3 A;  4X9J A;  1DGC A;  2DLK A;  2EMG A;  2YTN A;  1G2D C;  2YU8 A;  2EOJ A;  1YUI A;  2EM7 A;  2EOZ A;  2YTP A;  4WSG A;  2R1F A;  2VRD A;  2WBS A;  3EPL A;  2EOI A;  1TN9 A;  4F6M A;  2EOR A;  2YU5 A;  2I13 A;  2D9H A;  1TF3 A;  2ENA A;  2EQ1 A;  3VHT B;  2PRT A;  1RMD A;  2EPP A;  1B69 A;  2EM9 A;  2EPA A;  5KL6 A;  2GLI A;  2EM2 A;  2EOE A;  5KL2 A;  5KL4 A;  4IS1 C;  2EMB A;  2EPC A;  4R2C A;  1X6E A;  4R2R A;  2EQ3 A;  5KL7 A;  2EMZ A;  2EOO A;  2EOX A;  2EOM A;  1TF6 A;  2EMH A;  2YRH A;  2ADR A;  4R2S A;  3UK3 C;  4F6N A;  1A1G A;  2HGH A;  2RSI A;  2LV2 A;  4FK5 C;  2EN2 A;  2EMW A;  2EPR A;  2LO3 A;  2JPA A;  1NCS A;  2EM3 A;  2YSP A;  2EPZ A;  2YTI A;  2YTQ A;  1JK2 A;  2EN4 A;  2DMI A;  3MHS C;  1X5W A;  4GZN C;  2A25 A;  2NAB A;  2YTO A;  2EMI A;  1Z1B A;  2WBU A;  1A1I A;  2EQ0 A;  2MKN A;  1X6F A;  1A1J A;  4R2E A;  2EMY A;  2ELY A;  1LLM C;  1KJK A;  3M99 B;  4R2D A;  1JK1 A;  2EOH A;  1BBO A;  2EL5 A;  2EM4 A;  2YRM A;  2EMK A;  1A1F A;  2EMF A;  2LVH A;  2BB8 A;  2YTG A;  2RPC A;  1UBD C;  4R2A A;  4M9V C;  3EPK A;  2ENC A;  2EN8 A;  2MKD A;  2DRP A;  2EPU A;  2LCE A;  2EMC A;  2EMX A;  1UN6 B;  2LT7 A;  4R2P A;  1AAY A;  2ELZ A;  2EML A;  2EMA A;  2EOQ A;  4F2J C;  1ZU1 A;  3MHH C;  2EOF A;  1YSA C;  1X3C A;  2JP9 A;  1A1K A;  2WBT A;  2GHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...