2EOSA

Solution structure of the c2h2 type zinc finger (region 626-654) of human b-cell lymphoma 6 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYPCEICGTRFRHLQTLKSHLRIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 6 protein
publication title Solution structure of the C2H2 type zinc finger (region 626-654) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eosA01
1RMDA 2WBSA 1X5WA 2DGCA 1TN9A 2EN8A 1BBOA 1YSAC 2LV2A 4R2DA 2EE8A 2YRKA 2EORA 3EPLA 2CTDA 1TF6A 2EOXA 2YU8A 2GLIA 1P47A 5KL7A 2WCC3 1YUIA 1LLMC 1UN6B 1X6HA 2EMCA 2DMIA 2EM9A 2EQ0A 2DLKA 2CT1A 1X6FA 2E72A 2EOOA 2EMFA 2EM8A 2EN2A 4F2JC 2EMZA 1A1LA 1MEYC 2ELYA 2EN6A 2EPXA 1G2DC 2ADRA 2EN7A 2EOQA 1BB8A 2YTEA 3EPKA 2EMAA 2EN1A 3MHSC 5KL4A 4R2RA 2EM0A 1DGCA 4FK5C 2EL5A 2YTGA 2NABA 2EOHA 2EPPA 2EM4A 2R1FA 5KL3A 2MDGA 2I13A 2WBUA 2D9HA 1A1FA 1ZAAC 2EQ3A 1YUJA 2LCEA 5KL5A 2EMXA 4X9JA 1WJPA 2ELZA 2EMKA 2LO3A 2YRHA 1JK2A 2A25A 1A1HA 1UBDC 2EN3A 4R2CA 1A1GA 1JK1A 2MKNA 2EPZA 2EL4A 4F6MA 1NCSA 2MKDA 2RSIA 2YRMA 2EM3A 2YTIA 2EOFA 1Z1BA 2DRPA 2EMGA 1X3CA 2EMBA 4F6NA 1A1KA 2EOMA 2YSPA 2EOIA 2LT7A 2YTJA 1TF3A 2EQ1A 2EM7A 2YSOA 4GZNC 2EPUA 2EM5A 2YTPA 2EPAA 2BB8A 2YTDA 1X6EA 2YTQA 2EMHA 3EPJA 5KL6A 2LVHA 2CSHA 2EOYA 4R2PA 1AAYA 2EP3A 2GHFA 4R2EA 2M9AA 3MHHC 2EL6A 2ENAA 2EM6A 1B69A 2EOSA 2J7JA 2EMIA 3EPHA 1F2IG 2EOJA 2DLQA 2YTOA 2EOEA 3UK3C 4IS1C 3VHTB 2PRTA 4WSGA 2JP9A 4M9VC 1ZR9A 2EN4A 2YTNA 3M99B 2EJ4A 2EPRA 2EMYA 2YTFA 1ZU1A 1KJKA 2WBTA 5KL2A 2EMWA 2EPCA 1G2FC 2YU5A 4R2QA 2ENHA 2VRDA 1A1IA 2EM2A 2EOZA 2HGHA 2JPAA 1A1JA 2EMLA 4R2SA 2ENCA 2RPCA 4IJDA 4R2AA
chains in the Genus database with same CATH superfamily
3QG5C 1YYKA 2DGCA 1TN9A 3J81C 2EN8A 1BBOA 3KWRA 1XNRE 2EE8A 1PJQA 2B9DA 3EPLA 2YU8A 2YWQA 1LLMC 2CPNA 4BC9A 4BHBA 3HPSA 2EMCA 2CT1A 2F4VE 1X6FA 2E72A 1IQSA 2EM8A 3DF6A 2EN2A 4WXDA 1GZ6A 2EMZA 4RHBB 2RTXA 5IXMB 2NUEA 5LLQA 4DV7E 3H09A 2LBSB 5T6JA 2EOQA 2VQFE 3LLHA 2VE7C 1DGCA 1WHNA 4DV6E 2E1MA 4O4KA 4GKKE 5KL3A 2EWLA 2YZTA 1ZAAC 2F8BA 2YT4A 1UILA 1MGTA 2HC5A 1PJTA 4X8WA 2ELZA 2EMKA 2EPKX 2LO3A 2YPNA 1X48A 3IWBA 2K7IA 1JK1A 1NCSA 4K0KE 4P7DA 1PJSA 2G7HA 2YTIA 2V87A 2DIXA 2EMGA 2JY9A 1T4LB 4GZNC 5BR8E 2EM5A 2YTPA 3K6QA 4LF4E 1QNTA 2BB8A 2EPAA 2L2KB 5KL6A 2CSHA 2N3GA 2EP3A 1T39A 3MHHC 5AASA 2R76A 3P1XA 2EOJA 4JI1E 2MC5A 2UXDE 3C6KA 4DR4E 4M9VC 2RS7A 1ZR9A 2L2NA 3J7Yp 2YTFA 3DJWA 2NA2A 2MC6A 5KL2A 2UUAE 4R2QA 2EM2A 2EOZA 2HGHA 3TQMA 4DR5E 2KONA 3T1YE 4B3TE 2RPCA 4LF5E 1BBGA 4F54A 4R2AA 1RMDA 2GPIA 5DNYA 3JU0A 4JI3E 1N33E 5ADZA 4R2DA 5A6JA 3LMLA 2EORA 3THOB 4DR7E 2CTDA 2EOXA 1AH5A 1P47A 3ADIA 1UN6B 1X6HA 2HJJA 2IHR1 2L3CA 1FJGE 2JOBA 2DLKA 2EMFA 3MSWA 5F3WA 1I94E 4NHRA 4YHHE 1A1LA 1MEYC 4M2ZA 2ELYA 3KZYA 3IWCA 2EN6A 4N4RB 2YTEA 3EPKA 2Q8UA 1PKPA 2LE2A 2EN1A 1IQOA 2KOUA 2EM0A 1HNWE 3EQ1A 4FK5C 2BBGA 5FLXC 4P78A 4HEIA 2I13A 1A1FA 4BMJA 3F6HA 5A6KA 2EMXA 5KL5A 3OTOE 2M1SA 1FKAE 1JK2A 2A25A 2KHXA 4LFBE 3L00A 3FIGA 1A1GA 2L2MA 2EPZA 4JI2E 3HPZA 4LFCE 2EPNA 4Q35B 2EM3A 4JV5E 4DR1E 2EOFA 1Z1BA 2DRPA 4F6NA 1X3CA 2EOMA 2M7QA 2VF1A 4WX9A 2EOIA 2EQ1A 4OOGC 4BC7A 4KHPE 4ZYDA 2LJUA 2LTSA 1ZBQA 1RQ0A 3ADLA 4R03A 2LVHA 4DUZE 2EPLX 2M9AA 1N36E 2LUQA 1WRJA 4ZYGA 2UU9E 3OMLA 5IV8B 5IT9C 3EPHA 1F2IG 4DKKA 2YTOA 4WYQB 3UK3C 3VHTB 4F9BB 2JOXA 2PRTA 1YYWA 4DV1E 3JAMC 1YYOA 4JI5E 3VK6A 2EPRA 4X65E 3VYXA 2EMYA 1SFEA 3HQ1A 3BBGA 3C4TA 4WPYA 4ZYEA 2EMWA 2EPCA 1J26A 4LF9E 2ENHA 2N8XA 5A6BA 1XMOE 1T4OA 5LL6R 2MDRA 2H36X 4TUGA 4LF8E 4IJDA 2L6MA 4O43A 5TSEA 2WBSA 1X5WA 1YSAC 1KYQA 1IBME 4DV5E 1QU6A 2GLIA 4BBYA 4L8NA 4NXME 3AV0A 1IBKE 3BIDA 2I9IA 2DMYA 2V88A 2EQ0A 2EOOA 3ADJA 1IMUA 2EPXA 4I8OA 2ADRA 2EN7A 4YY3E 1BB8A 2FGGA 1T38A 4LF7E 1YFHA 2V8QB 1WHQA 3MHSC 5KL4A 4R2RA 2EL5A 2LUPB 2YTGA 2EOHA 2EPPA 2L8TA 2WBUA 5LMNE 4M30A 5A2QC 2M4IA 1ZBTA 4R8OA 4GKJE 1A1HA 2ODRD 2RSMA 2E5LE 2MKNA 4ZYHA 2EL4A 4F6MA 2V85A 2RSIA 2YRMA 2LMZA 1RC7A 4HTGA 3ECRA 4DV0E 4B3RE 4NXNE 2YSPA 4O24A 2LT7A 2YTJA 4JI4E 2EM7A 2YSOA 1PDAA 1O0WA 2UUBE 5CFFE 2YTDA 4JI7E 4DR3E 3EPJA 3VYYA 1DQ3A 1UHZA 2LJHA 2EOYA 1IBLE 1AAYA 1L4SA 2V89A 4R2EA 2JWOA 2RQLA 2EL6A 2ENAA 2WZOA 5AE3A 1B69A 2EOSA 2JXPA 4IS1C 2EOEA 1EH7A 2JP9A 4JYAE 2LTRA 3M99B 4WSPA 2UXCE 1ZU1A 4DV3E 5A69A 2YU5A 2EPOA 5AE2A 1A1IA 3C4BA 4MLQA 5A6AA 2JPAA 1A1JA 2EMLA 4X64E 4F9AB 1N3GA 1T4NA 4LF6E 4DMIA 2L92A 3T1HE 2LV2A 5LMUE 2YRKA 2UXBE 3ADGA 4KWYA 1TF6A 5KL7A 3RMPA 2WCC3 1YUIA 4TUIA 3BGHA 5AC4A 3IWDA 4GEQB 1EKZA 2DMIA 2EM9A 2UUCE 1EH6A 4WXCA 2V83A 1X49A 4J8ZA 3BF2A 4F2JC 2L33A 4B3ME 1X47A 3F6GA 1HR0E 1G2DC 1STUA 2HHHE 3JTZA 2B3TB 2EMAA 2FV4B 1NEIA 2B7VA 2K4VA 2ZM6E 3AUZA 2NABA 4KZSA 4RH8A 1SR9A 4O5GA 2EM4A 2R1FA 5A6BD 2MDGA 3HXLA 2D9HA 1XNQE 1WXRA 3ZOQB 4LFAE 2EQ3A 3J7AG 2FTXB 2LCEA 1YUJA 4X9JA 5AE1A 2JYAA 3HTXA 1WJPA 4F9CB 1HNXE 2YRHA 1UBDC 2VQEE 2EN3A 4R2CA 2ODRC 1J5EE 4M0VA 4DV4E 2B7TA 4JI8E 2MKDA 2JVAA 4AQYE 2L3JA 2EPMX 5AC5A 1A1KA 2EMBA 4JI0E 4LTYA 1TF3A 3C6MA 4Q28A 2NUFA 2EPUA 1N34E 4DV2E 1X6EA 2YTQA 2EMHA 1GQEA 2DSYA 1YPNA 2JR1A 2DB2A 4X66E 4NZVA 4R2PA 1EH8A 2N3HA 4LU9A 4BHCA 2GHFA 5IWAE 4BCAA 1N32E 2EM6A 2J7JA 2EMIA 2DLQA 2EZ6A 1XMQE 4WFTA 3THNA 4WSGA 1GTKA 2NUGA 4X62E 1DI2A 1HNZE 4B3SE 2EN4A 2YTNA 2V86A 2EJ4A 4JI6E 1KJKA 1YZ9A 4DR2E 2WBTA 4L5NC 4MLVA 3J80C 1G2FC 4BS9A 4DR6E 2LRSA 2VRDA 3KZZA 4DUYE 4OX9E 4R2SA 2ENCA 2RS6A
chains in the Genus database with same CATH topology
1RMDA 2WBSA 1X5WA 2DGCA 1TN9A 2EN8A 1BBOA 1YSAC 2LV2A 4R2DA 2EE8A 2YRKA 2EORA 3EPLA 2CTDA 1TF6A 2EOXA 2YU8A 2GLIA 1P47A 5KL7A 2WCC3 1YUIA 1LLMC 1UN6B 1X6HA 2EMCA 2DMIA 2EM9A 2EQ0A 2DLKA 2CT1A 1X6FA 2E72A 2EOOA 2EMFA 2EM8A 2EN2A 4F2JC 2EMZA 1A1LA 1MEYC 2ELYA 2EN6A 2EPXA 1G2DC 2ADRA 2EN7A 2EOQA 1BB8A 2YTEA 3EPKA 2EMAA 2EN1A 3MHSC 5KL4A 4R2RA 2EM0A 1DGCA 4FK5C 2EL5A 2YTGA 2NABA 2EOHA 2EPPA 2EM4A 2R1FA 5KL3A 2MDGA 2I13A 2WBUA 2D9HA 1A1FA 1ZAAC 2EQ3A 1YUJA 2LCEA 5KL5A 2EMXA 4X9JA 1WJPA 2ELZA 2EMKA 2LO3A 2YRHA 1JK2A 2A25A 1A1HA 1UBDC 2EN3A 4R2CA 1A1GA 1JK1A 2MKNA 2EPZA 2EL4A 4F6MA 1NCSA 2MKDA 2RSIA 2YRMA 2EM3A 2YTIA 2EOFA 1Z1BA 2DRPA 2EMGA 1X3CA 2EMBA 4F6NA 1A1KA 2EOMA 2YSPA 2EOIA 2LT7A 2YTJA 1TF3A 2EQ1A 2EM7A 2YSOA 4GZNC 2EPUA 2EM5A 2YTPA 2EPAA 2BB8A 2YTDA 1X6EA 2YTQA 2EMHA 3EPJA 5KL6A 2LVHA 2CSHA 2EOYA 4R2PA 1AAYA 2EP3A 2GHFA 4R2EA 2M9AA 3MHHC 2EL6A 2ENAA 2EM6A 1B69A 2EOSA 2J7JA 2EMIA 3EPHA 1F2IG 2EOJA 2DLQA 2YTOA 2EOEA 3UK3C 4IS1C 3VHTB 2PRTA 4WSGA 2JP9A 4M9VC 1ZR9A 2EN4A 2YTNA 3M99B 2EJ4A 2EPRA 2EMYA 2YTFA 1ZU1A 1KJKA 2WBTA 5KL2A 2EMWA 2EPCA 1G2FC 2YU5A 4R2QA 2ENHA 2VRDA 1A1IA 2EM2A 2EOZA 2HGHA 2JPAA 1A1JA 2EMLA 4R2SA 2ENCA 2RPCA 4IJDA 4R2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  2WBS A;  1X5W A;  2DGC A;  1TN9 A;  2EN8 A;  1BBO A;  1YSA C;  2LV2 A;  4R2D A;  2EE8 A;  2YRK A;  2EOR A;  3EPL A;  2CTD A;  1TF6 A;  2EOX A;  2YU8 A;  2GLI A;  1P47 A;  5KL7 A;  2WCC 3;  1YUI A;  1LLM C;  1UN6 B;  1X6H A;  2EMC A;  2DMI A;  2EM9 A;  2EQ0 A;  2DLK A;  2CT1 A;  1X6F A;  2E72 A;  2EOO A;  2EMF A;  2EM8 A;  2EN2 A;  4F2J C;  2EMZ A;  1A1L A;  1MEY C;  2ELY A;  2EN6 A;  2EPX A;  1G2D C;  2ADR A;  2EN7 A;  2EOQ A;  1BB8 A;  2YTE A;  3EPK A;  2EMA A;  2EN1 A;  3MHS C;  5KL4 A;  4R2R A;  2EM0 A;  1DGC A;  4FK5 C;  2EL5 A;  2YTG A;  2NAB A;  2EOH A;  2EPP A;  2EM4 A;  2R1F A;  5KL3 A;  2MDG A;  2I13 A;  2WBU A;  2D9H A;  1A1F A;  1ZAA C;  2EQ3 A;  1YUJ A;  2LCE A;  5KL5 A;  2EMX A;  4X9J A;  1WJP A;  2ELZ A;  2EMK A;  2LO3 A;  2YRH A;  1JK2 A;  2A25 A;  1A1H A;  1UBD C;  2EN3 A;  4R2C A;  1A1G A;  1JK1 A;  2MKN A;  2EPZ A;  2EL4 A;  4F6M A;  1NCS A;  2MKD A;  2RSI A;  2YRM A;  2EM3 A;  2YTI A;  2EOF A;  1Z1B A;  2DRP A;  2EMG A;  1X3C A;  2EMB A;  4F6N A;  1A1K A;  2EOM A;  2YSP A;  2EOI A;  2LT7 A;  2YTJ A;  1TF3 A;  2EQ1 A;  2EM7 A;  2YSO A;  4GZN C;  2EPU A;  2EM5 A;  2YTP A;  2EPA A;  2BB8 A;  2YTD A;  1X6E A;  2YTQ A;  2EMH A;  3EPJ A;  5KL6 A;  2LVH A;  2CSH A;  2EOY A;  4R2P A;  1AAY A;  2EP3 A;  2GHF A;  4R2E A;  2M9A A;  3MHH C;  2EL6 A;  2ENA A;  2EM6 A;  1B69 A;  2EOS A;  2J7J A;  2EMI A;  3EPH A;  1F2I G;  2EOJ A;  2DLQ A;  2YTO A;  2EOE A;  3UK3 C;  4IS1 C;  3VHT B;  2PRT A;  4WSG A;  2JP9 A;  4M9V C;  1ZR9 A;  2EN4 A;  2YTN A;  3M99 B;  2EJ4 A;  2EPR A;  2EMY A;  2YTF A;  1ZU1 A;  1KJK A;  2WBT A;  5KL2 A;  2EMW A;  2EPC A;  1G2F C;  2YU5 A;  4R2Q A;  2ENH A;  2VRD A;  1A1I A;  2EM2 A;  2EOZ A;  2HGH A;  2JPA A;  1A1J A;  2EML A;  4R2S A;  2ENC A;  2RPC A;  4IJD A;  4R2A A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  1YYK A;  2DGC A;  1TN9 A;  3J81 C;  2EN8 A;  1BBO A;  3KWR A;  1XNR E;  2EE8 A;  1PJQ A;  2B9D A;  3EPL A;  2YU8 A;  2YWQ A;  1LLM C;  2CPN A;  4BC9 A;  4BHB A;  3HPS A;  2EMC A;  2CT1 A;  2F4V E;  1X6F A;  2E72 A;  1IQS A;  2EM8 A;  3DF6 A;  2EN2 A;  4WXD A;  1GZ6 A;  2EMZ A;  4RHB B;  2RTX A;  5IXM B;  2NUE A;  5LLQ A;  4DV7 E;  3H09 A;  2LBS B;  5T6J A;  2EOQ A;  2VQF E;  3LLH A;  2VE7 C;  1DGC A;  1WHN A;  4DV6 E;  2E1M A;  4O4K A;  4GKK E;  5KL3 A;  2EWL A;  2YZT A;  1ZAA C;  2F8B A;  2YT4 A;  1UIL A;  1MGT A;  2HC5 A;  1PJT A;  4X8W A;  2ELZ A;  2EMK A;  2EPK X;  2LO3 A;  2YPN A;  1X48 A;  3IWB A;  2K7I A;  1JK1 A;  1NCS A;  4K0K E;  4P7D A;  1PJS A;  2G7H A;  2YTI A;  2V87 A;  2DIX A;  2EMG A;  2JY9 A;  1T4L B;  4GZN C;  5BR8 E;  2EM5 A;  2YTP A;  3K6Q A;  4LF4 E;  1QNT A;  2BB8 A;  2EPA A;  2L2K B;  5KL6 A;  2CSH A;  2N3G A;  2EP3 A;  1T39 A;  3MHH C;  5AAS A;  2R76 A;  3P1X A;  2EOJ A;  4JI1 E;  2MC5 A;  2UXD E;  3C6K A;  4DR4 E;  4M9V C;  2RS7 A;  1ZR9 A;  2L2N A;  3J7Y p;  2YTF A;  3DJW A;  2NA2 A;  2MC6 A;  5KL2 A;  2UUA E;  4R2Q A;  2EM2 A;  2EOZ A;  2HGH A;  3TQM A;  4DR5 E;  2KON A;  3T1Y E;  4B3T E;  2RPC A;  4LF5 E;  1BBG A;  4F54 A;  4R2A A;  1RMD A;  2GPI A;  5DNY A;  3JU0 A;  4JI3 E;  1N33 E;  5ADZ A;  4R2D A;  5A6J A;  3LML A;  2EOR A;  3THO B;  4DR7 E;  2CTD A;  2EOX A;  1AH5 A;  1P47 A;  3ADI A;  1UN6 B;  1X6H A;  2HJJ A;  2IHR 1;  2L3C A;  1FJG E;  2JOB A;  2DLK A;  2EMF A;  3MSW A;  5F3W A;  1I94 E;  4NHR A;  4YHH E;  1A1L A;  1MEY C;  4M2Z A;  2ELY A;  3KZY A;  3IWC A;  2EN6 A;  4N4R B;  2YTE A;  3EPK A;  2Q8U A;  1PKP A;  2LE2 A;  2EN1 A;  1IQO A;  2KOU A;  2EM0 A;  1HNW E;  3EQ1 A;  4FK5 C;  2BBG A;  5FLX C;  4P78 A;  4HEI A;  2I13 A;  1A1F A;  4BMJ A;  3F6H A;  5A6K A;  2EMX A;  5KL5 A;  3OTO E;  2M1S A;  1FKA E;  1JK2 A;  2A25 A;  2KHX A;  4LFB E;  3L00 A;  3FIG A;  1A1G A;  2L2M A;  2EPZ A;  4JI2 E;  3HPZ A;  4LFC E;  2EPN A;  4Q35 B;  2EM3 A;  4JV5 E;  4DR1 E;  2EOF A;  1Z1B A;  2DRP A;  4F6N A;  1X3C A;  2EOM A;  2M7Q A;  2VF1 A;  4WX9 A;  2EOI A;  2EQ1 A;  4OOG C;  4BC7 A;  4KHP E;  4ZYD A;  2LJU A;  2LTS A;  1ZBQ A;  1RQ0 A;  3ADL A;  4R03 A;  2LVH A;  4DUZ E;  2EPL X;  2M9A A;  1N36 E;  2LUQ A;  1WRJ A;  4ZYG A;  2UU9 E;  3OML A;  5IV8 B;  5IT9 C;  3EPH A;  1F2I G;  4DKK A;  2YTO A;  4WYQ B;  3UK3 C;  3VHT B;  4F9B B;  2JOX A;  2PRT A;  1YYW A;  4DV1 E;  3JAM C;  1YYO A;  4JI5 E;  3VK6 A;  2EPR A;  4X65 E;  3VYX A;  2EMY A;  1SFE A;  3HQ1 A;  3BBG A;  3C4T A;  4WPY A;  4ZYE A;  2EMW A;  2EPC A;  1J26 A;  4LF9 E;  2ENH A;  2N8X A;  5A6B A;  1XMO E;  1T4O A;  5LL6 R;  2MDR A;  2H36 X;  4TUG A;  4LF8 E;  4IJD A;  2L6M A;  4O43 A;  5TSE A;  2WBS A;  1X5W A;  1YSA C;  1KYQ A;  1IBM E;  4DV5 E;  1QU6 A;  2GLI A;  4BBY A;  4L8N A;  4NXM E;  3AV0 A;  1IBK E;  3BID A;  2I9I A;  2DMY A;  2V88 A;  2EQ0 A;  2EOO A;  3ADJ A;  1IMU A;  2EPX A;  4I8O A;  2ADR A;  2EN7 A;  4YY3 E;  1BB8 A;  2FGG A;  1T38 A;  4LF7 E;  1YFH A;  2V8Q B;  1WHQ A;  3MHS C;  5KL4 A;  4R2R A;  2EL5 A;  2LUP B;  2YTG A;  2EOH A;  2EPP A;  2L8T A;  2WBU A;  5LMN E;  4M30 A;  5A2Q C;  2M4I A;  1ZBT A;  4R8O A;  4GKJ E;  1A1H A;  2ODR D;  2RSM A;  2E5L E;  2MKN A;  4ZYH A;  2EL4 A;  4F6M A;  2V85 A;  2RSI A;  2YRM A;  2LMZ A;  1RC7 A;  4HTG A;  3ECR A;  4DV0 E;  4B3R E;  4NXN E;  2YSP A;  4O24 A;  2LT7 A;  2YTJ A;  4JI4 E;  2EM7 A;  2YSO A;  1PDA A;  1O0W A;  2UUB E;  5CFF E;  2YTD A;  4JI7 E;  4DR3 E;  3EPJ A;  3VYY A;  1DQ3 A;  1UHZ A;  2LJH A;  2EOY A;  1IBL E;  1AAY A;  1L4S A;  2V89 A;  4R2E A;  2JWO A;  2RQL A;  2EL6 A;  2ENA A;  2WZO A;  5AE3 A;  1B69 A;  2EOS A;  2JXP A;  4IS1 C;  2EOE A;  1EH7 A;  2JP9 A;  4JYA E;  2LTR A;  3M99 B;  4WSP A;  2UXC E;  1ZU1 A;  4DV3 E;  5A69 A;  2YU5 A;  2EPO A;  5AE2 A;  1A1I A;  3C4B A;  4MLQ A;  5A6A A;  2JPA A;  1A1J A;  2EML A;  4X64 E;  4F9A B;  1N3G A;  1T4N A;  4LF6 E;  4DMI A;  2L92 A;  3T1H E;  2LV2 A;  5LMU E;  2YRK A;  2UXB E;  3ADG A;  4KWY A;  1TF6 A;  5KL7 A;  3RMP A;  2WCC 3;  1YUI A;  4TUI A;  3BGH A;  5AC4 A;  3IWD A;  4GEQ B;  1EKZ A;  2DMI A;  2EM9 A;  2UUC E;  1EH6 A;  4WXC A;  2V83 A;  1X49 A;  4J8Z A;  3BF2 A;  4F2J C;  2L33 A;  4B3M E;  1X47 A;  3F6G A;  1HR0 E;  1G2D C;  1STU A;  2HHH E;  3JTZ A;  2B3T B;  2EMA A;  2FV4 B;  1NEI A;  2B7V A;  2K4V A;  2ZM6 E;  3AUZ A;  2NAB A;  4KZS A;  4RH8 A;  1SR9 A;  4O5G A;  2EM4 A;  2R1F A;  5A6B D;  2MDG A;  3HXL A;  2D9H A;  1XNQ E;  1WXR A;  3ZOQ B;  4LFA E;  2EQ3 A;  3J7A G;  2FTX B;  2LCE A;  1YUJ A;  4X9J A;  5AE1 A;  2JYA A;  3HTX A;  1WJP A;  4F9C B;  1HNX E;  2YRH A;  1UBD C;  2VQE E;  2EN3 A;  4R2C A;  2ODR C;  1J5E E;  4M0V A;  4DV4 E;  2B7T A;  4JI8 E;  2MKD A;  2JVA A;  4AQY E;  2L3J A;  2EPM X;  5AC5 A;  1A1K A;  2EMB A;  4JI0 E;  4LTY A;  1TF3 A;  3C6M A;  4Q28 A;  2NUF A;  2EPU A;  1N34 E;  4DV2 E;  1X6E A;  2YTQ A;  2EMH A;  1GQE A;  2DSY A;  1YPN A;  2JR1 A;  2DB2 A;  4X66 E;  4NZV A;  4R2P A;  1EH8 A;  2N3H A;  4LU9 A;  4BHC A;  2GHF A;  5IWA E;  4BCA A;  1N32 E;  2EM6 A;  2J7J A;  2EMI A;  2DLQ A;  2EZ6 A;  1XMQ E;  4WFT A;  3THN A;  4WSG A;  1GTK A;  2NUG A;  4X62 E;  1DI2 A;  1HNZ E;  4B3S E;  2EN4 A;  2YTN A;  2V86 A;  2EJ4 A;  4JI6 E;  1KJK A;  1YZ9 A;  4DR2 E;  2WBT A;  4L5N C;  4MLV A;  3J80 C;  1G2F C;  4BS9 A;  4DR6 E;  2LRS A;  2VRD A;  3KZZ A;  4DUY E;  4OX9 E;  4R2S A;  2ENC A;  2RS6 A; 
#chains in the Genus database with same CATH homology
 1RMD A;  2WBS A;  1X5W A;  2DGC A;  1TN9 A;  2EN8 A;  1BBO A;  1YSA C;  2LV2 A;  4R2D A;  2EE8 A;  2YRK A;  2EOR A;  3EPL A;  2CTD A;  1TF6 A;  2EOX A;  2YU8 A;  2GLI A;  1P47 A;  5KL7 A;  2WCC 3;  1YUI A;  1LLM C;  1UN6 B;  1X6H A;  2EMC A;  2DMI A;  2EM9 A;  2EQ0 A;  2DLK A;  2CT1 A;  1X6F A;  2E72 A;  2EOO A;  2EMF A;  2EM8 A;  2EN2 A;  4F2J C;  2EMZ A;  1A1L A;  1MEY C;  2ELY A;  2EN6 A;  2EPX A;  1G2D C;  2ADR A;  2EN7 A;  2EOQ A;  1BB8 A;  2YTE A;  3EPK A;  2EMA A;  2EN1 A;  3MHS C;  5KL4 A;  4R2R A;  2EM0 A;  1DGC A;  4FK5 C;  2EL5 A;  2YTG A;  2NAB A;  2EOH A;  2EPP A;  2EM4 A;  2R1F A;  5KL3 A;  2MDG A;  2I13 A;  2WBU A;  2D9H A;  1A1F A;  1ZAA C;  2EQ3 A;  1YUJ A;  2LCE A;  5KL5 A;  2EMX A;  4X9J A;  1WJP A;  2ELZ A;  2EMK A;  2LO3 A;  2YRH A;  1JK2 A;  2A25 A;  1A1H A;  1UBD C;  2EN3 A;  4R2C A;  1A1G A;  1JK1 A;  2MKN A;  2EPZ A;  2EL4 A;  4F6M A;  1NCS A;  2MKD A;  2RSI A;  2YRM A;  2EM3 A;  2YTI A;  2EOF A;  1Z1B A;  2DRP A;  2EMG A;  1X3C A;  2EMB A;  4F6N A;  1A1K A;  2EOM A;  2YSP A;  2EOI A;  2LT7 A;  2YTJ A;  1TF3 A;  2EQ1 A;  2EM7 A;  2YSO A;  4GZN C;  2EPU A;  2EM5 A;  2YTP A;  2EPA A;  2BB8 A;  2YTD A;  1X6E A;  2YTQ A;  2EMH A;  3EPJ A;  5KL6 A;  2LVH A;  2CSH A;  2EOY A;  4R2P A;  1AAY A;  2EP3 A;  2GHF A;  4R2E A;  2M9A A;  3MHH C;  2EL6 A;  2ENA A;  2EM6 A;  1B69 A;  2EOS A;  2J7J A;  2EMI A;  3EPH A;  1F2I G;  2EOJ A;  2DLQ A;  2YTO A;  2EOE A;  3UK3 C;  4IS1 C;  3VHT B;  2PRT A;  4WSG A;  2JP9 A;  4M9V C;  1ZR9 A;  2EN4 A;  2YTN A;  3M99 B;  2EJ4 A;  2EPR A;  2EMY A;  2YTF A;  1ZU1 A;  1KJK A;  2WBT A;  5KL2 A;  2EMW A;  2EPC A;  1G2F C;  2YU5 A;  4R2Q A;  2ENH A;  2VRD A;  1A1I A;  2EM2 A;  2EOZ A;  2HGH A;  2JPA A;  1A1J A;  2EML A;  4R2S A;  2ENC A;  2RPC A;  4IJD A;  4R2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...