2EOQA

Solution structure of the c2h2 type zinc finger (region 283-315) of human zinc finger protein 224
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFKCDICGKSFCGRSRLNRHSMVHTAEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 283-315) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoqA01
1Z1BA 3EPKA 3EPLA 2EPCA 1RMDA 4R2PA 2DLQA 2EN2A 1A1LA 2EOYA 1A1JA 2EM9A 2DLKA 4R2DA 1A1GA 2EOJA 4R2SA 2YTFA 3VHTB 2MDGA 5KL2A 5KL6A 2LT7A 2EMGA 2EMXA 1X6HA 2EPAA 2RSIA 1F2IG 2R1FA 1WJPA 2EQ3A 2EMLA 4X9JA 1G2DC 2EOIA 2GLIA 1X3CA 4F6MA 2EP3A 2EPUA 2EN1A 1YUIA 2WCC3 1ZR9A 1TN9A 2EPXA 2EM3A 2DRPA 5KL4A 3EPJA 1X6FA 2ENCA 2ELYA 2EOEA 2CSHA 2EN8A 2YTGA 1G2FC 2GHFA 2EN3A 1JK1A 2CT1A 2JP9A 2EOQA 2EORA 4R2QA 4R2RA 1AAYA 4F2JC 2VRDA 2EMAA 2EMHA 2EM0A 2EMYA 4FK5C 2EM5A 2EL4A 1JK2A 2I13A 1A1IA 2ENHA 4GZNC 5KL5A 2EQ0A 1P47A 1DGCA 2EMKA 2EOZA 1B69A 2EMBA 1X5WA 2LO3A 2YRKA 2EN7A 2LCEA 2WBTA 2YTJA 1ZAAC 1BB8A 2EOHA 1X6EA 2YTOA 2EL5A 2YTPA 1NCSA 2EN4A 2EQ1A 2E72A 2ELZA 2BB8A 2EL6A 2YU8A 1TF3A 2EPZA 2YTNA 2YRMA 2EM4A 2EM2A 2EMFA 2YTIA 2PRTA 4F6NA 3M99B 2YTDA 2YSPA 4WSGA 3EPHA 2HGHA 4IS1C 1YUJA 2EPRA 1KJKA 3UK3C 3MHSC 2YU5A 2WBSA 2DMIA 2EJ4A 2EM6A 2D9HA 2EOXA 2CTDA 2EE8A 2EOFA 2LV2A 2ENAA 1TF6A 4R2CA 2NABA 2EN6A 3MHHC 2LVHA 2J7JA 2RPCA 2MKNA 1ZU1A 2EM7A 2WBUA 2EPPA 4M9VC 2ADRA 2YRHA 1LLMC 2YTQA 5KL3A 2EM8A 1UBDC 2A25A 2MKDA 1YSAC 1UN6B 1BBOA 5KL7A 2EMCA 2EOMA 2DGCA 2M9AA 2EOSA 2JPAA 4R2AA 1A1HA 2EMWA 4R2EA 4IJDA 2EMIA 2YSOA 2EMZA 1A1FA 1A1KA 2YTEA 1MEYC 2EOOA
chains in the Genus database with same CATH superfamily
2YT4A 1Z1BA 5AE1A 2F4VE 1QNTA 1A1LA 2EOYA 2K4VA 1GZ6A 2JVAA 2EOJA 4R2SA 2YTFA 3VHTB 2MDGA 2UU9E 5KL2A 5KL6A 1XNQE 3HPSA 3C4TA 2E1MA 2K7IA 4JI8E 1N36E 1WHNA 4O24A 4LF4E 2R1FA 1STUA 2EMLA 2EOIA 2EPLX 4DV6E 1N34E 1IBLE 4OOGC 1PJQA 3J80C 2B3TB 4DV0E 1ZR9A 2BBGA 5A6KA 5IXMB 5KL4A 2ENCA 4ZYHA 1UILA 4DV5E 1N3GA 2ELYA 2N3GA 4DV2E 2EPKX 4P78A 2EN3A 2KOUA 2JP9A 4R2RA 5A6BD 2EMAA 1JK2A 1HR0E 2JOXA 2ENHA 2EPOA 2FGGA 4DMIA 1I94E 4GEQB 4DV4E 4DR2E 1X5WA 4F9AB 2DIXA 2V89A 2EOHA 2YPNA 4WXDA 1NCSA 2L6MA 2N3HA 5A6JA 2LUPB 4LF5E 2YU8A 1TF3A 1T39A 4NXME 2EPZA 3ZOQB 1T4LB 2JYAA 2EM4A 2EM2A 2EMFA 4NXNE 4N4RB 4F6NA 2YTDA 1GTKA 4BHCA 2L2NA 3KZZA 4DR6E 3EPHA 2NUEA 4DR4E 2B7TA 4BMJA 5A6BA 4X8WA 3L00A 2EPRA 2EPNA 2YU5A 2WBSA 2LRSA 3TQMA 4X65E 3F6GA 4KHPE 1X48A 4DR5E 3MSWA 2LVHA 3BF2A 2EPPA 4RH8A 4X62E 1LLMC 2RSMA 5KL3A 1BBOA 1YSAC 2L8TA 3OMLA 4JI7E 2L2KB 2DGCA 4ZYEA 2EOSA 5AC5A 2JPAA 2JXPA 4B3TE 4WSPA 1AH5A 1IMUA 3EPLA 2EPCA 1RMDA 4R2PA 4M30A 2GPIA 2V87A 1HNXE 4M0VA 1IQSA 4R8OA 1A1GA 2IHR1 2LTRA 5AE2A 3FIGA 3BGHA 2EMGA 4JI3E 1X6HA 2EPAA 2RSIA 4DR3E 1WRJA 4WX9A 2HJJA 2MC6A 4BHBA 5BR8E 3P1XA 2DSYA 3OTOE 1KYQA 2DRPA 2EM3A 2UUCE 1X6FA 1T38A 3THOB 2CSHA 2EN8A 4J8ZA 2HHHE 2GHFA 2RS6A 2CT1A 2ODRC 5DNYA 2VRDA 4HEIA 2EM5A 2LMZA 2I13A 2VQFE 2UXBE 2RQLA 4GZNC 3IWCA 2LUQA 4B3SE 3C4BA 4X64E 5FLXC 2LO3A 4P7DA 4L5NC 2WBTA 2YTJA 1T4OA 2YTOA 2YTPA 2EN4A 4R03A 2E72A 2ELZA 4TUIA 2F8BA 2BB8A 5LL6R 2EL6A 2VQEE 3THNA 1IBKE 4DV7E 2M4IA 1DQ3A 3AUZA 4AQYE 4HTGA 4WSGA 2B9DA 4IS1C 2EWLA 1RC7A 2NUGA 2UUAE 4LF7E 1XNRE 1KJKA 1YZ9A 4K0KE 3DJWA 5F3WA 2EM6A 4KWYA 2D9HA 5CFFE 3C6KA 1T4NA 5LMNE 4B3RE 2NABA 4BBYA 4YY3E 2ZM6E 4LFBE 1PDAA 4LF9E 1YYKA 1EH6A 2Q8UA 1X49A 5A69A 4RHBB 2WBUA 3AV0A 4M9VC 2ADRA 2YTQA 2EM8A 2N8XA 1UBDC 4LTYA 2MKDA 2UXCE 1PJSA 4I8OA 4DV1E 5TSEA 1XMQE 2EMWA 4R2EA 2EMIA 2DMYA 2EMZA 1O0WA 1WXRA 3VYXA 1J26A 3EPKA 2CPNA 2DLQA 2EN2A 4LFCE 3F6HA 1A1JA 2RS7A 4R2DA 3EQ1A 4JI0E 2LT7A 4GKKE 4DUZE 2LBSB 1F2IG 4OX9E 4WYQB 3HPZA 5AC4A 2NUFA 1IQOA 4X9JA 1G2DC 5ADZA 1N33E 1HNZE 1GQEA 2EPUA 2EN1A 4BC7A 2B7VA 1YUIA 1TN9A 4L8NA 3EPJA 1NEIA 4MLQA 2KONA 4WFTA 4Q35B 4JI6E 2EOEA 3VK6A 2LE2A 2EOQA 2EORA 3ADLA 3H09A 4F2JC 2EMHA 2EMYA 4FK5C 2EL4A 2LJUA 3QG5C 2R76A 5KL5A 4F9CB 2I9IA 1YYWA 3ADIA 4ZYDA 3J7AG 1P47A 5A6AA 1FJGE 4X66E 3ADGA 4LFAE 2YRKA 2HC5A 2EN7A 2LCEA 5T6JA 5A2QC 1ZAAC 1BB8A 1X6EA 4M2ZA 1EH8A 2EQ1A 2KHXA 1WHQA 1QU6A 2YTNA 3KWRA 2PRTA 4WXCA 3HQ1A 4DKKA 2HGHA 3HXLA 3HTXA 1YUJA 1SR9A 3UK3C 2EPMX 4B3ME 2EOXA 3ECRA 2CTDA 4MLVA 2EE8A 2EOFA 3KZYA 4Q28A 1SFEA 4JYAE 1TF6A 3IWBA 4R2CA 2L33A 2J7JA 1N32E 1ZBQA 2EM7A 2JY9A 2YRHA 2WZOA 2A25A 1UN6B 2EMCA 4DV3E 2H36X 3ADJA 1A1HA 1RQ0A 3T1HE 2YSOA 2V85A 2MC5A 2YTEA 1IBME 5AASA 1MGTA 5IT9C 1DI2A 1UHZA 2FV4B 4TUGA 1MEYC 1YPNA 5IV8B 4LF6E 1ZBTA 2JOBA 4KZSA 2EM9A 2DLKA 1L4SA 2JWOA 1BBGA 4BC9A 4JV5E 2EZ6A 2EOOA 1PKPA 2YWQA 4F9BB 3J7Yp 2EMXA 2RTXA 3C6MA 3JTZA 1EKZA 1WJPA 2EQ3A 1EH7A 3JAMC 2GLIA 4NZVA 1X3CA 4F6MA 2EP3A 4LU9A 4BS9A 5IWAE 3J81C 2WCC3 2EPXA 3LLHA 2E5LE 2YTGA 1G2FC 2UUBE 1JK1A 4R2QA 1YYOA 1J5EE 3BBGA 1AAYA 2M7QA 2EM0A 5AE3A 2LJHA 4BCAA 4JI5E 4O5GA 1A1IA 5LMUE 3JU0A 2L3JA 3DF6A 2EQ0A 2LTSA 2ODRD 1DGCA 2EMKA 2EOZA 4O43A 1B69A 2EMBA 4JI2E 2M1SA 3VYYA 4JI1E 1FKAE 4GKJE 2EL5A 3LMLA 2L3CA 2YRMA 4NHRA 2VF1A 3RMPA 2YTIA 3M99B 4YHHE 2YSPA 3K6QA 1HNWE 1XMOE 3T1YE 3MHSC 2DMIA 2EJ4A 1YFHA 2LV2A 2ENAA 4DR1E 4LF8E 2EN6A 2V88A 3IWDA 3MHHC 2FTXB 4WPYA 2V86A 2RPCA 2MKNA 1ZU1A 2V8QB 5LLQA 1PJTA 2MDRA 5KL7A 4ZYGA 2EOMA 4F54A 4DR7E 2M9AA 2JR1A 2L2MA 2V83A 2UXDE 4R2AA 4IJDA 2G7HA 2NA2A 2YZTA 4O4KA 3BIDA 4DUYE 1X47A 1A1KA 1A1FA 2L92A 4JI4E 2DB2A 2VE7C
chains in the Genus database with same CATH topology
1Z1BA 3EPKA 3EPLA 2EPCA 1RMDA 4R2PA 2DLQA 2EN2A 1A1LA 2EOYA 1A1JA 2EM9A 2DLKA 4R2DA 1A1GA 2EOJA 4R2SA 2YTFA 3VHTB 2MDGA 5KL2A 5KL6A 2LT7A 2EMGA 2EMXA 1X6HA 2EPAA 2RSIA 1F2IG 2R1FA 1WJPA 2EQ3A 2EMLA 4X9JA 1G2DC 2EOIA 2GLIA 1X3CA 4F6MA 2EP3A 2EPUA 2EN1A 1YUIA 2WCC3 1ZR9A 1TN9A 2EPXA 2EM3A 2DRPA 5KL4A 3EPJA 1X6FA 2ENCA 2ELYA 2EOEA 2CSHA 2EN8A 2YTGA 1G2FC 2GHFA 2EN3A 1JK1A 2CT1A 2JP9A 2EOQA 2EORA 4R2QA 4R2RA 1AAYA 4F2JC 2VRDA 2EMAA 2EMHA 2EM0A 2EMYA 4FK5C 2EM5A 2EL4A 1JK2A 2I13A 1A1IA 2ENHA 4GZNC 5KL5A 2EQ0A 1P47A 1DGCA 2EMKA 2EOZA 1B69A 2EMBA 1X5WA 2LO3A 2YRKA 2EN7A 2LCEA 2WBTA 2YTJA 1ZAAC 1BB8A 2EOHA 1X6EA 2YTOA 2EL5A 2YTPA 1NCSA 2EN4A 2EQ1A 2E72A 2ELZA 2BB8A 2EL6A 2YU8A 1TF3A 2EPZA 2YTNA 2YRMA 2EM4A 2EM2A 2EMFA 2YTIA 2PRTA 4F6NA 3M99B 2YTDA 2YSPA 4WSGA 3EPHA 2HGHA 4IS1C 1YUJA 2EPRA 1KJKA 3UK3C 3MHSC 2YU5A 2WBSA 2DMIA 2EJ4A 2EM6A 2D9HA 2EOXA 2CTDA 2EE8A 2EOFA 2LV2A 2ENAA 1TF6A 4R2CA 2NABA 2EN6A 3MHHC 2LVHA 2J7JA 2RPCA 2MKNA 1ZU1A 2EM7A 2WBUA 2EPPA 4M9VC 2ADRA 2YRHA 1LLMC 2YTQA 5KL3A 2EM8A 1UBDC 2A25A 2MKDA 1YSAC 1UN6B 1BBOA 5KL7A 2EMCA 2EOMA 2DGCA 2M9AA 2EOSA 2JPAA 4R2AA 1A1HA 2EMWA 4R2EA 4IJDA 2EMIA 2YSOA 2EMZA 1A1FA 1A1KA 2YTEA 1MEYC 2EOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  3EPK A;  3EPL A;  2EPC A;  1RMD A;  4R2P A;  2DLQ A;  2EN2 A;  1A1L A;  2EOY A;  1A1J A;  2EM9 A;  2DLK A;  4R2D A;  1A1G A;  2EOJ A;  4R2S A;  2YTF A;  3VHT B;  2MDG A;  5KL2 A;  5KL6 A;  2LT7 A;  2EMG A;  2EMX A;  1X6H A;  2EPA A;  2RSI A;  1F2I G;  2R1F A;  1WJP A;  2EQ3 A;  2EML A;  4X9J A;  1G2D C;  2EOI A;  2GLI A;  1X3C A;  4F6M A;  2EP3 A;  2EPU A;  2EN1 A;  1YUI A;  2WCC 3;  1ZR9 A;  1TN9 A;  2EPX A;  2EM3 A;  2DRP A;  5KL4 A;  3EPJ A;  1X6F A;  2ENC A;  2ELY A;  2EOE A;  2CSH A;  2EN8 A;  2YTG A;  1G2F C;  2GHF A;  2EN3 A;  1JK1 A;  2CT1 A;  2JP9 A;  2EOQ A;  2EOR A;  4R2Q A;  4R2R A;  1AAY A;  4F2J C;  2VRD A;  2EMA A;  2EMH A;  2EM0 A;  2EMY A;  4FK5 C;  2EM5 A;  2EL4 A;  1JK2 A;  2I13 A;  1A1I A;  2ENH A;  4GZN C;  5KL5 A;  2EQ0 A;  1P47 A;  1DGC A;  2EMK A;  2EOZ A;  1B69 A;  2EMB A;  1X5W A;  2LO3 A;  2YRK A;  2EN7 A;  2LCE A;  2WBT A;  2YTJ A;  1ZAA C;  1BB8 A;  2EOH A;  1X6E A;  2YTO A;  2EL5 A;  2YTP A;  1NCS A;  2EN4 A;  2EQ1 A;  2E72 A;  2ELZ A;  2BB8 A;  2EL6 A;  2YU8 A;  1TF3 A;  2EPZ A;  2YTN A;  2YRM A;  2EM4 A;  2EM2 A;  2EMF A;  2YTI A;  2PRT A;  4F6N A;  3M99 B;  2YTD A;  2YSP A;  4WSG A;  3EPH A;  2HGH A;  4IS1 C;  1YUJ A;  2EPR A;  1KJK A;  3UK3 C;  3MHS C;  2YU5 A;  2WBS A;  2DMI A;  2EJ4 A;  2EM6 A;  2D9H A;  2EOX A;  2CTD A;  2EE8 A;  2EOF A;  2LV2 A;  2ENA A;  1TF6 A;  4R2C A;  2NAB A;  2EN6 A;  3MHH C;  2LVH A;  2J7J A;  2RPC A;  2MKN A;  1ZU1 A;  2EM7 A;  2WBU A;  2EPP A;  4M9V C;  2ADR A;  2YRH A;  1LLM C;  2YTQ A;  5KL3 A;  2EM8 A;  1UBD C;  2A25 A;  2MKD A;  1YSA C;  1UN6 B;  1BBO A;  5KL7 A;  2EMC A;  2EOM A;  2DGC A;  2M9A A;  2EOS A;  2JPA A;  4R2A A;  1A1H A;  2EMW A;  4R2E A;  4IJD A;  2EMI A;  2YSO A;  2EMZ A;  1A1F A;  1A1K A;  2YTE A;  1MEY C;  2EOO A; 
#chains in the Genus database with same CATH topology
 2YT4 A;  1Z1B A;  5AE1 A;  2F4V E;  1QNT A;  1A1L A;  2EOY A;  2K4V A;  1GZ6 A;  2JVA A;  2EOJ A;  4R2S A;  2YTF A;  3VHT B;  2MDG A;  2UU9 E;  5KL2 A;  5KL6 A;  1XNQ E;  3HPS A;  3C4T A;  2E1M A;  2K7I A;  4JI8 E;  1N36 E;  1WHN A;  4O24 A;  4LF4 E;  2R1F A;  1STU A;  2EML A;  2EOI A;  2EPL X;  4DV6 E;  1N34 E;  1IBL E;  4OOG C;  1PJQ A;  3J80 C;  2B3T B;  4DV0 E;  1ZR9 A;  2BBG A;  5A6K A;  5IXM B;  5KL4 A;  2ENC A;  4ZYH A;  1UIL A;  4DV5 E;  1N3G A;  2ELY A;  2N3G A;  4DV2 E;  2EPK X;  4P78 A;  2EN3 A;  2KOU A;  2JP9 A;  4R2R A;  5A6B D;  2EMA A;  1JK2 A;  1HR0 E;  2JOX A;  2ENH A;  2EPO A;  2FGG A;  4DMI A;  1I94 E;  4GEQ B;  4DV4 E;  4DR2 E;  1X5W A;  4F9A B;  2DIX A;  2V89 A;  2EOH A;  2YPN A;  4WXD A;  1NCS A;  2L6M A;  2N3H A;  5A6J A;  2LUP B;  4LF5 E;  2YU8 A;  1TF3 A;  1T39 A;  4NXM E;  2EPZ A;  3ZOQ B;  1T4L B;  2JYA A;  2EM4 A;  2EM2 A;  2EMF A;  4NXN E;  4N4R B;  4F6N A;  2YTD A;  1GTK A;  4BHC A;  2L2N A;  3KZZ A;  4DR6 E;  3EPH A;  2NUE A;  4DR4 E;  2B7T A;  4BMJ A;  5A6B A;  4X8W A;  3L00 A;  2EPR A;  2EPN A;  2YU5 A;  2WBS A;  2LRS A;  3TQM A;  4X65 E;  3F6G A;  4KHP E;  1X48 A;  4DR5 E;  3MSW A;  2LVH A;  3BF2 A;  2EPP A;  4RH8 A;  4X62 E;  1LLM C;  2RSM A;  5KL3 A;  1BBO A;  1YSA C;  2L8T A;  3OML A;  4JI7 E;  2L2K B;  2DGC A;  4ZYE A;  2EOS A;  5AC5 A;  2JPA A;  2JXP A;  4B3T E;  4WSP A;  1AH5 A;  1IMU A;  3EPL A;  2EPC A;  1RMD A;  4R2P A;  4M30 A;  2GPI A;  2V87 A;  1HNX E;  4M0V A;  1IQS A;  4R8O A;  1A1G A;  2IHR 1;  2LTR A;  5AE2 A;  3FIG A;  3BGH A;  2EMG A;  4JI3 E;  1X6H A;  2EPA A;  2RSI A;  4DR3 E;  1WRJ A;  4WX9 A;  2HJJ A;  2MC6 A;  4BHB A;  5BR8 E;  3P1X A;  2DSY A;  3OTO E;  1KYQ A;  2DRP A;  2EM3 A;  2UUC E;  1X6F A;  1T38 A;  3THO B;  2CSH A;  2EN8 A;  4J8Z A;  2HHH E;  2GHF A;  2RS6 A;  2CT1 A;  2ODR C;  5DNY A;  2VRD A;  4HEI A;  2EM5 A;  2LMZ A;  2I13 A;  2VQF E;  2UXB E;  2RQL A;  4GZN C;  3IWC A;  2LUQ A;  4B3S E;  3C4B A;  4X64 E;  5FLX C;  2LO3 A;  4P7D A;  4L5N C;  2WBT A;  2YTJ A;  1T4O A;  2YTO A;  2YTP A;  2EN4 A;  4R03 A;  2E72 A;  2ELZ A;  4TUI A;  2F8B A;  2BB8 A;  5LL6 R;  2EL6 A;  2VQE E;  3THN A;  1IBK E;  4DV7 E;  2M4I A;  1DQ3 A;  3AUZ A;  4AQY E;  4HTG A;  4WSG A;  2B9D A;  4IS1 C;  2EWL A;  1RC7 A;  2NUG A;  2UUA E;  4LF7 E;  1XNR E;  1KJK A;  1YZ9 A;  4K0K E;  3DJW A;  5F3W A;  2EM6 A;  4KWY A;  2D9H A;  5CFF E;  3C6K A;  1T4N A;  5LMN E;  4B3R E;  2NAB A;  4BBY A;  4YY3 E;  2ZM6 E;  4LFB E;  1PDA A;  4LF9 E;  1YYK A;  1EH6 A;  2Q8U A;  1X49 A;  5A69 A;  4RHB B;  2WBU A;  3AV0 A;  4M9V C;  2ADR A;  2YTQ A;  2EM8 A;  2N8X A;  1UBD C;  4LTY A;  2MKD A;  2UXC E;  1PJS A;  4I8O A;  4DV1 E;  5TSE A;  1XMQ E;  2EMW A;  4R2E A;  2EMI A;  2DMY A;  2EMZ A;  1O0W A;  1WXR A;  3VYX A;  1J26 A;  3EPK A;  2CPN A;  2DLQ A;  2EN2 A;  4LFC E;  3F6H A;  1A1J A;  2RS7 A;  4R2D A;  3EQ1 A;  4JI0 E;  2LT7 A;  4GKK E;  4DUZ E;  2LBS B;  1F2I G;  4OX9 E;  4WYQ B;  3HPZ A;  5AC4 A;  2NUF A;  1IQO A;  4X9J A;  1G2D C;  5ADZ A;  1N33 E;  1HNZ E;  1GQE A;  2EPU A;  2EN1 A;  4BC7 A;  2B7V A;  1YUI A;  1TN9 A;  4L8N A;  3EPJ A;  1NEI A;  4MLQ A;  2KON A;  4WFT A;  4Q35 B;  4JI6 E;  2EOE A;  3VK6 A;  2LE2 A;  2EOQ A;  2EOR A;  3ADL A;  3H09 A;  4F2J C;  2EMH A;  2EMY A;  4FK5 C;  2EL4 A;  2LJU A;  3QG5 C;  2R76 A;  5KL5 A;  4F9C B;  2I9I A;  1YYW A;  3ADI A;  4ZYD A;  3J7A G;  1P47 A;  5A6A A;  1FJG E;  4X66 E;  3ADG A;  4LFA E;  2YRK A;  2HC5 A;  2EN7 A;  2LCE A;  5T6J A;  5A2Q C;  1ZAA C;  1BB8 A;  1X6E A;  4M2Z A;  1EH8 A;  2EQ1 A;  2KHX A;  1WHQ A;  1QU6 A;  2YTN A;  3KWR A;  2PRT A;  4WXC A;  3HQ1 A;  4DKK A;  2HGH A;  3HXL A;  3HTX A;  1YUJ A;  1SR9 A;  3UK3 C;  2EPM X;  4B3M E;  2EOX A;  3ECR A;  2CTD A;  4MLV A;  2EE8 A;  2EOF A;  3KZY A;  4Q28 A;  1SFE A;  4JYA E;  1TF6 A;  3IWB A;  4R2C A;  2L33 A;  2J7J A;  1N32 E;  1ZBQ A;  2EM7 A;  2JY9 A;  2YRH A;  2WZO A;  2A25 A;  1UN6 B;  2EMC A;  4DV3 E;  2H36 X;  3ADJ A;  1A1H A;  1RQ0 A;  3T1H E;  2YSO A;  2V85 A;  2MC5 A;  2YTE A;  1IBM E;  5AAS A;  1MGT A;  5IT9 C;  1DI2 A;  1UHZ A;  2FV4 B;  4TUG A;  1MEY C;  1YPN A;  5IV8 B;  4LF6 E;  1ZBT A;  2JOB A;  4KZS A;  2EM9 A;  2DLK A;  1L4S A;  2JWO A;  1BBG A;  4BC9 A;  4JV5 E;  2EZ6 A;  2EOO A;  1PKP A;  2YWQ A;  4F9B B;  3J7Y p;  2EMX A;  2RTX A;  3C6M A;  3JTZ A;  1EKZ A;  1WJP A;  2EQ3 A;  1EH7 A;  3JAM C;  2GLI A;  4NZV A;  1X3C A;  4F6M A;  2EP3 A;  4LU9 A;  4BS9 A;  5IWA E;  3J81 C;  2WCC 3;  2EPX A;  3LLH A;  2E5L E;  2YTG A;  1G2F C;  2UUB E;  1JK1 A;  4R2Q A;  1YYO A;  1J5E E;  3BBG A;  1AAY A;  2M7Q A;  2EM0 A;  5AE3 A;  2LJH A;  4BCA A;  4JI5 E;  4O5G A;  1A1I A;  5LMU E;  3JU0 A;  2L3J A;  3DF6 A;  2EQ0 A;  2LTS A;  2ODR D;  1DGC A;  2EMK A;  2EOZ A;  4O43 A;  1B69 A;  2EMB A;  4JI2 E;  2M1S A;  3VYY A;  4JI1 E;  1FKA E;  4GKJ E;  2EL5 A;  3LML A;  2L3C A;  2YRM A;  4NHR A;  2VF1 A;  3RMP A;  2YTI A;  3M99 B;  4YHH E;  2YSP A;  3K6Q A;  1HNW E;  1XMO E;  3T1Y E;  3MHS C;  2DMI A;  2EJ4 A;  1YFH A;  2LV2 A;  2ENA A;  4DR1 E;  4LF8 E;  2EN6 A;  2V88 A;  3IWD A;  3MHH C;  2FTX B;  4WPY A;  2V86 A;  2RPC A;  2MKN A;  1ZU1 A;  2V8Q B;  5LLQ A;  1PJT A;  2MDR A;  5KL7 A;  4ZYG A;  2EOM A;  4F54 A;  4DR7 E;  2M9A A;  2JR1 A;  2L2M A;  2V83 A;  2UXD E;  4R2A A;  4IJD A;  2G7H A;  2NA2 A;  2YZT A;  4O4K A;  3BID A;  4DUY E;  1X47 A;  1A1K A;  1A1F A;  2L92 A;  4JI4 E;  2DB2 A;  2VE7 C; 
#chains in the Genus database with same CATH homology
 1Z1B A;  3EPK A;  3EPL A;  2EPC A;  1RMD A;  4R2P A;  2DLQ A;  2EN2 A;  1A1L A;  2EOY A;  1A1J A;  2EM9 A;  2DLK A;  4R2D A;  1A1G A;  2EOJ A;  4R2S A;  2YTF A;  3VHT B;  2MDG A;  5KL2 A;  5KL6 A;  2LT7 A;  2EMG A;  2EMX A;  1X6H A;  2EPA A;  2RSI A;  1F2I G;  2R1F A;  1WJP A;  2EQ3 A;  2EML A;  4X9J A;  1G2D C;  2EOI A;  2GLI A;  1X3C A;  4F6M A;  2EP3 A;  2EPU A;  2EN1 A;  1YUI A;  2WCC 3;  1ZR9 A;  1TN9 A;  2EPX A;  2EM3 A;  2DRP A;  5KL4 A;  3EPJ A;  1X6F A;  2ENC A;  2ELY A;  2EOE A;  2CSH A;  2EN8 A;  2YTG A;  1G2F C;  2GHF A;  2EN3 A;  1JK1 A;  2CT1 A;  2JP9 A;  2EOQ A;  2EOR A;  4R2Q A;  4R2R A;  1AAY A;  4F2J C;  2VRD A;  2EMA A;  2EMH A;  2EM0 A;  2EMY A;  4FK5 C;  2EM5 A;  2EL4 A;  1JK2 A;  2I13 A;  1A1I A;  2ENH A;  4GZN C;  5KL5 A;  2EQ0 A;  1P47 A;  1DGC A;  2EMK A;  2EOZ A;  1B69 A;  2EMB A;  1X5W A;  2LO3 A;  2YRK A;  2EN7 A;  2LCE A;  2WBT A;  2YTJ A;  1ZAA C;  1BB8 A;  2EOH A;  1X6E A;  2YTO A;  2EL5 A;  2YTP A;  1NCS A;  2EN4 A;  2EQ1 A;  2E72 A;  2ELZ A;  2BB8 A;  2EL6 A;  2YU8 A;  1TF3 A;  2EPZ A;  2YTN A;  2YRM A;  2EM4 A;  2EM2 A;  2EMF A;  2YTI A;  2PRT A;  4F6N A;  3M99 B;  2YTD A;  2YSP A;  4WSG A;  3EPH A;  2HGH A;  4IS1 C;  1YUJ A;  2EPR A;  1KJK A;  3UK3 C;  3MHS C;  2YU5 A;  2WBS A;  2DMI A;  2EJ4 A;  2EM6 A;  2D9H A;  2EOX A;  2CTD A;  2EE8 A;  2EOF A;  2LV2 A;  2ENA A;  1TF6 A;  4R2C A;  2NAB A;  2EN6 A;  3MHH C;  2LVH A;  2J7J A;  2RPC A;  2MKN A;  1ZU1 A;  2EM7 A;  2WBU A;  2EPP A;  4M9V C;  2ADR A;  2YRH A;  1LLM C;  2YTQ A;  5KL3 A;  2EM8 A;  1UBD C;  2A25 A;  2MKD A;  1YSA C;  1UN6 B;  1BBO A;  5KL7 A;  2EMC A;  2EOM A;  2DGC A;  2M9A A;  2EOS A;  2JPA A;  4R2A A;  1A1H A;  2EMW A;  4R2E A;  4IJD A;  2EMI A;  2YSO A;  2EMZ A;  1A1F A;  1A1K A;  2YTE A;  1MEY C;  2EOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...