2EOQA

Solution structure of the c2h2 type zinc finger (region 283-315) of human zinc finger protein 224
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPFKCDICGKSFCGRSRLNRHSMVHTAEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 283-315) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoqA01
2EN6A 2BB8A 2WBUA 2MKNA 4R2QA 2EPXA 2RPCA 2YTEA 2VRDA 2LVHA 2YRKA 3UK3C 1TN9A 2DLKA 2EM3A 3EPHA 3MHSC 2LCEA 1A1LA 2YTDA 1RMDA 1UBDC 2EM7A 3EPLA 1G2FC 2EOSA 2DLQA 1LLMC 2YSOA 3EPKA 4F2JC 2CT1A 1A1FA 2E72A 1ZU1A 2EMBA 2D9HA 2CTDA 2EOJA 5KL6A 4GZNC 1YUIA 2EOEA 2EQ0A 2EM0A 3M99B 4R2PA 2EOQA 1TF3A 1A1KA 2ELYA 2YU5A 2JPAA 1F2IG 2GHFA 2YTGA 4R2CA 2EMKA 1A1IA 2JP9A 2EMGA 5KL3A 2EMIA 5KL4A 1X6EA 1JK2A 2DRPA 1ZAAC 2EMHA 2EORA 2EE8A 2M9AA 2A25A 2MKDA 4FK5C 2EMFA 2EM8A 3VHTB 1JK1A 1KJKA 2RSIA 1A1HA 1MEYC 2EOOA 2EOFA 4IS1C 2EPCA 4R2AA 2EJ4A 4R2EA 4M9VC 2EMWA 2CSHA 2YTIA 1WJPA 1A1GA 2YTJA 2ELZA 2EOZA 2YTOA 2EPRA 2YRMA 2EM6A 4R2RA 2EM9A 2J7JA 2YU8A 3MHHC 2EPZA 1YUJA 4WSGA 2EN4A 2EN1A 2EN8A 2EM2A 2LT7A 2EN7A 2EMLA 1UN6B 1P47A 2YSPA 4F6MA 1AAYA 2EMAA 1Z1BA 1B69A 2YTQA 1TF6A 2EPAA 2EN2A 2EOYA 2ENAA 2DGCA 2EOXA 2EPPA 1A1JA 4R2DA 5KL7A 2EL4A 2EMXA 2EOHA 1G2DC 2YTNA 2HGHA 1NCSA 2EMYA 1X6FA 2EPUA 3EPJA 2EMZA 2YRHA 2EM4A 2EN3A 1X5WA 2EM5A 5KL2A 1X6HA 2PRTA 2WBSA 2ENCA 2EL5A 4IJDA 2ADRA 4R2SA 2I13A 2DMIA 2MDGA 2EP3A 1X3CA 2NABA 1BBOA 1DGCA 2EMCA 2EQ1A 2EQ3A 4F6NA 2R1FA 1YSAC 2ENHA 2GLIA 2WCC3 2WBTA 2LV2A 2EL6A 2EOMA 1ZR9A 4X9JA 1BB8A 2YTPA 5KL5A 2LO3A 2YTFA 2EOIA
chains in the Genus database with same CATH superfamily
1N32E 4YHHE 5AC4A 1YYWA 4LFBE 4F54A 4L8NA 2DB2A 1ZBTA 5LL6R 4KZSA 4OOGC 1TN9A 2VQEE 1DI2A 1XNQE 2LCEA 4ZYGA 5CFFE 4DR3E 4BMJA 1LLMC 5AE3A 2EWLA 2LMZA 1WXRA 4RH8A 2CT1A 2V8QB 3HPZA 2E72A 2EMBA 5ADZA 4DR6E 2CTDA 2IHR1 2M7QA 3OTOE 4X66E 4R2PA 2EOQA 3ADJA 2JPAA 1EH8A 5A6BA 2GHFA 3KZZA 4DUZE 1A1IA 1HNXE 2L6MA 4JI3E 1N36E 2EMGA 3HXLA 5KL3A 4JI6E 1JK2A 4Q28A 2JOXA 2JXPA 2EMHA 2MC6A 2RS7A 1KJKA 2RSIA 1A1HA 2EOOA 4BS9A 2V89A 4R2AA 5FLXC 4B3RE 4F9AB 2HJJA 5F3WA 1STUA 2EPRA 2YRMA 4TUGA 4R2RA 1HNWE 2JYAA 2YU8A 2EPZA 2UXDE 2NUFA 2EPOA 2JWOA 1NEIA 2EN4A 2NA2A 2JR1A 4R8OA 2EN7A 2RTXA 5A6KA 4DR1E 4X65E 4F6MA 2EPLX 5A69A 2YTQA 2NUEA 1T4NA 1DQ3A 4TUIA 1X6FA 5DNYA 2L3CA 3F6HA 2EM4A 1I94E 2EN3A 4DV2E 1X5WA 1O0WA 5KL2A 3BBGA 2L2NA 2YT4A 3MSWA 4R2SA 4B3SE 1N3GA 3T1YE 2DMIA 1T4LB 2K7IA 1X3CA 1IQSA 1DGCA 1BBGA 2L92A 4DV4E 3AUZA 2DIXA 5AASA 2WCC3 4BC9A 2EL6A 2G7HA 4DV6E 1BB8A 4X9JA 2YTPA 2LO3A 2EMFA 4WPYA 3VYXA 2BB8A 2MKNA 2ZM6E 3IWBA 2EPKX 2LVHA 1HNZE 5IT9C 4GKKE 3QG5C 1YPNA 2YTDA 4WYQB 5A6JA 1N33E 2EOSA 4ZYDA 2Q8UA 2VF1A 4BC7A 2YSOA 4M0VA 1YYOA 4LF6E 1QU6A 2YZTA 1ZU1A 5KL6A 4GZNC 2RQLA 5AE2A 2EOEA 3BF2A 2ELYA 2YU5A 2N3GA 3IWCA 4MLQA 2F8BA 5LLQA 2KOUA 1IMUA 2BBGA 2EMKA 1HR0E 2MC5A 2LTSA 2UUAE 2LTRA 3AV0A 4DMIA 4NXME 2EORA 2EE8A 4ZYEA 2A25A 2EM8A 3ADGA 1SR9A 4J8ZA 1MEYC 2EOFA 3JAMC 1RQ0A 4M9VC 4P78A 2CPNA 2EPNA 2YTJA 2EOZA 2EM6A 2UXCE 1SFEA 3OMLA 2I9IA 4WX9A 3JTZA 4WSGA 3P1XA 2EM2A 4O24A 1IQOA 2EMLA 2VE7C 2L2KB 2LE2A 1IBME 3HTXA 2HC5A 2EPAA 1FKAE 2F4VE 2HHHE 1T38A 4L5NC 2EOXA 2EPPA 2EL4A 1G2DC 5T6JA 3J7AG 4NXNE 2EMYA 4BCAA 4NHRA 2YRHA 1UHZA 4JYAE 3BGHA 1MGTA 5LMUE 4GKJE 2ENCA 1X48A 4IJDA 2ADRA 4B3ME 1YFHA 2LRSA 2B9DA 1X47A 4M2ZA 3F6GA 4F6NA 2R1FA 1YSAC 2L33A 3IWDA 5AE1A 2LV2A 5IXMB 5KL5A 3L00A 2YTFA 2DSYA 2YTGA 4P7DA 1T39A 2UUCE 2WBUA 4MLVA 4JI7E 2EPXA 1QNTA 2V88A 2VRDA 3UK3C 2H36X 2GPIA 2DLKA 5BR8E 3MHSC 4Q35B 1XMQE 1UBDC 4HEIA 1PJTA 1G2FC 2DLQA 2ODRC 2K4VA 1J26A 4F2JC 1A1FA 4X64E 3J81C 1PJSA 1KYQA 2L3JA 3M99B 4DV5E 4DR2E 4B3TE 4DV1E 2YWQA 2YPNA 5A6AA 3LLHA 4F9CB 1UILA 4R2CA 4BHCA 3ADIA 2B3TB 2V85A 4JI2E 4YY3E 5KL4A 1X6EA 4RHBB 3J80C 2DRPA 2LUQA 4BHBA 1PJQA 3C4BA 4FK5C 4DV7E 3VHTB 2MKDA 1JK1A 4DV0E 4IS1C 2EMWA 2CSHA 2NUGA 1WHNA 3RMPA 2YTIA 3DF6A 3EQ1A 1A1GA 2YTOA 3T1HE 2E5LE 2EM9A 2EZ6A 2J7JA 3KWRA 3MHHC 1YUJA 3THNA 2EN1A 2EN8A 3DJWA 4X62E 1UN6B 2YSPA 1YYKA 2EMAA 1TF6A 2L8TA 4WFTA 2ENAA 2DGCA 4LFAE 5KL7A 4DUYE 5AC5A 2JOBA 1WHQA 2EOHA 2YTNA 1EH7A 5LMNE 4LU9A 4OX9E 2R76A 4HTGA 2EMZA 4JI1E 4DR5E 4LF5E 2EM5A 2WZOA 1X6HA 2WBSA 2MDRA 1IBKE 2N3HA 3TQMA 5TSEA 4F9BB 3VK6A 2I13A 2V83A 4JI4E 1BBOA 4LTYA 4KWYA 2EQ1A 3BIDA 4I8OA 2EQ3A 1FJGE 1PKPA 5A6BD 2LUPB 2GLIA 3H09A 3VYYA 4N4RB 2DMYA 4LF9E 2LJHA 1ZR9A 2EOIA 2EPMX 2EN6A 2V86A 4X8WA 1XNRE 1L4SA 4R2QA 2RPCA 3C6MA 4O43A 3HQ1A 2YTEA 4K0KE 2YRKA 2E1MA 1T4OA 2EM3A 4JI5E 4DR4E 2UXBE 3EPHA 2B7TA 4ZYHA 3C6KA 1A1LA 1RMDA 2FTXB 2EM7A 3EPLA 3LMLA 4WSPA 1WRJA 2JY9A 3EPKA 2FGGA 2D9HA 2ODRD 2EOJA 1YUIA 4O5GA 2EQ0A 2EM0A 3J7Yp 1N34E 2LJUA 1TF3A 1A1KA 1XMOE 5IV8B 1F2IG 1AH5A 2JP9A 1X49A 3K6QA 2EMIA 3FIGA 4LFCE 1ZAAC 4KHPE 1GTKA 2LBSB 2M9AA 2V87A 1GQEA 3JU0A 4DKKA 4LF4E 2EPCA 2EJ4A 4R2EA 1EKZA 5A2QC 2N8XA 4R03A 4DR7E 1WJPA 2B7VA 2RS6A 4WXCA 4BBYA 2ELZA 3KZYA 2VQFE 2UUBE 4NZVA 2LT7A 4WXDA 4JV5E 2L2MA 1P47A 4JI8E 1AAYA 2FV4B 2KONA 1Z1BA 1B69A 4LF7E 2EN2A 2UU9E 1EH6A 2EOYA 3HPSA 3ZOQB 3C4TA 1A1JA 4R2DA 1RC7A 4JI0E 2EMXA 1IBLE 2HGHA 1NCSA 3ADLA 5IWAE 1PDAA 2EPUA 3EPJA 3ECRA 4AQYE 4DV3E 2PRTA 2EL5A 1ZBQA 4LF8E 4GEQB 1GZ6A 2MDGA 2EP3A 1YZ9A 2NABA 2EMCA 2JVAA 2M1SA 3THOB 2KHXA 2ENHA 1J5EE 2M4IA 2WBTA 2RSMA 4O4KA 2EOMA 4M30A
chains in the Genus database with same CATH topology
2EN6A 2BB8A 2WBUA 2MKNA 4R2QA 2EPXA 2RPCA 2YTEA 2VRDA 2LVHA 2YRKA 3UK3C 1TN9A 2DLKA 2EM3A 3EPHA 3MHSC 2LCEA 1A1LA 2YTDA 1RMDA 1UBDC 2EM7A 3EPLA 1G2FC 2EOSA 2DLQA 1LLMC 2YSOA 3EPKA 4F2JC 2CT1A 1A1FA 2E72A 1ZU1A 2EMBA 2D9HA 2CTDA 2EOJA 5KL6A 4GZNC 1YUIA 2EOEA 2EQ0A 2EM0A 3M99B 4R2PA 2EOQA 1TF3A 1A1KA 2ELYA 2YU5A 2JPAA 1F2IG 2GHFA 2YTGA 4R2CA 2EMKA 1A1IA 2JP9A 2EMGA 5KL3A 2EMIA 5KL4A 1X6EA 1JK2A 2DRPA 1ZAAC 2EMHA 2EORA 2EE8A 2M9AA 2A25A 2MKDA 4FK5C 2EMFA 2EM8A 3VHTB 1JK1A 1KJKA 2RSIA 1A1HA 1MEYC 2EOOA 2EOFA 4IS1C 2EPCA 4R2AA 2EJ4A 4R2EA 4M9VC 2EMWA 2CSHA 2YTIA 1WJPA 1A1GA 2YTJA 2ELZA 2EOZA 2YTOA 2EPRA 2YRMA 2EM6A 4R2RA 2EM9A 2J7JA 2YU8A 3MHHC 2EPZA 1YUJA 4WSGA 2EN4A 2EN1A 2EN8A 2EM2A 2LT7A 2EN7A 2EMLA 1UN6B 1P47A 2YSPA 4F6MA 1AAYA 2EMAA 1Z1BA 1B69A 2YTQA 1TF6A 2EPAA 2EN2A 2EOYA 2ENAA 2DGCA 2EOXA 2EPPA 1A1JA 4R2DA 5KL7A 2EL4A 2EMXA 2EOHA 1G2DC 2YTNA 2HGHA 1NCSA 2EMYA 1X6FA 2EPUA 3EPJA 2EMZA 2YRHA 2EM4A 2EN3A 1X5WA 2EM5A 5KL2A 1X6HA 2PRTA 2WBSA 2ENCA 2EL5A 4IJDA 2ADRA 4R2SA 2I13A 2DMIA 2MDGA 2EP3A 1X3CA 2NABA 1BBOA 1DGCA 2EMCA 2EQ1A 2EQ3A 4F6NA 2R1FA 1YSAC 2ENHA 2GLIA 2WCC3 2WBTA 2LV2A 2EL6A 2EOMA 1ZR9A 4X9JA 1BB8A 2YTPA 5KL5A 2LO3A 2YTFA 2EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN6 A;  2BB8 A;  2WBU A;  2MKN A;  4R2Q A;  2EPX A;  2RPC A;  2YTE A;  2VRD A;  2LVH A;  2YRK A;  3UK3 C;  1TN9 A;  2DLK A;  2EM3 A;  3EPH A;  3MHS C;  2LCE A;  1A1L A;  2YTD A;  1RMD A;  1UBD C;  2EM7 A;  3EPL A;  1G2F C;  2EOS A;  2DLQ A;  1LLM C;  2YSO A;  3EPK A;  4F2J C;  2CT1 A;  1A1F A;  2E72 A;  1ZU1 A;  2EMB A;  2D9H A;  2CTD A;  2EOJ A;  5KL6 A;  4GZN C;  1YUI A;  2EOE A;  2EQ0 A;  2EM0 A;  3M99 B;  4R2P A;  2EOQ A;  1TF3 A;  1A1K A;  2ELY A;  2YU5 A;  2JPA A;  1F2I G;  2GHF A;  2YTG A;  4R2C A;  2EMK A;  1A1I A;  2JP9 A;  2EMG A;  5KL3 A;  2EMI A;  5KL4 A;  1X6E A;  1JK2 A;  2DRP A;  1ZAA C;  2EMH A;  2EOR A;  2EE8 A;  2M9A A;  2A25 A;  2MKD A;  4FK5 C;  2EMF A;  2EM8 A;  3VHT B;  1JK1 A;  1KJK A;  2RSI A;  1A1H A;  1MEY C;  2EOO A;  2EOF A;  4IS1 C;  2EPC A;  4R2A A;  2EJ4 A;  4R2E A;  4M9V C;  2EMW A;  2CSH A;  2YTI A;  1WJP A;  1A1G A;  2YTJ A;  2ELZ A;  2EOZ A;  2YTO A;  2EPR A;  2YRM A;  2EM6 A;  4R2R A;  2EM9 A;  2J7J A;  2YU8 A;  3MHH C;  2EPZ A;  1YUJ A;  4WSG A;  2EN4 A;  2EN1 A;  2EN8 A;  2EM2 A;  2LT7 A;  2EN7 A;  2EML A;  1UN6 B;  1P47 A;  2YSP A;  4F6M A;  1AAY A;  2EMA A;  1Z1B A;  1B69 A;  2YTQ A;  1TF6 A;  2EPA A;  2EN2 A;  2EOY A;  2ENA A;  2DGC A;  2EOX A;  2EPP A;  1A1J A;  4R2D A;  5KL7 A;  2EL4 A;  2EMX A;  2EOH A;  1G2D C;  2YTN A;  2HGH A;  1NCS A;  2EMY A;  1X6F A;  2EPU A;  3EPJ A;  2EMZ A;  2YRH A;  2EM4 A;  2EN3 A;  1X5W A;  2EM5 A;  5KL2 A;  1X6H A;  2PRT A;  2WBS A;  2ENC A;  2EL5 A;  4IJD A;  2ADR A;  4R2S A;  2I13 A;  2DMI A;  2MDG A;  2EP3 A;  1X3C A;  2NAB A;  1BBO A;  1DGC A;  2EMC A;  2EQ1 A;  2EQ3 A;  4F6N A;  2R1F A;  1YSA C;  2ENH A;  2GLI A;  2WCC 3;  2WBT A;  2LV2 A;  2EL6 A;  2EOM A;  1ZR9 A;  4X9J A;  1BB8 A;  2YTP A;  5KL5 A;  2LO3 A;  2YTF A;  2EOI A; 
#chains in the Genus database with same CATH topology
 1N32 E;  4YHH E;  5AC4 A;  1YYW A;  4LFB E;  4F54 A;  4L8N A;  2DB2 A;  1ZBT A;  5LL6 R;  4KZS A;  4OOG C;  1TN9 A;  2VQE E;  1DI2 A;  1XNQ E;  2LCE A;  4ZYG A;  5CFF E;  4DR3 E;  4BMJ A;  1LLM C;  5AE3 A;  2EWL A;  2LMZ A;  1WXR A;  4RH8 A;  2CT1 A;  2V8Q B;  3HPZ A;  2E72 A;  2EMB A;  5ADZ A;  4DR6 E;  2CTD A;  2IHR 1;  2M7Q A;  3OTO E;  4X66 E;  4R2P A;  2EOQ A;  3ADJ A;  2JPA A;  1EH8 A;  5A6B A;  2GHF A;  3KZZ A;  4DUZ E;  1A1I A;  1HNX E;  2L6M A;  4JI3 E;  1N36 E;  2EMG A;  3HXL A;  5KL3 A;  4JI6 E;  1JK2 A;  4Q28 A;  2JOX A;  2JXP A;  2EMH A;  2MC6 A;  2RS7 A;  1KJK A;  2RSI A;  1A1H A;  2EOO A;  4BS9 A;  2V89 A;  4R2A A;  5FLX C;  4B3R E;  4F9A B;  2HJJ A;  5F3W A;  1STU A;  2EPR A;  2YRM A;  4TUG A;  4R2R A;  1HNW E;  2JYA A;  2YU8 A;  2EPZ A;  2UXD E;  2NUF A;  2EPO A;  2JWO A;  1NEI A;  2EN4 A;  2NA2 A;  2JR1 A;  4R8O A;  2EN7 A;  2RTX A;  5A6K A;  4DR1 E;  4X65 E;  4F6M A;  2EPL X;  5A69 A;  2YTQ A;  2NUE A;  1T4N A;  1DQ3 A;  4TUI A;  1X6F A;  5DNY A;  2L3C A;  3F6H A;  2EM4 A;  1I94 E;  2EN3 A;  4DV2 E;  1X5W A;  1O0W A;  5KL2 A;  3BBG A;  2L2N A;  2YT4 A;  3MSW A;  4R2S A;  4B3S E;  1N3G A;  3T1Y E;  2DMI A;  1T4L B;  2K7I A;  1X3C A;  1IQS A;  1DGC A;  1BBG A;  2L92 A;  4DV4 E;  3AUZ A;  2DIX A;  5AAS A;  2WCC 3;  4BC9 A;  2EL6 A;  2G7H A;  4DV6 E;  1BB8 A;  4X9J A;  2YTP A;  2LO3 A;  2EMF A;  4WPY A;  3VYX A;  2BB8 A;  2MKN A;  2ZM6 E;  3IWB A;  2EPK X;  2LVH A;  1HNZ E;  5IT9 C;  4GKK E;  3QG5 C;  1YPN A;  2YTD A;  4WYQ B;  5A6J A;  1N33 E;  2EOS A;  4ZYD A;  2Q8U A;  2VF1 A;  4BC7 A;  2YSO A;  4M0V A;  1YYO A;  4LF6 E;  1QU6 A;  2YZT A;  1ZU1 A;  5KL6 A;  4GZN C;  2RQL A;  5AE2 A;  2EOE A;  3BF2 A;  2ELY A;  2YU5 A;  2N3G A;  3IWC A;  4MLQ A;  2F8B A;  5LLQ A;  2KOU A;  1IMU A;  2BBG A;  2EMK A;  1HR0 E;  2MC5 A;  2LTS A;  2UUA E;  2LTR A;  3AV0 A;  4DMI A;  4NXM E;  2EOR A;  2EE8 A;  4ZYE A;  2A25 A;  2EM8 A;  3ADG A;  1SR9 A;  4J8Z A;  1MEY C;  2EOF A;  3JAM C;  1RQ0 A;  4M9V C;  4P78 A;  2CPN A;  2EPN A;  2YTJ A;  2EOZ A;  2EM6 A;  2UXC E;  1SFE A;  3OML A;  2I9I A;  4WX9 A;  3JTZ A;  4WSG A;  3P1X A;  2EM2 A;  4O24 A;  1IQO A;  2EML A;  2VE7 C;  2L2K B;  2LE2 A;  1IBM E;  3HTX A;  2HC5 A;  2EPA A;  1FKA E;  2F4V E;  2HHH E;  1T38 A;  4L5N C;  2EOX A;  2EPP A;  2EL4 A;  1G2D C;  5T6J A;  3J7A G;  4NXN E;  2EMY A;  4BCA A;  4NHR A;  2YRH A;  1UHZ A;  4JYA E;  3BGH A;  1MGT A;  5LMU E;  4GKJ E;  2ENC A;  1X48 A;  4IJD A;  2ADR A;  4B3M E;  1YFH A;  2LRS A;  2B9D A;  1X47 A;  4M2Z A;  3F6G A;  4F6N A;  2R1F A;  1YSA C;  2L33 A;  3IWD A;  5AE1 A;  2LV2 A;  5IXM B;  5KL5 A;  3L00 A;  2YTF A;  2DSY A;  2YTG A;  4P7D A;  1T39 A;  2UUC E;  2WBU A;  4MLV A;  4JI7 E;  2EPX A;  1QNT A;  2V88 A;  2VRD A;  3UK3 C;  2H36 X;  2GPI A;  2DLK A;  5BR8 E;  3MHS C;  4Q35 B;  1XMQ E;  1UBD C;  4HEI A;  1PJT A;  1G2F C;  2DLQ A;  2ODR C;  2K4V A;  1J26 A;  4F2J C;  1A1F A;  4X64 E;  3J81 C;  1PJS A;  1KYQ A;  2L3J A;  3M99 B;  4DV5 E;  4DR2 E;  4B3T E;  4DV1 E;  2YWQ A;  2YPN A;  5A6A A;  3LLH A;  4F9C B;  1UIL A;  4R2C A;  4BHC A;  3ADI A;  2B3T B;  2V85 A;  4JI2 E;  4YY3 E;  5KL4 A;  1X6E A;  4RHB B;  3J80 C;  2DRP A;  2LUQ A;  4BHB A;  1PJQ A;  3C4B A;  4FK5 C;  4DV7 E;  3VHT B;  2MKD A;  1JK1 A;  4DV0 E;  4IS1 C;  2EMW A;  2CSH A;  2NUG A;  1WHN A;  3RMP A;  2YTI A;  3DF6 A;  3EQ1 A;  1A1G A;  2YTO A;  3T1H E;  2E5L E;  2EM9 A;  2EZ6 A;  2J7J A;  3KWR A;  3MHH C;  1YUJ A;  3THN A;  2EN1 A;  2EN8 A;  3DJW A;  4X62 E;  1UN6 B;  2YSP A;  1YYK A;  2EMA A;  1TF6 A;  2L8T A;  4WFT A;  2ENA A;  2DGC A;  4LFA E;  5KL7 A;  4DUY E;  5AC5 A;  2JOB A;  1WHQ A;  2EOH A;  2YTN A;  1EH7 A;  5LMN E;  4LU9 A;  4OX9 E;  2R76 A;  4HTG A;  2EMZ A;  4JI1 E;  4DR5 E;  4LF5 E;  2EM5 A;  2WZO A;  1X6H A;  2WBS A;  2MDR A;  1IBK E;  2N3H A;  3TQM A;  5TSE A;  4F9B B;  3VK6 A;  2I13 A;  2V83 A;  4JI4 E;  1BBO A;  4LTY A;  4KWY A;  2EQ1 A;  3BID A;  4I8O A;  2EQ3 A;  1FJG E;  1PKP A;  5A6B D;  2LUP B;  2GLI A;  3H09 A;  3VYY A;  4N4R B;  2DMY A;  4LF9 E;  2LJH A;  1ZR9 A;  2EOI A;  2EPM X;  2EN6 A;  2V86 A;  4X8W A;  1XNR E;  1L4S A;  4R2Q A;  2RPC A;  3C6M A;  4O43 A;  3HQ1 A;  2YTE A;  4K0K E;  2YRK A;  2E1M A;  1T4O A;  2EM3 A;  4JI5 E;  4DR4 E;  2UXB E;  3EPH A;  2B7T A;  4ZYH A;  3C6K A;  1A1L A;  1RMD A;  2FTX B;  2EM7 A;  3EPL A;  3LML A;  4WSP A;  1WRJ A;  2JY9 A;  3EPK A;  2FGG A;  2D9H A;  2ODR D;  2EOJ A;  1YUI A;  4O5G A;  2EQ0 A;  2EM0 A;  3J7Y p;  1N34 E;  2LJU A;  1TF3 A;  1A1K A;  1XMO E;  5IV8 B;  1F2I G;  1AH5 A;  2JP9 A;  1X49 A;  3K6Q A;  2EMI A;  3FIG A;  4LFC E;  1ZAA C;  4KHP E;  1GTK A;  2LBS B;  2M9A A;  2V87 A;  1GQE A;  3JU0 A;  4DKK A;  4LF4 E;  2EPC A;  2EJ4 A;  4R2E A;  1EKZ A;  5A2Q C;  2N8X A;  4R03 A;  4DR7 E;  1WJP A;  2B7V A;  2RS6 A;  4WXC A;  4BBY A;  2ELZ A;  3KZY A;  2VQF E;  2UUB E;  4NZV A;  2LT7 A;  4WXD A;  4JV5 E;  2L2M A;  1P47 A;  4JI8 E;  1AAY A;  2FV4 B;  2KON A;  1Z1B A;  1B69 A;  4LF7 E;  2EN2 A;  2UU9 E;  1EH6 A;  2EOY A;  3HPS A;  3ZOQ B;  3C4T A;  1A1J A;  4R2D A;  1RC7 A;  4JI0 E;  2EMX A;  1IBL E;  2HGH A;  1NCS A;  3ADL A;  5IWA E;  1PDA A;  2EPU A;  3EPJ A;  3ECR A;  4AQY E;  4DV3 E;  2PRT A;  2EL5 A;  1ZBQ A;  4LF8 E;  4GEQ B;  1GZ6 A;  2MDG A;  2EP3 A;  1YZ9 A;  2NAB A;  2EMC A;  2JVA A;  2M1S A;  3THO B;  2KHX A;  2ENH A;  1J5E E;  2M4I A;  2WBT A;  2RSM A;  4O4K A;  2EOM A;  4M30 A; 
#chains in the Genus database with same CATH homology
 2EN6 A;  2BB8 A;  2WBU A;  2MKN A;  4R2Q A;  2EPX A;  2RPC A;  2YTE A;  2VRD A;  2LVH A;  2YRK A;  3UK3 C;  1TN9 A;  2DLK A;  2EM3 A;  3EPH A;  3MHS C;  2LCE A;  1A1L A;  2YTD A;  1RMD A;  1UBD C;  2EM7 A;  3EPL A;  1G2F C;  2EOS A;  2DLQ A;  1LLM C;  2YSO A;  3EPK A;  4F2J C;  2CT1 A;  1A1F A;  2E72 A;  1ZU1 A;  2EMB A;  2D9H A;  2CTD A;  2EOJ A;  5KL6 A;  4GZN C;  1YUI A;  2EOE A;  2EQ0 A;  2EM0 A;  3M99 B;  4R2P A;  2EOQ A;  1TF3 A;  1A1K A;  2ELY A;  2YU5 A;  2JPA A;  1F2I G;  2GHF A;  2YTG A;  4R2C A;  2EMK A;  1A1I A;  2JP9 A;  2EMG A;  5KL3 A;  2EMI A;  5KL4 A;  1X6E A;  1JK2 A;  2DRP A;  1ZAA C;  2EMH A;  2EOR A;  2EE8 A;  2M9A A;  2A25 A;  2MKD A;  4FK5 C;  2EMF A;  2EM8 A;  3VHT B;  1JK1 A;  1KJK A;  2RSI A;  1A1H A;  1MEY C;  2EOO A;  2EOF A;  4IS1 C;  2EPC A;  4R2A A;  2EJ4 A;  4R2E A;  4M9V C;  2EMW A;  2CSH A;  2YTI A;  1WJP A;  1A1G A;  2YTJ A;  2ELZ A;  2EOZ A;  2YTO A;  2EPR A;  2YRM A;  2EM6 A;  4R2R A;  2EM9 A;  2J7J A;  2YU8 A;  3MHH C;  2EPZ A;  1YUJ A;  4WSG A;  2EN4 A;  2EN1 A;  2EN8 A;  2EM2 A;  2LT7 A;  2EN7 A;  2EML A;  1UN6 B;  1P47 A;  2YSP A;  4F6M A;  1AAY A;  2EMA A;  1Z1B A;  1B69 A;  2YTQ A;  1TF6 A;  2EPA A;  2EN2 A;  2EOY A;  2ENA A;  2DGC A;  2EOX A;  2EPP A;  1A1J A;  4R2D A;  5KL7 A;  2EL4 A;  2EMX A;  2EOH A;  1G2D C;  2YTN A;  2HGH A;  1NCS A;  2EMY A;  1X6F A;  2EPU A;  3EPJ A;  2EMZ A;  2YRH A;  2EM4 A;  2EN3 A;  1X5W A;  2EM5 A;  5KL2 A;  1X6H A;  2PRT A;  2WBS A;  2ENC A;  2EL5 A;  4IJD A;  2ADR A;  4R2S A;  2I13 A;  2DMI A;  2MDG A;  2EP3 A;  1X3C A;  2NAB A;  1BBO A;  1DGC A;  2EMC A;  2EQ1 A;  2EQ3 A;  4F6N A;  2R1F A;  1YSA C;  2ENH A;  2GLI A;  2WCC 3;  2WBT A;  2LV2 A;  2EL6 A;  2EOM A;  1ZR9 A;  4X9J A;  1BB8 A;  2YTP A;  5KL5 A;  2LO3 A;  2YTF A;  2EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...