2EOSA

Solution structure of the c2h2 type zinc finger (region 626-654) of human b-cell lymphoma 6 protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GSSGSSGGEKPYPCEICGTRFRHLQTLKSHLRIHTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords B-cell lymphoma 6 protein
publication title Solution structure of the C2H2 type zinc finger (region 626-654) of human B-cell lymphoma 6 protein
rcsb
source organism Homo sapiens
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eosA01
2YTJA 2LT7A 2EM4A 1G2FC 2R1FA 2EMKA 2HGHA 2EPCA 1TF3A 2LCEA 3MHHC 2YRKA 2VRDA 4R2SA 1A1LA 4IJDA 2YU8A 2EORA 2YTGA 1G2DC 1AAYA 5KL3A 2EQ1A 2DLKA 2DMIA 1JK1A 5KL5A 2EMAA 4GZNC 1YSAC 2MDGA 3EPKA 2EN4A 1KJKA 2LVHA 4X9JA 2RPCA 2EOSA 2ENHA 2EM9A 2EOXA 2YTDA 2EMBA 4R2DA 2CSHA 2EM0A 2ELZA 2LO3A 2EMXA 2YSPA 1MEYC 2YTPA 4FK5C 2EM3A 4F2JC 1NCSA 1A1HA 1X6FA 2EMIA 2YTIA 1X6HA 2EOZA 2MKDA 4F6NA 1ZU1A 1ZAAC 2EM7A 2LV2A 2YU5A 2YTEA 2EN7A 2EPUA 2EN2A 2EM6A 2EM5A 2EOEA 1UBDC 4R2QA 1WJPA 4WSGA 2CT1A 4IS1C 1X3CA 2EL6A 2EL5A 2EPRA 5KL7A 1F2IG 1UN6B 2EJ4A 2EPZA 2EMHA 1YUJA 4M9VC 1ZR9A 2GLIA 4R2EA 1P47A 2WCC3 2EMYA 2EN8A 2WBTA 1LLMC 2JPAA 2EOIA 2DRPA 2ADRA 2EOJA 3EPJA 2EP3A 2EMLA 2NABA 2EM2A 1BBOA 2EN6A 2CTDA 1YUIA 2MKNA 2JP9A 2EOFA 2DLQA 1Z1BA 2EOYA 1A1JA 2EE8A 1TN9A 2E72A 1JK2A 1DGCA 2EOMA 2YRHA 2J7JA 2EOHA 2GHFA 1A1GA 1TF6A 2EMGA 2EPAA 2EOQA 2YSOA 1B69A 2BB8A 2EQ0A 4R2CA 2YTFA 3UK3C 2EMWA 3M99B 1X5WA 4R2RA 2I13A 3VHTB 2EMZA 2A25A 2DGCA 5KL4A 5KL6A 4R2PA 2ELYA 2D9HA 2EQ3A 2RSIA 1RMDA 2M9AA 2YTOA 1A1IA 3EPLA 2ENAA 2YTNA 4F6MA 2WBUA 2EMFA 2EL4A 2EM8A 2EPXA 2WBSA 2EN1A 2ENCA 2YTQA 2YRMA 2PRTA 5KL2A 2EPPA 4R2AA 3MHSC 1BB8A 2EMCA 1A1FA 3EPHA 1A1KA 1X6EA 2EOOA 2EN3A
chains in the Genus database with same CATH superfamily
2V88A 2EM4A 2HGHA 1HNXE 2LCEA 2N3HA 5AC5A 2VRDA 3J81C 1YPNA 3BF2A 1STUA 4LF7E 1PJSA 4P78A 4KHPE 3HQ1A 2EM9A 2EOXA 2EMBA 3IWCA 4B3ME 2EM0A 3HPSA 4ZYHA 2M7QA 1MEYC 3L00A 4FK5C 1EH7A 4LFCE 2VQEE 4AQYE 4WXCA 5A2QC 1GZ6A 5ADZA 2EMIA 4JI0E 2YTIA 4F6NA 4M2ZA 1IMUA 1ZAAC 4WSPA 4DR4E 1X47A 2UXBE 4YY3E 2YTEA 1I94E 2EPUA 2RS7A 2JXPA 2EM5A 4LU9A 1UBDC 4R2QA 4WSGA 1QU6A 2CT1A 3K6QA 4WYQB 5LMNE 2EL5A 2UXDE 5A6BA 5KL7A 2EJ4A 2RTXA 1IBLE 1YUJA 5LL6R 3T1YE 1ZR9A 1N3GA 4TUIA 1P47A 2WCC3 2DRPA 2L2NA 2ADRA 1EKZA 1IBKE 3EPJA 3HXLA 1RQ0A 4DV1E 1WHNA 4F9AB 2EOFA 5DNYA 4R8OA 2EOYA 4MLQA 4M30A 4LTYA 4J8ZA 2EOMA 2HJJA 2GHFA 4X62E 2HC5A 2YT4A 2EMGA 5FLXC 2BB8A 4JI7E 4R2CA 2YTFA 3UK3C 2EMWA 3M99B 3VK6A 4R2RA 2I13A 4JI6E 2DGCA 2DIXA 2JYAA 4KWYA 3VYXA 2ELYA 1RMDA 4DV4E 2L92A 4GKKE 5IXMB 1WXRA 2K4VA 1T4LB 4RHBB 2ENAA 2ODRD 3OMLA 2WBUA 3C6MA 4LF9E 3F6GA 4JI4E 2ODRC 5AE1A 1A1FA 1X49A 2YWQA 1A1KA 1X6EA 2UXCE 2LT7A 5AASA 1G2FC 2UUCE 4RH8A 3MHHC 4R03A 4DR3E 2M4IA 2L3JA 4ZYDA 4DKKA 4Q28A 4R2SA 4IJDA 2YU8A 2EORA 2YTGA 2EQ1A 4O4KA 1PJTA 1MGTA 2EMAA 2I9IA 2MDGA 4N4RB 4L8NA 2EPMX 5IWAE 4LF5E 3TQMA 2RPCA 2IHR1 2FGGA 4BMJA 2L6MA 5IT9C 1N32E 2JWOA 5A6JA 4OX9E 2YSPA 5A69A 4B3TE 2EM3A 1A1HA 3ECRA 4M0VA 4B3SE 5BR8E 2MKDA 4P7DA 2BBGA 4DUYE 2VQFE 1ZU1A 5A6KA 4NXME 2YU5A 2EPNA 2EN7A 2EM6A 2L2MA 1WJPA 3C4BA 3FIGA 2NUGA 2EPRA 2EPZA 3JU0A 2H36X 2DB2A 2JOBA 4M9VC 2B3TB 1HNZE 3HPZA 3T1HE 2MC6A 2GLIA 4R2EA 1YYOA 1YYKA 2EMYA 1YYWA 2JPAA 4X66E 2EOIA 1T4NA 3LMLA 1UILA 2EMLA 2EM2A 2EN6A 2CTDA 2KHXA 1YUIA 2MKNA 5IV8B 4I8OA 1A1JA 4DV5E 1TN9A 4DV7E 3IWDA 2E72A 4BC9A 1JK2A 2V85A 1ZBQA 1J5EE 1A1GA 3DF6A 2EOQA 2YSOA 1B69A 2KOUA 3HTXA 5TSEA 2LRSA 1X5WA 3QG5C 5KL6A 2R76A 2EQ3A 3J7AG 2M9AA 1O0WA 3EPLA 2YZTA 1IQOA 4KZSA 2RS6A 4F6MA 2EMFA 2EPXA 4F9BB 2JVAA 2YTQA 2YRMA 5KL2A 3P1XA 4ZYGA 2MC5A 1HR0E 2L2KB 2EN3A 2VF1A 2EPLX 2F8BA 2V87A 1X48A 3KWRA 1A1LA 4JI1E 4LF8E 4BHBA 5KL3A 2V8QB 2B7VA 5KL5A 1KJKA 2EN4A 4WX9A 4DR6E 2LUQA 1L4SA 3RMPA 5A6BD 2WZOA 1YFHA 5T6JA 4R2DA 3MSWA 2V89A 2ELZA 3KZZA 2LJHA 5LMUE 2YTPA 4NHRA 2MDRA 2Q8UA 4F2JC 1NCSA 4LF6E 4NXNE 1X6FA 4MLVA 3JAMC 3AUZA 1X6HA 2EOZA 4DV6E 1YZ9A 4JV5E 2EM7A 2LV2A 4GEQB 3EQ1A 3ADGA 1XMQE 3THNA 2EOEA 4BBYA 4IS1C 1X3CA 2EL6A 1F2IG 1UN6B 4LFAE 2RSMA 2KONA 4WFTA 1XMOE 2E5LE 2L8TA 2DSYA 5AC4A 5A6AA 2EN8A 2WBTA 4GKJE 2N8XA 3IWBA 3AV0A 4O24A 1GQEA 1LLMC 4NZVA 1XNQE 2LBSB 2NABA 1SR9A 3VYYA 2DLQA 2EZ6A 2G7HA 1IBME 5AE2A 1HNWE 3DJWA 2NA2A 1N33E 1EH8A 1WHQA 2CPNA 1XNRE 1T39A 3C6KA 2B7TA 1DGCA 3H09A 2V86A 5CFFE 2J7JA 2LE2A 2EPAA 4HEIA 1AH5A 2UU9E 4O43A 2N3GA 2A25A 5KL4A 1T38A 2D9HA 2FV4B 2YPNA 2YTNA 3LLHA 2ZM6E 2HHHE 3ADLA 2WBSA 2NUFA 2ENCA 4JI5E 1PJQA 4R2AA 2EMCA 2M1SA 4JI8E 2VE7C 4TUGA 4DV0E 2YTJA 3ZOQB 4WPYA 2R1FA 2EMKA 4BHCA 4BC7A 2EPCA 1TF3A 2GPIA 2YRKA 4LFBE 1UHZA 1IQSA 3JTZA 2LUPB 1G2DC 3OTOE 1AAYA 2DMIA 2DLKA 1JK1A 1SFEA 4GZNC 1YSAC 3EPKA 2LVHA 1KYQA 3BBGA 4X9JA 4DMIA 2EOSA 2ENHA 2FTXB 2YTDA 5AE3A 1FKAE 1NEIA 2CSHA 4YHHE 2LO3A 2E1MA 4F54A 2EMXA 2LMZA 1QNTA 1BBGA 3BGHA 2K7IA 2RQLA 1RC7A 2F4VE 2EPKX 1ZBTA 2JR1A 1DQ3A 3J7Yp 1PDAA 4DR5E 1PKPA 2LTRA 2EN2A 1GTKA 1N34E 4DUZE 2B9DA 4O5GA 2LTSA 2L33A 4WXDA 4K0KE 4DR2E 2EMHA 4JI3E 3BIDA 4DR7E 3C4TA 5F3WA 2EOJA 2EP3A 2NUEA 1BBOA 1EH6A 2JP9A 1Z1BA 2DMYA 4LF4E 2EE8A 3ADIA 3J80C 4HTGA 4L5NC 4F9CB 4B3RE 2YRHA 2EOHA 1TF6A 2UUBE 2UUAE 1T4OA 4JI2E 2EQ0A 4Q35B 4BS9A 5LLQA 4DV3E 1DI2A 3ADJA 3VHTB 2V83A 2EMZA 2JOXA 3F6HA 1N36E 4R2PA 2L3CA 2EWLA 2RSIA 3THOB 2LJUA 4JYAE 4X64E 4DV2E 2YTOA 4DR1E 1A1IA 1WRJA 3KZYA 2EL4A 2EM8A 2JY9A 4ZYEA 2EN1A 4BCAA 4X65E 1FJGE 1J26A 2PRTA 2EPOA 2EPPA 4OOGC 3MHSC 1BB8A 4X8WA 3EPHA 2EOOA
chains in the Genus database with same CATH topology
2YTJA 2LT7A 2EM4A 1G2FC 2R1FA 2EMKA 2HGHA 2EPCA 1TF3A 2LCEA 3MHHC 2YRKA 2VRDA 4R2SA 1A1LA 4IJDA 2YU8A 2EORA 2YTGA 1G2DC 1AAYA 5KL3A 2EQ1A 2DLKA 2DMIA 1JK1A 5KL5A 2EMAA 4GZNC 1YSAC 2MDGA 3EPKA 2EN4A 1KJKA 2LVHA 4X9JA 2RPCA 2EOSA 2ENHA 2EM9A 2EOXA 2YTDA 2EMBA 4R2DA 2CSHA 2EM0A 2ELZA 2LO3A 2EMXA 2YSPA 1MEYC 2YTPA 4FK5C 2EM3A 4F2JC 1NCSA 1A1HA 1X6FA 2EMIA 2YTIA 1X6HA 2EOZA 2MKDA 4F6NA 1ZU1A 1ZAAC 2EM7A 2LV2A 2YU5A 2YTEA 2EN7A 2EPUA 2EN2A 2EM6A 2EM5A 2EOEA 1UBDC 4R2QA 1WJPA 4WSGA 2CT1A 4IS1C 1X3CA 2EL6A 2EL5A 2EPRA 5KL7A 1F2IG 1UN6B 2EJ4A 2EPZA 2EMHA 1YUJA 4M9VC 1ZR9A 2GLIA 4R2EA 1P47A 2WCC3 2EMYA 2EN8A 2WBTA 1LLMC 2JPAA 2EOIA 2DRPA 2ADRA 2EOJA 3EPJA 2EP3A 2EMLA 2NABA 2EM2A 1BBOA 2EN6A 2CTDA 1YUIA 2MKNA 2JP9A 2EOFA 2DLQA 1Z1BA 2EOYA 1A1JA 2EE8A 1TN9A 2E72A 1JK2A 1DGCA 2EOMA 2YRHA 2J7JA 2EOHA 2GHFA 1A1GA 1TF6A 2EMGA 2EPAA 2EOQA 2YSOA 1B69A 2BB8A 2EQ0A 4R2CA 2YTFA 3UK3C 2EMWA 3M99B 1X5WA 4R2RA 2I13A 3VHTB 2EMZA 2A25A 2DGCA 5KL4A 5KL6A 4R2PA 2ELYA 2D9HA 2EQ3A 2RSIA 1RMDA 2M9AA 2YTOA 1A1IA 3EPLA 2ENAA 2YTNA 4F6MA 2WBUA 2EMFA 2EL4A 2EM8A 2EPXA 2WBSA 2EN1A 2ENCA 2YTQA 2YRMA 2PRTA 5KL2A 2EPPA 4R2AA 3MHSC 1BB8A 2EMCA 1A1FA 3EPHA 1A1KA 1X6EA 2EOOA 2EN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTJ A;  2LT7 A;  2EM4 A;  1G2F C;  2R1F A;  2EMK A;  2HGH A;  2EPC A;  1TF3 A;  2LCE A;  3MHH C;  2YRK A;  2VRD A;  4R2S A;  1A1L A;  4IJD A;  2YU8 A;  2EOR A;  2YTG A;  1G2D C;  1AAY A;  5KL3 A;  2EQ1 A;  2DLK A;  2DMI A;  1JK1 A;  5KL5 A;  2EMA A;  4GZN C;  1YSA C;  2MDG A;  3EPK A;  2EN4 A;  1KJK A;  2LVH A;  4X9J A;  2RPC A;  2EOS A;  2ENH A;  2EM9 A;  2EOX A;  2YTD A;  2EMB A;  4R2D A;  2CSH A;  2EM0 A;  2ELZ A;  2LO3 A;  2EMX A;  2YSP A;  1MEY C;  2YTP A;  4FK5 C;  2EM3 A;  4F2J C;  1NCS A;  1A1H A;  1X6F A;  2EMI A;  2YTI A;  1X6H A;  2EOZ A;  2MKD A;  4F6N A;  1ZU1 A;  1ZAA C;  2EM7 A;  2LV2 A;  2YU5 A;  2YTE A;  2EN7 A;  2EPU A;  2EN2 A;  2EM6 A;  2EM5 A;  2EOE A;  1UBD C;  4R2Q A;  1WJP A;  4WSG A;  2CT1 A;  4IS1 C;  1X3C A;  2EL6 A;  2EL5 A;  2EPR A;  5KL7 A;  1F2I G;  1UN6 B;  2EJ4 A;  2EPZ A;  2EMH A;  1YUJ A;  4M9V C;  1ZR9 A;  2GLI A;  4R2E A;  1P47 A;  2WCC 3;  2EMY A;  2EN8 A;  2WBT A;  1LLM C;  2JPA A;  2EOI A;  2DRP A;  2ADR A;  2EOJ A;  3EPJ A;  2EP3 A;  2EML A;  2NAB A;  2EM2 A;  1BBO A;  2EN6 A;  2CTD A;  1YUI A;  2MKN A;  2JP9 A;  2EOF A;  2DLQ A;  1Z1B A;  2EOY A;  1A1J A;  2EE8 A;  1TN9 A;  2E72 A;  1JK2 A;  1DGC A;  2EOM A;  2YRH A;  2J7J A;  2EOH A;  2GHF A;  1A1G A;  1TF6 A;  2EMG A;  2EPA A;  2EOQ A;  2YSO A;  1B69 A;  2BB8 A;  2EQ0 A;  4R2C A;  2YTF A;  3UK3 C;  2EMW A;  3M99 B;  1X5W A;  4R2R A;  2I13 A;  3VHT B;  2EMZ A;  2A25 A;  2DGC A;  5KL4 A;  5KL6 A;  4R2P A;  2ELY A;  2D9H A;  2EQ3 A;  2RSI A;  1RMD A;  2M9A A;  2YTO A;  1A1I A;  3EPL A;  2ENA A;  2YTN A;  4F6M A;  2WBU A;  2EMF A;  2EL4 A;  2EM8 A;  2EPX A;  2WBS A;  2EN1 A;  2ENC A;  2YTQ A;  2YRM A;  2PRT A;  5KL2 A;  2EPP A;  4R2A A;  3MHS C;  1BB8 A;  2EMC A;  1A1F A;  3EPH A;  1A1K A;  1X6E A;  2EOO A;  2EN3 A; 
#chains in the Genus database with same CATH topology
 2V88 A;  2EM4 A;  2HGH A;  1HNX E;  2LCE A;  2N3H A;  5AC5 A;  2VRD A;  3J81 C;  1YPN A;  3BF2 A;  1STU A;  4LF7 E;  1PJS A;  4P78 A;  4KHP E;  3HQ1 A;  2EM9 A;  2EOX A;  2EMB A;  3IWC A;  4B3M E;  2EM0 A;  3HPS A;  4ZYH A;  2M7Q A;  1MEY C;  3L00 A;  4FK5 C;  1EH7 A;  4LFC E;  2VQE E;  4AQY E;  4WXC A;  5A2Q C;  1GZ6 A;  5ADZ A;  2EMI A;  4JI0 E;  2YTI A;  4F6N A;  4M2Z A;  1IMU A;  1ZAA C;  4WSP A;  4DR4 E;  1X47 A;  2UXB E;  4YY3 E;  2YTE A;  1I94 E;  2EPU A;  2RS7 A;  2JXP A;  2EM5 A;  4LU9 A;  1UBD C;  4R2Q A;  4WSG A;  1QU6 A;  2CT1 A;  3K6Q A;  4WYQ B;  5LMN E;  2EL5 A;  2UXD E;  5A6B A;  5KL7 A;  2EJ4 A;  2RTX A;  1IBL E;  1YUJ A;  5LL6 R;  3T1Y E;  1ZR9 A;  1N3G A;  4TUI A;  1P47 A;  2WCC 3;  2DRP A;  2L2N A;  2ADR A;  1EKZ A;  1IBK E;  3EPJ A;  3HXL A;  1RQ0 A;  4DV1 E;  1WHN A;  4F9A B;  2EOF A;  5DNY A;  4R8O A;  2EOY A;  4MLQ A;  4M30 A;  4LTY A;  4J8Z A;  2EOM A;  2HJJ A;  2GHF A;  4X62 E;  2HC5 A;  2YT4 A;  2EMG A;  5FLX C;  2BB8 A;  4JI7 E;  4R2C A;  2YTF A;  3UK3 C;  2EMW A;  3M99 B;  3VK6 A;  4R2R A;  2I13 A;  4JI6 E;  2DGC A;  2DIX A;  2JYA A;  4KWY A;  3VYX A;  2ELY A;  1RMD A;  4DV4 E;  2L92 A;  4GKK E;  5IXM B;  1WXR A;  2K4V A;  1T4L B;  4RHB B;  2ENA A;  2ODR D;  3OML A;  2WBU A;  3C6M A;  4LF9 E;  3F6G A;  4JI4 E;  2ODR C;  5AE1 A;  1A1F A;  1X49 A;  2YWQ A;  1A1K A;  1X6E A;  2UXC E;  2LT7 A;  5AAS A;  1G2F C;  2UUC E;  4RH8 A;  3MHH C;  4R03 A;  4DR3 E;  2M4I A;  2L3J A;  4ZYD A;  4DKK A;  4Q28 A;  4R2S A;  4IJD A;  2YU8 A;  2EOR A;  2YTG A;  2EQ1 A;  4O4K A;  1PJT A;  1MGT A;  2EMA A;  2I9I A;  2MDG A;  4N4R B;  4L8N A;  2EPM X;  5IWA E;  4LF5 E;  3TQM A;  2RPC A;  2IHR 1;  2FGG A;  4BMJ A;  2L6M A;  5IT9 C;  1N32 E;  2JWO A;  5A6J A;  4OX9 E;  2YSP A;  5A69 A;  4B3T E;  2EM3 A;  1A1H A;  3ECR A;  4M0V A;  4B3S E;  5BR8 E;  2MKD A;  4P7D A;  2BBG A;  4DUY E;  2VQF E;  1ZU1 A;  5A6K A;  4NXM E;  2YU5 A;  2EPN A;  2EN7 A;  2EM6 A;  2L2M A;  1WJP A;  3C4B A;  3FIG A;  2NUG A;  2EPR A;  2EPZ A;  3JU0 A;  2H36 X;  2DB2 A;  2JOB A;  4M9V C;  2B3T B;  1HNZ E;  3HPZ A;  3T1H E;  2MC6 A;  2GLI A;  4R2E A;  1YYO A;  1YYK A;  2EMY A;  1YYW A;  2JPA A;  4X66 E;  2EOI A;  1T4N A;  3LML A;  1UIL A;  2EML A;  2EM2 A;  2EN6 A;  2CTD A;  2KHX A;  1YUI A;  2MKN A;  5IV8 B;  4I8O A;  1A1J A;  4DV5 E;  1TN9 A;  4DV7 E;  3IWD A;  2E72 A;  4BC9 A;  1JK2 A;  2V85 A;  1ZBQ A;  1J5E E;  1A1G A;  3DF6 A;  2EOQ A;  2YSO A;  1B69 A;  2KOU A;  3HTX A;  5TSE A;  2LRS A;  1X5W A;  3QG5 C;  5KL6 A;  2R76 A;  2EQ3 A;  3J7A G;  2M9A A;  1O0W A;  3EPL A;  2YZT A;  1IQO A;  4KZS A;  2RS6 A;  4F6M A;  2EMF A;  2EPX A;  4F9B B;  2JVA A;  2YTQ A;  2YRM A;  5KL2 A;  3P1X A;  4ZYG A;  2MC5 A;  1HR0 E;  2L2K B;  2EN3 A;  2VF1 A;  2EPL X;  2F8B A;  2V87 A;  1X48 A;  3KWR A;  1A1L A;  4JI1 E;  4LF8 E;  4BHB A;  5KL3 A;  2V8Q B;  2B7V A;  5KL5 A;  1KJK A;  2EN4 A;  4WX9 A;  4DR6 E;  2LUQ A;  1L4S A;  3RMP A;  5A6B D;  2WZO A;  1YFH A;  5T6J A;  4R2D A;  3MSW A;  2V89 A;  2ELZ A;  3KZZ A;  2LJH A;  5LMU E;  2YTP A;  4NHR A;  2MDR A;  2Q8U A;  4F2J C;  1NCS A;  4LF6 E;  4NXN E;  1X6F A;  4MLV A;  3JAM C;  3AUZ A;  1X6H A;  2EOZ A;  4DV6 E;  1YZ9 A;  4JV5 E;  2EM7 A;  2LV2 A;  4GEQ B;  3EQ1 A;  3ADG A;  1XMQ E;  3THN A;  2EOE A;  4BBY A;  4IS1 C;  1X3C A;  2EL6 A;  1F2I G;  1UN6 B;  4LFA E;  2RSM A;  2KON A;  4WFT A;  1XMO E;  2E5L E;  2L8T A;  2DSY A;  5AC4 A;  5A6A A;  2EN8 A;  2WBT A;  4GKJ E;  2N8X A;  3IWB A;  3AV0 A;  4O24 A;  1GQE A;  1LLM C;  4NZV A;  1XNQ E;  2LBS B;  2NAB A;  1SR9 A;  3VYY A;  2DLQ A;  2EZ6 A;  2G7H A;  1IBM E;  5AE2 A;  1HNW E;  3DJW A;  2NA2 A;  1N33 E;  1EH8 A;  1WHQ A;  2CPN A;  1XNR E;  1T39 A;  3C6K A;  2B7T A;  1DGC A;  3H09 A;  2V86 A;  5CFF E;  2J7J A;  2LE2 A;  2EPA A;  4HEI A;  1AH5 A;  2UU9 E;  4O43 A;  2N3G A;  2A25 A;  5KL4 A;  1T38 A;  2D9H A;  2FV4 B;  2YPN A;  2YTN A;  3LLH A;  2ZM6 E;  2HHH E;  3ADL A;  2WBS A;  2NUF A;  2ENC A;  4JI5 E;  1PJQ A;  4R2A A;  2EMC A;  2M1S A;  4JI8 E;  2VE7 C;  4TUG A;  4DV0 E;  2YTJ A;  3ZOQ B;  4WPY A;  2R1F A;  2EMK A;  4BHC A;  4BC7 A;  2EPC A;  1TF3 A;  2GPI A;  2YRK A;  4LFB E;  1UHZ A;  1IQS A;  3JTZ A;  2LUP B;  1G2D C;  3OTO E;  1AAY A;  2DMI A;  2DLK A;  1JK1 A;  1SFE A;  4GZN C;  1YSA C;  3EPK A;  2LVH A;  1KYQ A;  3BBG A;  4X9J A;  4DMI A;  2EOS A;  2ENH A;  2FTX B;  2YTD A;  5AE3 A;  1FKA E;  1NEI A;  2CSH A;  4YHH E;  2LO3 A;  2E1M A;  4F54 A;  2EMX A;  2LMZ A;  1QNT A;  1BBG A;  3BGH A;  2K7I A;  2RQL A;  1RC7 A;  2F4V E;  2EPK X;  1ZBT A;  2JR1 A;  1DQ3 A;  3J7Y p;  1PDA A;  4DR5 E;  1PKP A;  2LTR A;  2EN2 A;  1GTK A;  1N34 E;  4DUZ E;  2B9D A;  4O5G A;  2LTS A;  2L33 A;  4WXD A;  4K0K E;  4DR2 E;  2EMH A;  4JI3 E;  3BID A;  4DR7 E;  3C4T A;  5F3W A;  2EOJ A;  2EP3 A;  2NUE A;  1BBO A;  1EH6 A;  2JP9 A;  1Z1B A;  2DMY A;  4LF4 E;  2EE8 A;  3ADI A;  3J80 C;  4HTG A;  4L5N C;  4F9C B;  4B3R E;  2YRH A;  2EOH A;  1TF6 A;  2UUB E;  2UUA E;  1T4O A;  4JI2 E;  2EQ0 A;  4Q35 B;  4BS9 A;  5LLQ A;  4DV3 E;  1DI2 A;  3ADJ A;  3VHT B;  2V83 A;  2EMZ A;  2JOX A;  3F6H A;  1N36 E;  4R2P A;  2L3C A;  2EWL A;  2RSI A;  3THO B;  2LJU A;  4JYA E;  4X64 E;  4DV2 E;  2YTO A;  4DR1 E;  1A1I A;  1WRJ A;  3KZY A;  2EL4 A;  2EM8 A;  2JY9 A;  4ZYE A;  2EN1 A;  4BCA A;  4X65 E;  1FJG E;  1J26 A;  2PRT A;  2EPO A;  2EPP A;  4OOG C;  3MHS C;  1BB8 A;  4X8W A;  3EPH A;  2EOO A; 
#chains in the Genus database with same CATH homology
 2YTJ A;  2LT7 A;  2EM4 A;  1G2F C;  2R1F A;  2EMK A;  2HGH A;  2EPC A;  1TF3 A;  2LCE A;  3MHH C;  2YRK A;  2VRD A;  4R2S A;  1A1L A;  4IJD A;  2YU8 A;  2EOR A;  2YTG A;  1G2D C;  1AAY A;  5KL3 A;  2EQ1 A;  2DLK A;  2DMI A;  1JK1 A;  5KL5 A;  2EMA A;  4GZN C;  1YSA C;  2MDG A;  3EPK A;  2EN4 A;  1KJK A;  2LVH A;  4X9J A;  2RPC A;  2EOS A;  2ENH A;  2EM9 A;  2EOX A;  2YTD A;  2EMB A;  4R2D A;  2CSH A;  2EM0 A;  2ELZ A;  2LO3 A;  2EMX A;  2YSP A;  1MEY C;  2YTP A;  4FK5 C;  2EM3 A;  4F2J C;  1NCS A;  1A1H A;  1X6F A;  2EMI A;  2YTI A;  1X6H A;  2EOZ A;  2MKD A;  4F6N A;  1ZU1 A;  1ZAA C;  2EM7 A;  2LV2 A;  2YU5 A;  2YTE A;  2EN7 A;  2EPU A;  2EN2 A;  2EM6 A;  2EM5 A;  2EOE A;  1UBD C;  4R2Q A;  1WJP A;  4WSG A;  2CT1 A;  4IS1 C;  1X3C A;  2EL6 A;  2EL5 A;  2EPR A;  5KL7 A;  1F2I G;  1UN6 B;  2EJ4 A;  2EPZ A;  2EMH A;  1YUJ A;  4M9V C;  1ZR9 A;  2GLI A;  4R2E A;  1P47 A;  2WCC 3;  2EMY A;  2EN8 A;  2WBT A;  1LLM C;  2JPA A;  2EOI A;  2DRP A;  2ADR A;  2EOJ A;  3EPJ A;  2EP3 A;  2EML A;  2NAB A;  2EM2 A;  1BBO A;  2EN6 A;  2CTD A;  1YUI A;  2MKN A;  2JP9 A;  2EOF A;  2DLQ A;  1Z1B A;  2EOY A;  1A1J A;  2EE8 A;  1TN9 A;  2E72 A;  1JK2 A;  1DGC A;  2EOM A;  2YRH A;  2J7J A;  2EOH A;  2GHF A;  1A1G A;  1TF6 A;  2EMG A;  2EPA A;  2EOQ A;  2YSO A;  1B69 A;  2BB8 A;  2EQ0 A;  4R2C A;  2YTF A;  3UK3 C;  2EMW A;  3M99 B;  1X5W A;  4R2R A;  2I13 A;  3VHT B;  2EMZ A;  2A25 A;  2DGC A;  5KL4 A;  5KL6 A;  4R2P A;  2ELY A;  2D9H A;  2EQ3 A;  2RSI A;  1RMD A;  2M9A A;  2YTO A;  1A1I A;  3EPL A;  2ENA A;  2YTN A;  4F6M A;  2WBU A;  2EMF A;  2EL4 A;  2EM8 A;  2EPX A;  2WBS A;  2EN1 A;  2ENC A;  2YTQ A;  2YRM A;  2PRT A;  5KL2 A;  2EPP A;  4R2A A;  3MHS C;  1BB8 A;  2EMC A;  1A1F A;  3EPH A;  1A1K A;  1X6E A;  2EOO A;  2EN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...