2EOSA

Solution structure of the c2h2 type zinc finger (region 626-654) of human b-cell lymphoma 6 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYPCEICGTRFRHLQTLKSHLRIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 626-654) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords B-cell lymphoma 6 protein
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eosA01
4R2DA 1NCSA 4R2PA 2EPUA 2EOIA 5KL7A 4FK5C 1RMDA 2EM6A 2EOYA 3EPLA 3MHHC 4M9VC 2EN4A 2EOXA 2LCEA 2PRTA 2GLIA 2ENAA 2JPAA 2ELYA 1A1HA 2YSPA 2EMYA 2RSIA 2EM8A 2YTNA 2YTPA 2EMKA 2YTEA 2EMBA 2YTIA 2DRPA 2EN7A 2YTGA 1YUIA 2DLQA 1P47A 2EMLA 2WCC3 2J7JA 2LV2A 2YSOA 5KL5A 3EPHA 2EOZA 2R1FA 4F6NA 1AAYA 1WJPA 2CSHA 2EMHA 1A1IA 1TN9A 1JK2A 2WBTA 4IS1C 2EM0A 1A1LA 2EM5A 2YTJA 2EPZA 2EM2A 2EQ3A 2ADRA 2LT7A 1UBDC 1JK1A 2ENCA 2EMIA 1Z1BA 2EN1A 1TF3A 1ZR9A 2EPCA 2GHFA 2HGHA 1YSAC 1LLMC 2EMXA 2EMGA 2WBSA 1A1GA 2EL5A 1X6FA 2EORA 2EM7A 2WBUA 2JP9A 2YTFA 2EOMA 2EOJA 2YU8A 2EPRA 1BB8A 2ELZA 2EJ4A 2CTDA 2EMAA 2A25A 1F2IG 2MKNA 2EPPA 1A1KA 2YTDA 2EN2A 2EOHA 2EM3A 3EPKA 5KL2A 2EM9A 2E72A 2LO3A 2DGCA 1G2FC 2EOEA 2MKDA 2EQ0A 1MEYC 1UN6B 1X6HA 2YRKA 2EN3A 2MDGA 5KL3A 1A1JA 2YTQA 3M99B 5KL4A 3UK3C 2DMIA 1ZU1A 4F6MA 2YU5A 2VRDA 1KJKA 2EE8A 1TF6A 1G2DC 2EN8A 2RPCA 2CT1A 2EOQA 2EL4A 3MHSC 2YRMA 4IJDA 2I13A 1BBOA 2EL6A 2YTOA 4R2AA 2D9HA 2NABA 2EMWA 4R2CA 1B69A 4R2SA 1DGCA 2ENHA 2M9AA 1A1FA 1X6EA 2LVHA 2EP3A 2EMCA 5KL6A 2EOFA 4F2JC 1X3CA 1X5WA 2EMFA 3VHTB 2EOSA 4R2EA 4X9JA 4GZNC 2EPAA 1YUJA 4WSGA 2EMZA 2EQ1A 4R2QA 2YRHA 4R2RA 2DLKA 1ZAAC 2EOOA 2EM4A 3EPJA 2EPXA 2BB8A 2EN6A
chains in the Genus database with same CATH superfamily
3THNA 1NCSA 4DR1E 2LJUA 4M9VC 4NHRA 2GLIA 2JPAA 1A1HA 2YWQA 4DR6E 2YTNA 3JU0A 3BIDA 2EMKA 3EQ1A 1N36E 2EMBA 4WXCA 2YTIA 3DJWA 1YUIA 3ADIA 2DLQA 4DKKA 4WPYA 1DQ3A 2YSOA 1EH8A 1QNTA 1AAYA 4B3TE 1HNXE 1JK2A 4B3RE 2EPZA 1GQEA 1XMOE 4RHBB 3KZYA 2B7TA 3VYYA 4N4RB 3ADLA 2EMIA 3AV0A 4X62E 2UXDE 2EPCA 4DV0E 2GHFA 1T38A 1I94E 4DV7E 2EMGA 3DF6A 2EL5A 3VK6A 2JP9A 3HPSA 2YTFA 1HNWE 2EOMA 2R76A 2EOJA 3BGHA 2LUQA 2CPNA 2LMZA 1HR0E 2A25A 2LRSA 1GTKA 2E5LE 1EH6A 1ZBQA 2EN2A 1IBME 4MLQA 2EPKX 5AC5A 1G2FC 2MKDA 1YYWA 5T6JA 3QG5C 2EN3A 3JAMC 5KL3A 3J81C 3M99B 1IBKE 2V86A 4F6MA 1PDAA 4BMJA 1J5EE 1WXRA 3BF2A 2KOUA 2EN8A 3BBGA 2LTSA 4X64E 3ADJA 1PKPA 2FV4B 2EOQA 2I13A 1BBOA 1EH7A 3LMLA 1YPNA 2UUCE 3OMLA 1DGCA 4R2SA 2LJHA 2NUGA 2MC6A 1X6EA 5A6AA 4GKJE 5AE3A 1PJQA 3C6KA 5KL6A 4LF8E 2EOFA 4F2JC 1DI2A 3HQ1A 1X5WA 3VHTB 4X9JA 4DV5E 4GZNC 4DR2E 4HEIA 2M4IA 4BHBA 4P78A 2JWOA 2MC5A 5FLXC 2DLKA 2EOOA 1PJSA 2EPXA 1IBLE 2EN6A 5A6BA 1NEIA 2L3CA 4R2DA 4JI8E 4X66E 1AH5A 5LL6R 4JI7E 2K7IA 2FTXB 2EOXA 2LCEA 2K4VA 2ENAA 2ELYA 4K0KE 2YSPA 3P1XA 1ZBTA 2DMYA 2KONA 2EN7A 5DNYA 2YTGA 4LF4E 4NXME 1P47A 2EMLA 2J7JA 5A69A 5KL5A 4F9BB 1WJPA 2EMHA 2NA2A 4TUIA 4OX9E 1TN9A 1L4SA 4BCAA 1A1LA 4GKKE 2LBSB 1XMQE 2EQ3A 2ADRA 4X65E 2LT7A 2UXBE 4J8ZA 2EPNA 2V89A 2RS7A 1JK1A 4JI3E 4LF5E 4F9AB 1Z1BA 2EN1A 3C4TA 1ZR9A 1MGTA 2MDRA 4BC7A 2HGHA 1YYKA 2VF1A 2B3TB 2G7HA 1T39A 1N3GA 2I9IA 1X6FA 2WBUA 5LLQA 3MSWA 1BB8A 4YY3E 5IWAE 2L6MA 2ODRD 1RQ0A 1IQSA 4ZYHA 1SFEA 4JI1E 3EPKA 2E72A 1T4LB 4BBYA 2EOEA 2EQ0A 1MEYC 1X6HA 2RTXA 2YRKA 2UU9E 5LMUE 5F3WA 4GEQB 5KL4A 3UK3C 2DMIA 2EE8A 4KWYA 4DR4E 1G2DC 1T4OA 2YT4A 1X47A 4X8WA 3J7AG 3IWCA 2GPIA 3RMPA 2V85A 3KWRA 2F8BA 2D9HA 2NABA 4R2CA 5AE1A 4Q35B 2KHXA 2M9AA 1XNRE 5AE2A 2ODRC 3OTOE 1X3CA 2EMFA 4WSGA 1WHNA 2UUAE 2YRHA 2NUFA 1X48A 4L8NA 2F4VE 3EPJA 2VQFE 2BB8A 3J80C 1WRJA 2V83A 2LTRA 3HTXA 3J7Yp 4R2PA 3C6MA 2EOIA 4LFCE 2EOYA 1X49A 3MHHC 2L92A 4MLVA 2EN4A 2PRTA 4F9CB 1QU6A 2EM8A 4WFTA 2YTPA 2DRPA 2RQLA 2RS6A 5TSEA 2JYAA 3JTZA 4L5NC 4DV4E 1PJTA 2EWLA 2LV2A 4O4KA 2R1FA 1FKAE 1GZ6A 2RSMA 4IS1C 1UHZA 2JXPA 2EM5A 2YTJA 4JI0E 2M7QA 2V88A 4BHCA 4M0VA 1HNZE 2LUPB 5AC4A 2DB2A 2ENCA 3IWDA 1TF3A 2ZM6E 2UXCE 1EKZA 2EPOA 1KYQA 2L33A 1YFHA 4WSPA 2EM7A 2JR1A 2UUBE 4M30A 4LTYA 2N8XA 3FIGA 2EPRA 2L2NA 4KHPE 2EJ4A 2E1MA 1T4NA 2EZ6A 4LFBE 2DSYA 1IQOA 3F6GA 1O0WA 2JOBA 1F2IG 2MKNA 2HJJA 2EPPA 5A6JA 2YTDA 2EM3A 5KL2A 4DV2E 5IXMB 1J26A 4DMIA 2DGCA 2WZOA 4JYAE 2DIXA 1A1JA 4DUYE 2YTQA 1ZU1A 2YU5A 2VRDA 1KJKA 2N3GA 3LLHA 4IJDA 4WXDA 1N33E 4AQYE 2LE2A 4ZYGA 2ENHA 1N32E 2L2KB 2LVHA 2N3HA 3THOB 3F6HA 2V87A 4JI6E 4M2ZA 2YPNA 2EPAA 5BR8E 1YUJA 2EMZA 2JOXA 2B7VA 2EPMX 4O5GA 3C4BA 5ADZA 4R2RA 1ZAAC 2IHR1 4KZSA 4LFAE 1IMUA 4R8OA 4NXNE 4JI5E 1SR9A 2EPUA 5KL7A 3AUZA 4FK5C 1RMDA 2EM6A 4NZVA 1BBGA 3EPLA 4JV5E 4LF7E 1YZ9A 2EMYA 2RSIA 2YTEA 4RH8A 3H09A 2M1SA 3ECRA 4I8OA 2WCC3 3HXLA 5LMNE 3EPHA 2EOZA 4F6NA 2CSHA 4DR5E 1A1IA 3T1HE 4TUGA 2WBTA 4LF6E 2Q8UA 2EM0A 4P7DA 1YYOA 3ADGA 2EM2A 2HHHE 1UBDC 1FJGE 5CFFE 1XNQE 4WYQB 3HPZA 1YSAC 1LLMC 2EMXA 4F54A 2WBSA 1A1GA 5AASA 5IT9C 2JVAA 2EORA 3T1YE 4OOGC 2JY9A 2YU8A 4R03A 2B9DA 2ELZA 2YZTA 4O24A 2CTDA 2EMAA 2NUEA 4JI4E 2EPLX 1A1KA 2EOHA 5A2QC 2EM9A 2L2MA 3KZZA 1RC7A 2LO3A 2VQEE 3L00A 1N34E 4B3SE 2L8TA 1UN6B 4LF9E 2MDGA 1UILA 4ZYDA 1TF6A 4Q28A 2HC5A 2RPCA 4DV6E 2CT1A 2EL4A 3MHSC 2BBGA 4O43A 2YRMA 2VE7C 3ZOQB 2EL6A 2H36X 4DUZE 2YTOA 3TQMA 4R2AA 2EMWA 1B69A 1A1FA 4LU9A 4BS9A 1WHQA 2EP3A 3K6QA 2EMCA 5IV8B 2V8QB 4ZYEA 3IWBA 4YHHE 4B3ME 2EOSA 4R2EA 4DR7E 2FGGA 1STUA 2L3JA 2EQ1A 4BC9A 4R2QA 5A6BD 4DV3E 4DV1E 5A6KA 2EM4A 4HTGA 4WX9A 4DR3E 4JI2E 3VYXA
chains in the Genus database with same CATH topology
4R2DA 1NCSA 4R2PA 2EPUA 2EOIA 5KL7A 4FK5C 1RMDA 2EM6A 2EOYA 3EPLA 3MHHC 4M9VC 2EN4A 2EOXA 2LCEA 2PRTA 2GLIA 2ENAA 2JPAA 2ELYA 1A1HA 2YSPA 2EMYA 2RSIA 2EM8A 2YTNA 2YTPA 2EMKA 2YTEA 2EMBA 2YTIA 2DRPA 2EN7A 2YTGA 1YUIA 2DLQA 1P47A 2EMLA 2WCC3 2J7JA 2LV2A 2YSOA 5KL5A 3EPHA 2EOZA 2R1FA 4F6NA 1AAYA 1WJPA 2CSHA 2EMHA 1A1IA 1TN9A 1JK2A 2WBTA 4IS1C 2EM0A 1A1LA 2EM5A 2YTJA 2EPZA 2EM2A 2EQ3A 2ADRA 2LT7A 1UBDC 1JK1A 2ENCA 2EMIA 1Z1BA 2EN1A 1TF3A 1ZR9A 2EPCA 2GHFA 2HGHA 1YSAC 1LLMC 2EMXA 2EMGA 2WBSA 1A1GA 2EL5A 1X6FA 2EORA 2EM7A 2WBUA 2JP9A 2YTFA 2EOMA 2EOJA 2YU8A 2EPRA 1BB8A 2ELZA 2EJ4A 2CTDA 2EMAA 2A25A 1F2IG 2MKNA 2EPPA 1A1KA 2YTDA 2EN2A 2EOHA 2EM3A 3EPKA 5KL2A 2EM9A 2E72A 2LO3A 2DGCA 1G2FC 2EOEA 2MKDA 2EQ0A 1MEYC 1UN6B 1X6HA 2YRKA 2EN3A 2MDGA 5KL3A 1A1JA 2YTQA 3M99B 5KL4A 3UK3C 2DMIA 1ZU1A 4F6MA 2YU5A 2VRDA 1KJKA 2EE8A 1TF6A 1G2DC 2EN8A 2RPCA 2CT1A 2EOQA 2EL4A 3MHSC 2YRMA 4IJDA 2I13A 1BBOA 2EL6A 2YTOA 4R2AA 2D9HA 2NABA 2EMWA 4R2CA 1B69A 4R2SA 1DGCA 2ENHA 2M9AA 1A1FA 1X6EA 2LVHA 2EP3A 2EMCA 5KL6A 2EOFA 4F2JC 1X3CA 1X5WA 2EMFA 3VHTB 2EOSA 4R2EA 4X9JA 4GZNC 2EPAA 1YUJA 4WSGA 2EMZA 2EQ1A 4R2QA 2YRHA 4R2RA 2DLKA 1ZAAC 2EOOA 2EM4A 3EPJA 2EPXA 2BB8A 2EN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2D A;  1NCS A;  4R2P A;  2EPU A;  2EOI A;  5KL7 A;  4FK5 C;  1RMD A;  2EM6 A;  2EOY A;  3EPL A;  3MHH C;  4M9V C;  2EN4 A;  2EOX A;  2LCE A;  2PRT A;  2GLI A;  2ENA A;  2JPA A;  2ELY A;  1A1H A;  2YSP A;  2EMY A;  2RSI A;  2EM8 A;  2YTN A;  2YTP A;  2EMK A;  2YTE A;  2EMB A;  2YTI A;  2DRP A;  2EN7 A;  2YTG A;  1YUI A;  2DLQ A;  1P47 A;  2EML A;  2WCC 3;  2J7J A;  2LV2 A;  2YSO A;  5KL5 A;  3EPH A;  2EOZ A;  2R1F A;  4F6N A;  1AAY A;  1WJP A;  2CSH A;  2EMH A;  1A1I A;  1TN9 A;  1JK2 A;  2WBT A;  4IS1 C;  2EM0 A;  1A1L A;  2EM5 A;  2YTJ A;  2EPZ A;  2EM2 A;  2EQ3 A;  2ADR A;  2LT7 A;  1UBD C;  1JK1 A;  2ENC A;  2EMI A;  1Z1B A;  2EN1 A;  1TF3 A;  1ZR9 A;  2EPC A;  2GHF A;  2HGH A;  1YSA C;  1LLM C;  2EMX A;  2EMG A;  2WBS A;  1A1G A;  2EL5 A;  1X6F A;  2EOR A;  2EM7 A;  2WBU A;  2JP9 A;  2YTF A;  2EOM A;  2EOJ A;  2YU8 A;  2EPR A;  1BB8 A;  2ELZ A;  2EJ4 A;  2CTD A;  2EMA A;  2A25 A;  1F2I G;  2MKN A;  2EPP A;  1A1K A;  2YTD A;  2EN2 A;  2EOH A;  2EM3 A;  3EPK A;  5KL2 A;  2EM9 A;  2E72 A;  2LO3 A;  2DGC A;  1G2F C;  2EOE A;  2MKD A;  2EQ0 A;  1MEY C;  1UN6 B;  1X6H A;  2YRK A;  2EN3 A;  2MDG A;  5KL3 A;  1A1J A;  2YTQ A;  3M99 B;  5KL4 A;  3UK3 C;  2DMI A;  1ZU1 A;  4F6M A;  2YU5 A;  2VRD A;  1KJK A;  2EE8 A;  1TF6 A;  1G2D C;  2EN8 A;  2RPC A;  2CT1 A;  2EOQ A;  2EL4 A;  3MHS C;  2YRM A;  4IJD A;  2I13 A;  1BBO A;  2EL6 A;  2YTO A;  4R2A A;  2D9H A;  2NAB A;  2EMW A;  4R2C A;  1B69 A;  4R2S A;  1DGC A;  2ENH A;  2M9A A;  1A1F A;  1X6E A;  2LVH A;  2EP3 A;  2EMC A;  5KL6 A;  2EOF A;  4F2J C;  1X3C A;  1X5W A;  2EMF A;  3VHT B;  2EOS A;  4R2E A;  4X9J A;  4GZN C;  2EPA A;  1YUJ A;  4WSG A;  2EMZ A;  2EQ1 A;  4R2Q A;  2YRH A;  4R2R A;  2DLK A;  1ZAA C;  2EOO A;  2EM4 A;  3EPJ A;  2EPX A;  2BB8 A;  2EN6 A; 
#chains in the Genus database with same CATH topology
 3THN A;  1NCS A;  4DR1 E;  2LJU A;  4M9V C;  4NHR A;  2GLI A;  2JPA A;  1A1H A;  2YWQ A;  4DR6 E;  2YTN A;  3JU0 A;  3BID A;  2EMK A;  3EQ1 A;  1N36 E;  2EMB A;  4WXC A;  2YTI A;  3DJW A;  1YUI A;  3ADI A;  2DLQ A;  4DKK A;  4WPY A;  1DQ3 A;  2YSO A;  1EH8 A;  1QNT A;  1AAY A;  4B3T E;  1HNX E;  1JK2 A;  4B3R E;  2EPZ A;  1GQE A;  1XMO E;  4RHB B;  3KZY A;  2B7T A;  3VYY A;  4N4R B;  3ADL A;  2EMI A;  3AV0 A;  4X62 E;  2UXD E;  2EPC A;  4DV0 E;  2GHF A;  1T38 A;  1I94 E;  4DV7 E;  2EMG A;  3DF6 A;  2EL5 A;  3VK6 A;  2JP9 A;  3HPS A;  2YTF A;  1HNW E;  2EOM A;  2R76 A;  2EOJ A;  3BGH A;  2LUQ A;  2CPN A;  2LMZ A;  1HR0 E;  2A25 A;  2LRS A;  1GTK A;  2E5L E;  1EH6 A;  1ZBQ A;  2EN2 A;  1IBM E;  4MLQ A;  2EPK X;  5AC5 A;  1G2F C;  2MKD A;  1YYW A;  5T6J A;  3QG5 C;  2EN3 A;  3JAM C;  5KL3 A;  3J81 C;  3M99 B;  1IBK E;  2V86 A;  4F6M A;  1PDA A;  4BMJ A;  1J5E E;  1WXR A;  3BF2 A;  2KOU A;  2EN8 A;  3BBG A;  2LTS A;  4X64 E;  3ADJ A;  1PKP A;  2FV4 B;  2EOQ A;  2I13 A;  1BBO A;  1EH7 A;  3LML A;  1YPN A;  2UUC E;  3OML A;  1DGC A;  4R2S A;  2LJH A;  2NUG A;  2MC6 A;  1X6E A;  5A6A A;  4GKJ E;  5AE3 A;  1PJQ A;  3C6K A;  5KL6 A;  4LF8 E;  2EOF A;  4F2J C;  1DI2 A;  3HQ1 A;  1X5W A;  3VHT B;  4X9J A;  4DV5 E;  4GZN C;  4DR2 E;  4HEI A;  2M4I A;  4BHB A;  4P78 A;  2JWO A;  2MC5 A;  5FLX C;  2DLK A;  2EOO A;  1PJS A;  2EPX A;  1IBL E;  2EN6 A;  5A6B A;  1NEI A;  2L3C A;  4R2D A;  4JI8 E;  4X66 E;  1AH5 A;  5LL6 R;  4JI7 E;  2K7I A;  2FTX B;  2EOX A;  2LCE A;  2K4V A;  2ENA A;  2ELY A;  4K0K E;  2YSP A;  3P1X A;  1ZBT A;  2DMY A;  2KON A;  2EN7 A;  5DNY A;  2YTG A;  4LF4 E;  4NXM E;  1P47 A;  2EML A;  2J7J A;  5A69 A;  5KL5 A;  4F9B B;  1WJP A;  2EMH A;  2NA2 A;  4TUI A;  4OX9 E;  1TN9 A;  1L4S A;  4BCA A;  1A1L A;  4GKK E;  2LBS B;  1XMQ E;  2EQ3 A;  2ADR A;  4X65 E;  2LT7 A;  2UXB E;  4J8Z A;  2EPN A;  2V89 A;  2RS7 A;  1JK1 A;  4JI3 E;  4LF5 E;  4F9A B;  1Z1B A;  2EN1 A;  3C4T A;  1ZR9 A;  1MGT A;  2MDR A;  4BC7 A;  2HGH A;  1YYK A;  2VF1 A;  2B3T B;  2G7H A;  1T39 A;  1N3G A;  2I9I A;  1X6F A;  2WBU A;  5LLQ A;  3MSW A;  1BB8 A;  4YY3 E;  5IWA E;  2L6M A;  2ODR D;  1RQ0 A;  1IQS A;  4ZYH A;  1SFE A;  4JI1 E;  3EPK A;  2E72 A;  1T4L B;  4BBY A;  2EOE A;  2EQ0 A;  1MEY C;  1X6H A;  2RTX A;  2YRK A;  2UU9 E;  5LMU E;  5F3W A;  4GEQ B;  5KL4 A;  3UK3 C;  2DMI A;  2EE8 A;  4KWY A;  4DR4 E;  1G2D C;  1T4O A;  2YT4 A;  1X47 A;  4X8W A;  3J7A G;  3IWC A;  2GPI A;  3RMP A;  2V85 A;  3KWR A;  2F8B A;  2D9H A;  2NAB A;  4R2C A;  5AE1 A;  4Q35 B;  2KHX A;  2M9A A;  1XNR E;  5AE2 A;  2ODR C;  3OTO E;  1X3C A;  2EMF A;  4WSG A;  1WHN A;  2UUA E;  2YRH A;  2NUF A;  1X48 A;  4L8N A;  2F4V E;  3EPJ A;  2VQF E;  2BB8 A;  3J80 C;  1WRJ A;  2V83 A;  2LTR A;  3HTX A;  3J7Y p;  4R2P A;  3C6M A;  2EOI A;  4LFC E;  2EOY A;  1X49 A;  3MHH C;  2L92 A;  4MLV A;  2EN4 A;  2PRT A;  4F9C B;  1QU6 A;  2EM8 A;  4WFT A;  2YTP A;  2DRP A;  2RQL A;  2RS6 A;  5TSE A;  2JYA A;  3JTZ A;  4L5N C;  4DV4 E;  1PJT A;  2EWL A;  2LV2 A;  4O4K A;  2R1F A;  1FKA E;  1GZ6 A;  2RSM A;  4IS1 C;  1UHZ A;  2JXP A;  2EM5 A;  2YTJ A;  4JI0 E;  2M7Q A;  2V88 A;  4BHC A;  4M0V A;  1HNZ E;  2LUP B;  5AC4 A;  2DB2 A;  2ENC A;  3IWD A;  1TF3 A;  2ZM6 E;  2UXC E;  1EKZ A;  2EPO A;  1KYQ A;  2L33 A;  1YFH A;  4WSP A;  2EM7 A;  2JR1 A;  2UUB E;  4M30 A;  4LTY A;  2N8X A;  3FIG A;  2EPR A;  2L2N A;  4KHP E;  2EJ4 A;  2E1M A;  1T4N A;  2EZ6 A;  4LFB E;  2DSY A;  1IQO A;  3F6G A;  1O0W A;  2JOB A;  1F2I G;  2MKN A;  2HJJ A;  2EPP A;  5A6J A;  2YTD A;  2EM3 A;  5KL2 A;  4DV2 E;  5IXM B;  1J26 A;  4DMI A;  2DGC A;  2WZO A;  4JYA E;  2DIX A;  1A1J A;  4DUY E;  2YTQ A;  1ZU1 A;  2YU5 A;  2VRD A;  1KJK A;  2N3G A;  3LLH A;  4IJD A;  4WXD A;  1N33 E;  4AQY E;  2LE2 A;  4ZYG A;  2ENH A;  1N32 E;  2L2K B;  2LVH A;  2N3H A;  3THO B;  3F6H A;  2V87 A;  4JI6 E;  4M2Z A;  2YPN A;  2EPA A;  5BR8 E;  1YUJ A;  2EMZ A;  2JOX A;  2B7V A;  2EPM X;  4O5G A;  3C4B A;  5ADZ A;  4R2R A;  1ZAA C;  2IHR 1;  4KZS A;  4LFA E;  1IMU A;  4R8O A;  4NXN E;  4JI5 E;  1SR9 A;  2EPU A;  5KL7 A;  3AUZ A;  4FK5 C;  1RMD A;  2EM6 A;  4NZV A;  1BBG A;  3EPL A;  4JV5 E;  4LF7 E;  1YZ9 A;  2EMY A;  2RSI A;  2YTE A;  4RH8 A;  3H09 A;  2M1S A;  3ECR A;  4I8O A;  2WCC 3;  3HXL A;  5LMN E;  3EPH A;  2EOZ A;  4F6N A;  2CSH A;  4DR5 E;  1A1I A;  3T1H E;  4TUG A;  2WBT A;  4LF6 E;  2Q8U A;  2EM0 A;  4P7D A;  1YYO A;  3ADG A;  2EM2 A;  2HHH E;  1UBD C;  1FJG E;  5CFF E;  1XNQ E;  4WYQ B;  3HPZ A;  1YSA C;  1LLM C;  2EMX A;  4F54 A;  2WBS A;  1A1G A;  5AAS A;  5IT9 C;  2JVA A;  2EOR A;  3T1Y E;  4OOG C;  2JY9 A;  2YU8 A;  4R03 A;  2B9D A;  2ELZ A;  2YZT A;  4O24 A;  2CTD A;  2EMA A;  2NUE A;  4JI4 E;  2EPL X;  1A1K A;  2EOH A;  5A2Q C;  2EM9 A;  2L2M A;  3KZZ A;  1RC7 A;  2LO3 A;  2VQE E;  3L00 A;  1N34 E;  4B3S E;  2L8T A;  1UN6 B;  4LF9 E;  2MDG A;  1UIL A;  4ZYD A;  1TF6 A;  4Q28 A;  2HC5 A;  2RPC A;  4DV6 E;  2CT1 A;  2EL4 A;  3MHS C;  2BBG A;  4O43 A;  2YRM A;  2VE7 C;  3ZOQ B;  2EL6 A;  2H36 X;  4DUZ E;  2YTO A;  3TQM A;  4R2A A;  2EMW A;  1B69 A;  1A1F A;  4LU9 A;  4BS9 A;  1WHQ A;  2EP3 A;  3K6Q A;  2EMC A;  5IV8 B;  2V8Q B;  4ZYE A;  3IWB A;  4YHH E;  4B3M E;  2EOS A;  4R2E A;  4DR7 E;  2FGG A;  1STU A;  2L3J A;  2EQ1 A;  4BC9 A;  4R2Q A;  5A6B D;  4DV3 E;  4DV1 E;  5A6K A;  2EM4 A;  4HTG A;  4WX9 A;  4DR3 E;  4JI2 E;  3VYX A; 
#chains in the Genus database with same CATH homology
 4R2D A;  1NCS A;  4R2P A;  2EPU A;  2EOI A;  5KL7 A;  4FK5 C;  1RMD A;  2EM6 A;  2EOY A;  3EPL A;  3MHH C;  4M9V C;  2EN4 A;  2EOX A;  2LCE A;  2PRT A;  2GLI A;  2ENA A;  2JPA A;  2ELY A;  1A1H A;  2YSP A;  2EMY A;  2RSI A;  2EM8 A;  2YTN A;  2YTP A;  2EMK A;  2YTE A;  2EMB A;  2YTI A;  2DRP A;  2EN7 A;  2YTG A;  1YUI A;  2DLQ A;  1P47 A;  2EML A;  2WCC 3;  2J7J A;  2LV2 A;  2YSO A;  5KL5 A;  3EPH A;  2EOZ A;  2R1F A;  4F6N A;  1AAY A;  1WJP A;  2CSH A;  2EMH A;  1A1I A;  1TN9 A;  1JK2 A;  2WBT A;  4IS1 C;  2EM0 A;  1A1L A;  2EM5 A;  2YTJ A;  2EPZ A;  2EM2 A;  2EQ3 A;  2ADR A;  2LT7 A;  1UBD C;  1JK1 A;  2ENC A;  2EMI A;  1Z1B A;  2EN1 A;  1TF3 A;  1ZR9 A;  2EPC A;  2GHF A;  2HGH A;  1YSA C;  1LLM C;  2EMX A;  2EMG A;  2WBS A;  1A1G A;  2EL5 A;  1X6F A;  2EOR A;  2EM7 A;  2WBU A;  2JP9 A;  2YTF A;  2EOM A;  2EOJ A;  2YU8 A;  2EPR A;  1BB8 A;  2ELZ A;  2EJ4 A;  2CTD A;  2EMA A;  2A25 A;  1F2I G;  2MKN A;  2EPP A;  1A1K A;  2YTD A;  2EN2 A;  2EOH A;  2EM3 A;  3EPK A;  5KL2 A;  2EM9 A;  2E72 A;  2LO3 A;  2DGC A;  1G2F C;  2EOE A;  2MKD A;  2EQ0 A;  1MEY C;  1UN6 B;  1X6H A;  2YRK A;  2EN3 A;  2MDG A;  5KL3 A;  1A1J A;  2YTQ A;  3M99 B;  5KL4 A;  3UK3 C;  2DMI A;  1ZU1 A;  4F6M A;  2YU5 A;  2VRD A;  1KJK A;  2EE8 A;  1TF6 A;  1G2D C;  2EN8 A;  2RPC A;  2CT1 A;  2EOQ A;  2EL4 A;  3MHS C;  2YRM A;  4IJD A;  2I13 A;  1BBO A;  2EL6 A;  2YTO A;  4R2A A;  2D9H A;  2NAB A;  2EMW A;  4R2C A;  1B69 A;  4R2S A;  1DGC A;  2ENH A;  2M9A A;  1A1F A;  1X6E A;  2LVH A;  2EP3 A;  2EMC A;  5KL6 A;  2EOF A;  4F2J C;  1X3C A;  1X5W A;  2EMF A;  3VHT B;  2EOS A;  4R2E A;  4X9J A;  4GZN C;  2EPA A;  1YUJ A;  4WSG A;  2EMZ A;  2EQ1 A;  4R2Q A;  2YRH A;  4R2R A;  2DLK A;  1ZAA C;  2EOO A;  2EM4 A;  3EPJ A;  2EPX A;  2BB8 A;  2EN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...