2EOQA

Solution structure of the c2h2 type zinc finger (region 283-315) of human zinc finger protein 224
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFKCDICGKSFCGRSRLNRHSMVHTAEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 283-315) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoqA01
2EPAA 2EMIA 1TN9A 2LCEA 2EM5A 2EOSA 2ELZA 4X9JA 2RSIA 5KL4A 1X6FA 2EMYA 2YTEA 2JPAA 2EPCA 2M9AA 2EJ4A 2EOZA 2MKDA 2VRDA 1BB8A 2CSHA 2EMLA 2EPUA 3M99B 1A1JA 2DMIA 2EMAA 2LVHA 2E72A 2EL6A 2EMCA 2A25A 2WCC3 2LO3A 2EOMA 2EL4A 2GHFA 2EN7A 2ADRA 1RMDA 5KL5A 1Z1BA 1LLMC 2EOQA 2EPZA 1P47A 2DRPA 2EP3A 3MHHC 2EOXA 2HGHA 2EQ1A 2WBTA 3EPJA 2PRTA 4IJDA 2EOFA 4R2EA 2BB8A 2EMFA 2EMXA 2EOEA 2EM0A 2EN4A 4WSGA 4R2PA 2CTDA 2EMKA 2EOOA 2EM3A 2NABA 2YRHA 1A1LA 1X3CA 2EM6A 2EN6A 2YTJA 1B69A 2EPRA 5KL7A 3EPHA 2LT7A 4M9VC 2ENAA 1BBOA 4FK5C 2GLIA 2EPPA 1A1KA 4R2QA 1UBDC 2YU8A 2EM2A 2RPCA 1TF6A 2EM9A 2YRKA 2WBUA 2YTPA 2JP9A 1G2DC 1UN6B 1ZU1A 2MDGA 2ENCA 3UK3C 2EN3A 4R2RA 1WJPA 2DLKA 2EM4A 1DGCA 2ENHA 4R2AA 2I13A 2YRMA 2EOYA 2YTNA 1ZAAC 2YSPA 1YUIA 1G2FC 2YSOA 1TF3A 2YU5A 1MEYC 2EMBA 1YUJA 1NCSA 3VHTB 2YTGA 2DLQA 2EN1A 4R2CA 1A1FA 2EOHA 2CT1A 2EQ3A 2LV2A 2YTIA 3MHSC 2YTOA 4F6MA 1JK2A 2EN8A 2EMGA 1X6EA 1YSAC 1A1HA 3EPKA 2EM7A 2EMHA 5KL6A 2EORA 2YTFA 2EL5A 4R2SA 2WBSA 2EQ0A 2DGCA 5KL2A 2EN2A 4IS1C 1X5WA 2EE8A 2EPXA 2ELYA 4F6NA 1JK1A 1AAYA 2EMWA 2YTQA 1X6HA 1ZR9A 1A1IA 2EOJA 2EM8A 2EOIA 2J7JA 2YTDA 4GZNC 1KJKA 1A1GA 4F2JC 3EPLA 4R2DA 1F2IG 2EMZA 2MKNA 2R1FA 5KL3A 2D9HA
chains in the Genus database with same CATH superfamily
1TN9A 4DV4E 2M4IA 2VE7C 4DKKA 4WXCA 5A6KA 2JPAA 5A2QC 4R8OA 2EJ4A 4DV1E 4O24A 2EOZA 3BF2A 4X65E 2VRDA 2R76A 1I94E 1A1JA 2LVHA 3QG5C 3T1HE 1N36E 2EL6A 3KWRA 1X47A 1EH6A 4DV3E 2ADRA 1RMDA 3LLHA 2JOXA 2DSYA 2NUEA 1IBKE 3EPJA 3VK6A 4JI0E 2BB8A 2KHXA 2EN4A 4WSGA 3THNA 4JI2E 2EMKA 5A6BA 2EM6A 2YTJA 1B69A 1IBLE 4F9CB 4LF8E 4LF5E 1UHZA 4JI8E 2RTXA 4BHBA 1RQ0A 2M7QA 2UUCE 4TUIA 2VQFE 2UUBE 2EM9A 2YTPA 1G2DC 4ZYGA 4DR5E 5AE3A 1T4LB 4K0KE 4O5GA 4DV2E 4L5NC 4LFCE 4O4KA 2YRMA 3IWDA 4DV7E 2YSPA 1YUIA 5LMUE 1G2FC 2RQLA 4LTYA 1TF3A 2YU5A 1MEYC 2V85A 2JWOA 5AE2A 4DMIA 2YTGA 1SR9A 4B3TE 2EN1A 3VYXA 2YTIA 5LL6R 4F6MA 3ADJA 5A69A 1YSAC 2EM7A 2EPKX 3F6GA 2L2MA 2EORA 2YTFA 5IV8B 2WBSA 4JI3E 2V87A 2EPLX 2V83A 4WPYA 2LTSA 2DGCA 1J5EE 2BBGA 2EPXA 2ODRC 2DB2A 4AQYE 1JK1A 1AAYA 3ADIA 2YTQA 1X6HA 2LJHA 4WYQB 1F2IG 3ADLA 5KL3A 2GPIA 3OMLA 2ELZA 2RSIA 5KL4A 4JYAE 2E1MA 1X6FA 4NZVA 2YTEA 3TQMA 2LJUA 1T38A 3AV0A 1GQEA 1BB8A 2CSHA 2EPUA 2NUGA 2RSMA 1T4OA 3P1XA 2B7TA 2E72A 4F9AB 2JY9A 3C4BA 2HC5A 2EL4A 3OTOE 2V88A 4B3ME 3ECRA 4P78A 3HTXA 4JI4E 2HGHA 4BC7A 1ZBTA 2V89A 2V86A 4OOGC 2RS7A 2EOFA 4R2EA 2EOEA 1YYWA 1IBME 4R2PA 2CTDA 2NABA 1IQSA 2YRHA 1O0WA 2EPRA 3DF6A 4ZYEA 4HTGA 4M9VC 2L6MA 2L2NA 1X48A 1YFHA 2VF1A 1L4SA 1UBDC 4WXDA 2YU8A 2UXCE 1TF6A 2YRKA 1IQOA 1ZU1A 2L8TA 4BC9A 4R2RA 2JOBA 3BGHA 1WJPA 2DLKA 4X66E 3HQ1A 1WHQA 2ODRD 4I8OA 4R03A 4R2AA 2I13A 4DR1E 4N4RB 4RHBB 1ZAAC 5LLQA 3DJWA 4JI1E 2YSOA 2K7IA 1YUJA 4BS9A 4DR3E 4LF7E 1XMOE 1NCSA 4R2CA 1N33E 1JK2A 2YTOA 2F8BA 2MC5A 2JYAA 2KOUA 4BHCA 1X6EA 4Q35B 1A1HA 4MLQA 2EMHA 4O43A 5KL6A 2YPNA 2EL5A 3FIGA 3H09A 5A6JA 2EN2A 2JR1A 1ZBQA 2WZOA 1N3GA 4LF4E 4F54A 4ZYHA 1YZ9A 2YZTA 3L00A 1ZR9A 1J26A 3HPZA 1A1IA 2EM8A 2YTDA 3BBGA 1KJKA 1RC7A 5IT9C 2MKNA 3THOB 4DR4E 4P7DA 2EPAA 2M1SA 4DR6E 3C6KA 2EMIA 2K4VA 2EOSA 4TUGA 4BBYA 2EPOA 1HNXE 2NUFA 4WFTA 2M9AA 1EKZA 1MGTA 2JVAA 3M99B 3IWCA 2DMIA 2EMAA 2KONA 2EMCA 2WCC3 3K6QA 2GHFA 5CFFE 2FGGA 5KL5A 1T39A 2EOQA 1P47A 2DRPA 4B3RE 2JXPA 3MHHC 2EOXA 4MLVA 1YYOA 1NEIA 4X64E 1PJSA 4IJDA 2EMXA 2EMFA 2EZ6A 2HJJA 1PDAA 3KZYA 1A1LA 3JTZA 4DR2E 1DI2A 1SFEA 3EPHA 2EWLA 2LT7A 4KZSA 1QNTA 1PJTA 2I9IA 5DNYA 2EPPA 1HR0E 4R2QA 4M30A 4Q28A 4ZYDA 2EM2A 2L33A 2VQEE 2WBUA 4DV0E 4YY3E 4WSPA 2MDGA 3UK3C 4JI5E 2EN3A 2L2KB 3LMLA 4DR7E 1GZ6A 5IWAE 4GKJE 2YTNA 3ADGA 5AASA 2B7VA 2EMBA 2NA2A 1YPNA 3IWBA 4NXNE 3VHTB 2E5LE 1A1FA 2EPNA 2EOHA 1EH7A 3MHSC 1FJGE 4LFBE 2YWQA 4LF9E 4J8ZA 1PKPA 3HPSA 1IMUA 4LU9A 1FKAE 2DIXA 3J7AG 2LBSB 4GKKE 3J7Yp 4IS1C 1X5WA 4RH8A 3ZOQB 1UILA 4WX9A 2ELYA 2LTRA 2EOIA 2J7JA 3HXLA 3EPLA 1PJQA 3JU0A 2EMZA 2IHR1 2R1FA 2Q8UA 1A1GA 2D9HA 2GLIA 3BIDA 2HHHE 2LRSA 2LCEA 2EM5A 5ADZA 4X62E 4DUYE 2EPMX 4X9JA 2L3JA 4M0VA 3RMPA 2EMYA 1KYQA 2EPCA 1STUA 2N3HA 3J81C 2ZM6E 2MKDA 5AC5A 2UU9E 2H36X 2EMLA 2L92A 2YT4A 4M2ZA 5IXMB 5LMNE 2LUQA 1N32E 2A25A 2LO3A 2EOMA 5T6JA 1AH5A 2EN7A 4LF6E 2FTXB 4JI6E 2UXDE 1Z1BA 1LLMC 2EPZA 4HEIA 2EP3A 2MC6A 3AUZA 2EQ1A 2DMYA 2WBTA 5AC4A 4DUZE 2PRTA 1XNRE 4KWYA 2EM0A 2F4VE 2N8XA 2EOOA 2EM3A 1X3CA 2EN6A 5FLXC 2V8QB 5KL7A 2ENAA 1BBOA 4FK5C 2B3TB 5A6BD 3EQ1A 1A1KA 2CPNA 4YHHE 3F6HA 4JI7E 2LUPB 2RPCA 3VYYA 5F3WA 4B3SE 4X8WA 2JP9A 1UN6B 1EH8A 1WHNA 2ENCA 4NXME 2FV4B 2EM4A 1DGCA 2ENHA 1HNZE 2B9DA 2EOYA 5TSEA 1XNQE 4F9BB 4KHPE 1QU6A 1GTKA 3C4TA 4LFAE 1BBGA 2DLQA 4NHRA 1WXRA 2CT1A 2EQ3A 2LE2A 2LV2A 4BMJA 2EN8A 2EMGA 4BCAA 1YYKA 5A6AA 3KZZA 1XMQE 4L8NA 3EPKA 2UUAE 4JV5E 4OX9E 2MDRA 1WRJA 1X49A 4R2SA 2G7HA 2RS6A 2EQ0A 1DQ3A 5KL2A 1N34E 4GEQB 2L3CA 2EE8A 5AE1A 4F6NA 3MSWA 2EMWA 2N3GA 2UXBE 3JAMC 4DV6E 3T1YE 1HNWE 2EOJA 4GZNC 3C6MA 5BR8E 4F2JC 4R2DA 3J80C 4DV5E 1T4NA 2LMZA
chains in the Genus database with same CATH topology
2EPAA 2EMIA 1TN9A 2LCEA 2EM5A 2EOSA 2ELZA 4X9JA 2RSIA 5KL4A 1X6FA 2EMYA 2YTEA 2JPAA 2EPCA 2M9AA 2EJ4A 2EOZA 2MKDA 2VRDA 1BB8A 2CSHA 2EMLA 2EPUA 3M99B 1A1JA 2DMIA 2EMAA 2LVHA 2E72A 2EL6A 2EMCA 2A25A 2WCC3 2LO3A 2EOMA 2EL4A 2GHFA 2EN7A 2ADRA 1RMDA 5KL5A 1Z1BA 1LLMC 2EOQA 2EPZA 1P47A 2DRPA 2EP3A 3MHHC 2EOXA 2HGHA 2EQ1A 2WBTA 3EPJA 2PRTA 4IJDA 2EOFA 4R2EA 2BB8A 2EMFA 2EMXA 2EOEA 2EM0A 2EN4A 4WSGA 4R2PA 2CTDA 2EMKA 2EOOA 2EM3A 2NABA 2YRHA 1A1LA 1X3CA 2EM6A 2EN6A 2YTJA 1B69A 2EPRA 5KL7A 3EPHA 2LT7A 4M9VC 2ENAA 1BBOA 4FK5C 2GLIA 2EPPA 1A1KA 4R2QA 1UBDC 2YU8A 2EM2A 2RPCA 1TF6A 2EM9A 2YRKA 2WBUA 2YTPA 2JP9A 1G2DC 1UN6B 1ZU1A 2MDGA 2ENCA 3UK3C 2EN3A 4R2RA 1WJPA 2DLKA 2EM4A 1DGCA 2ENHA 4R2AA 2I13A 2YRMA 2EOYA 2YTNA 1ZAAC 2YSPA 1YUIA 1G2FC 2YSOA 1TF3A 2YU5A 1MEYC 2EMBA 1YUJA 1NCSA 3VHTB 2YTGA 2DLQA 2EN1A 4R2CA 1A1FA 2EOHA 2CT1A 2EQ3A 2LV2A 2YTIA 3MHSC 2YTOA 4F6MA 1JK2A 2EN8A 2EMGA 1X6EA 1YSAC 1A1HA 3EPKA 2EM7A 2EMHA 5KL6A 2EORA 2YTFA 2EL5A 4R2SA 2WBSA 2EQ0A 2DGCA 5KL2A 2EN2A 4IS1C 1X5WA 2EE8A 2EPXA 2ELYA 4F6NA 1JK1A 1AAYA 2EMWA 2YTQA 1X6HA 1ZR9A 1A1IA 2EOJA 2EM8A 2EOIA 2J7JA 2YTDA 4GZNC 1KJKA 1A1GA 4F2JC 3EPLA 4R2DA 1F2IG 2EMZA 2MKNA 2R1FA 5KL3A 2D9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPA A;  2EMI A;  1TN9 A;  2LCE A;  2EM5 A;  2EOS A;  2ELZ A;  4X9J A;  2RSI A;  5KL4 A;  1X6F A;  2EMY A;  2YTE A;  2JPA A;  2EPC A;  2M9A A;  2EJ4 A;  2EOZ A;  2MKD A;  2VRD A;  1BB8 A;  2CSH A;  2EML A;  2EPU A;  3M99 B;  1A1J A;  2DMI A;  2EMA A;  2LVH A;  2E72 A;  2EL6 A;  2EMC A;  2A25 A;  2WCC 3;  2LO3 A;  2EOM A;  2EL4 A;  2GHF A;  2EN7 A;  2ADR A;  1RMD A;  5KL5 A;  1Z1B A;  1LLM C;  2EOQ A;  2EPZ A;  1P47 A;  2DRP A;  2EP3 A;  3MHH C;  2EOX A;  2HGH A;  2EQ1 A;  2WBT A;  3EPJ A;  2PRT A;  4IJD A;  2EOF A;  4R2E A;  2BB8 A;  2EMF A;  2EMX A;  2EOE A;  2EM0 A;  2EN4 A;  4WSG A;  4R2P A;  2CTD A;  2EMK A;  2EOO A;  2EM3 A;  2NAB A;  2YRH A;  1A1L A;  1X3C A;  2EM6 A;  2EN6 A;  2YTJ A;  1B69 A;  2EPR A;  5KL7 A;  3EPH A;  2LT7 A;  4M9V C;  2ENA A;  1BBO A;  4FK5 C;  2GLI A;  2EPP A;  1A1K A;  4R2Q A;  1UBD C;  2YU8 A;  2EM2 A;  2RPC A;  1TF6 A;  2EM9 A;  2YRK A;  2WBU A;  2YTP A;  2JP9 A;  1G2D C;  1UN6 B;  1ZU1 A;  2MDG A;  2ENC A;  3UK3 C;  2EN3 A;  4R2R A;  1WJP A;  2DLK A;  2EM4 A;  1DGC A;  2ENH A;  4R2A A;  2I13 A;  2YRM A;  2EOY A;  2YTN A;  1ZAA C;  2YSP A;  1YUI A;  1G2F C;  2YSO A;  1TF3 A;  2YU5 A;  1MEY C;  2EMB A;  1YUJ A;  1NCS A;  3VHT B;  2YTG A;  2DLQ A;  2EN1 A;  4R2C A;  1A1F A;  2EOH A;  2CT1 A;  2EQ3 A;  2LV2 A;  2YTI A;  3MHS C;  2YTO A;  4F6M A;  1JK2 A;  2EN8 A;  2EMG A;  1X6E A;  1YSA C;  1A1H A;  3EPK A;  2EM7 A;  2EMH A;  5KL6 A;  2EOR A;  2YTF A;  2EL5 A;  4R2S A;  2WBS A;  2EQ0 A;  2DGC A;  5KL2 A;  2EN2 A;  4IS1 C;  1X5W A;  2EE8 A;  2EPX A;  2ELY A;  4F6N A;  1JK1 A;  1AAY A;  2EMW A;  2YTQ A;  1X6H A;  1ZR9 A;  1A1I A;  2EOJ A;  2EM8 A;  2EOI A;  2J7J A;  2YTD A;  4GZN C;  1KJK A;  1A1G A;  4F2J C;  3EPL A;  4R2D A;  1F2I G;  2EMZ A;  2MKN A;  2R1F A;  5KL3 A;  2D9H A; 
#chains in the Genus database with same CATH topology
 1TN9 A;  4DV4 E;  2M4I A;  2VE7 C;  4DKK A;  4WXC A;  5A6K A;  2JPA A;  5A2Q C;  4R8O A;  2EJ4 A;  4DV1 E;  4O24 A;  2EOZ A;  3BF2 A;  4X65 E;  2VRD A;  2R76 A;  1I94 E;  1A1J A;  2LVH A;  3QG5 C;  3T1H E;  1N36 E;  2EL6 A;  3KWR A;  1X47 A;  1EH6 A;  4DV3 E;  2ADR A;  1RMD A;  3LLH A;  2JOX A;  2DSY A;  2NUE A;  1IBK E;  3EPJ A;  3VK6 A;  4JI0 E;  2BB8 A;  2KHX A;  2EN4 A;  4WSG A;  3THN A;  4JI2 E;  2EMK A;  5A6B A;  2EM6 A;  2YTJ A;  1B69 A;  1IBL E;  4F9C B;  4LF8 E;  4LF5 E;  1UHZ A;  4JI8 E;  2RTX A;  4BHB A;  1RQ0 A;  2M7Q A;  2UUC E;  4TUI A;  2VQF E;  2UUB E;  2EM9 A;  2YTP A;  1G2D C;  4ZYG A;  4DR5 E;  5AE3 A;  1T4L B;  4K0K E;  4O5G A;  4DV2 E;  4L5N C;  4LFC E;  4O4K A;  2YRM A;  3IWD A;  4DV7 E;  2YSP A;  1YUI A;  5LMU E;  1G2F C;  2RQL A;  4LTY A;  1TF3 A;  2YU5 A;  1MEY C;  2V85 A;  2JWO A;  5AE2 A;  4DMI A;  2YTG A;  1SR9 A;  4B3T E;  2EN1 A;  3VYX A;  2YTI A;  5LL6 R;  4F6M A;  3ADJ A;  5A69 A;  1YSA C;  2EM7 A;  2EPK X;  3F6G A;  2L2M A;  2EOR A;  2YTF A;  5IV8 B;  2WBS A;  4JI3 E;  2V87 A;  2EPL X;  2V83 A;  4WPY A;  2LTS A;  2DGC A;  1J5E E;  2BBG A;  2EPX A;  2ODR C;  2DB2 A;  4AQY E;  1JK1 A;  1AAY A;  3ADI A;  2YTQ A;  1X6H A;  2LJH A;  4WYQ B;  1F2I G;  3ADL A;  5KL3 A;  2GPI A;  3OML A;  2ELZ A;  2RSI A;  5KL4 A;  4JYA E;  2E1M A;  1X6F A;  4NZV A;  2YTE A;  3TQM A;  2LJU A;  1T38 A;  3AV0 A;  1GQE A;  1BB8 A;  2CSH A;  2EPU A;  2NUG A;  2RSM A;  1T4O A;  3P1X A;  2B7T A;  2E72 A;  4F9A B;  2JY9 A;  3C4B A;  2HC5 A;  2EL4 A;  3OTO E;  2V88 A;  4B3M E;  3ECR A;  4P78 A;  3HTX A;  4JI4 E;  2HGH A;  4BC7 A;  1ZBT A;  2V89 A;  2V86 A;  4OOG C;  2RS7 A;  2EOF A;  4R2E A;  2EOE A;  1YYW A;  1IBM E;  4R2P A;  2CTD A;  2NAB A;  1IQS A;  2YRH A;  1O0W A;  2EPR A;  3DF6 A;  4ZYE A;  4HTG A;  4M9V C;  2L6M A;  2L2N A;  1X48 A;  1YFH A;  2VF1 A;  1L4S A;  1UBD C;  4WXD A;  2YU8 A;  2UXC E;  1TF6 A;  2YRK A;  1IQO A;  1ZU1 A;  2L8T A;  4BC9 A;  4R2R A;  2JOB A;  3BGH A;  1WJP A;  2DLK A;  4X66 E;  3HQ1 A;  1WHQ A;  2ODR D;  4I8O A;  4R03 A;  4R2A A;  2I13 A;  4DR1 E;  4N4R B;  4RHB B;  1ZAA C;  5LLQ A;  3DJW A;  4JI1 E;  2YSO A;  2K7I A;  1YUJ A;  4BS9 A;  4DR3 E;  4LF7 E;  1XMO E;  1NCS A;  4R2C A;  1N33 E;  1JK2 A;  2YTO A;  2F8B A;  2MC5 A;  2JYA A;  2KOU A;  4BHC A;  1X6E A;  4Q35 B;  1A1H A;  4MLQ A;  2EMH A;  4O43 A;  5KL6 A;  2YPN A;  2EL5 A;  3FIG A;  3H09 A;  5A6J A;  2EN2 A;  2JR1 A;  1ZBQ A;  2WZO A;  1N3G A;  4LF4 E;  4F54 A;  4ZYH A;  1YZ9 A;  2YZT A;  3L00 A;  1ZR9 A;  1J26 A;  3HPZ A;  1A1I A;  2EM8 A;  2YTD A;  3BBG A;  1KJK A;  1RC7 A;  5IT9 C;  2MKN A;  3THO B;  4DR4 E;  4P7D A;  2EPA A;  2M1S A;  4DR6 E;  3C6K A;  2EMI A;  2K4V A;  2EOS A;  4TUG A;  4BBY A;  2EPO A;  1HNX E;  2NUF A;  4WFT A;  2M9A A;  1EKZ A;  1MGT A;  2JVA A;  3M99 B;  3IWC A;  2DMI A;  2EMA A;  2KON A;  2EMC A;  2WCC 3;  3K6Q A;  2GHF A;  5CFF E;  2FGG A;  5KL5 A;  1T39 A;  2EOQ A;  1P47 A;  2DRP A;  4B3R E;  2JXP A;  3MHH C;  2EOX A;  4MLV A;  1YYO A;  1NEI A;  4X64 E;  1PJS A;  4IJD A;  2EMX A;  2EMF A;  2EZ6 A;  2HJJ A;  1PDA A;  3KZY A;  1A1L A;  3JTZ A;  4DR2 E;  1DI2 A;  1SFE A;  3EPH A;  2EWL A;  2LT7 A;  4KZS A;  1QNT A;  1PJT A;  2I9I A;  5DNY A;  2EPP A;  1HR0 E;  4R2Q A;  4M30 A;  4Q28 A;  4ZYD A;  2EM2 A;  2L33 A;  2VQE E;  2WBU A;  4DV0 E;  4YY3 E;  4WSP A;  2MDG A;  3UK3 C;  4JI5 E;  2EN3 A;  2L2K B;  3LML A;  4DR7 E;  1GZ6 A;  5IWA E;  4GKJ E;  2YTN A;  3ADG A;  5AAS A;  2B7V A;  2EMB A;  2NA2 A;  1YPN A;  3IWB A;  4NXN E;  3VHT B;  2E5L E;  1A1F A;  2EPN A;  2EOH A;  1EH7 A;  3MHS C;  1FJG E;  4LFB E;  2YWQ A;  4LF9 E;  4J8Z A;  1PKP A;  3HPS A;  1IMU A;  4LU9 A;  1FKA E;  2DIX A;  3J7A G;  2LBS B;  4GKK E;  3J7Y p;  4IS1 C;  1X5W A;  4RH8 A;  3ZOQ B;  1UIL A;  4WX9 A;  2ELY A;  2LTR A;  2EOI A;  2J7J A;  3HXL A;  3EPL A;  1PJQ A;  3JU0 A;  2EMZ A;  2IHR 1;  2R1F A;  2Q8U A;  1A1G A;  2D9H A;  2GLI A;  3BID A;  2HHH E;  2LRS A;  2LCE A;  2EM5 A;  5ADZ A;  4X62 E;  4DUY E;  2EPM X;  4X9J A;  2L3J A;  4M0V A;  3RMP A;  2EMY A;  1KYQ A;  2EPC A;  1STU A;  2N3H A;  3J81 C;  2ZM6 E;  2MKD A;  5AC5 A;  2UU9 E;  2H36 X;  2EML A;  2L92 A;  2YT4 A;  4M2Z A;  5IXM B;  5LMN E;  2LUQ A;  1N32 E;  2A25 A;  2LO3 A;  2EOM A;  5T6J A;  1AH5 A;  2EN7 A;  4LF6 E;  2FTX B;  4JI6 E;  2UXD E;  1Z1B A;  1LLM C;  2EPZ A;  4HEI A;  2EP3 A;  2MC6 A;  3AUZ A;  2EQ1 A;  2DMY A;  2WBT A;  5AC4 A;  4DUZ E;  2PRT A;  1XNR E;  4KWY A;  2EM0 A;  2F4V E;  2N8X A;  2EOO A;  2EM3 A;  1X3C A;  2EN6 A;  5FLX C;  2V8Q B;  5KL7 A;  2ENA A;  1BBO A;  4FK5 C;  2B3T B;  5A6B D;  3EQ1 A;  1A1K A;  2CPN A;  4YHH E;  3F6H A;  4JI7 E;  2LUP B;  2RPC A;  3VYY A;  5F3W A;  4B3S E;  4X8W A;  2JP9 A;  1UN6 B;  1EH8 A;  1WHN A;  2ENC A;  4NXM E;  2FV4 B;  2EM4 A;  1DGC A;  2ENH A;  1HNZ E;  2B9D A;  2EOY A;  5TSE A;  1XNQ E;  4F9B B;  4KHP E;  1QU6 A;  1GTK A;  3C4T A;  4LFA E;  1BBG A;  2DLQ A;  4NHR A;  1WXR A;  2CT1 A;  2EQ3 A;  2LE2 A;  2LV2 A;  4BMJ A;  2EN8 A;  2EMG A;  4BCA A;  1YYK A;  5A6A A;  3KZZ A;  1XMQ E;  4L8N A;  3EPK A;  2UUA E;  4JV5 E;  4OX9 E;  2MDR A;  1WRJ A;  1X49 A;  4R2S A;  2G7H A;  2RS6 A;  2EQ0 A;  1DQ3 A;  5KL2 A;  1N34 E;  4GEQ B;  2L3C A;  2EE8 A;  5AE1 A;  4F6N A;  3MSW A;  2EMW A;  2N3G A;  2UXB E;  3JAM C;  4DV6 E;  3T1Y E;  1HNW E;  2EOJ A;  4GZN C;  3C6M A;  5BR8 E;  4F2J C;  4R2D A;  3J80 C;  4DV5 E;  1T4N A;  2LMZ A; 
#chains in the Genus database with same CATH homology
 2EPA A;  2EMI A;  1TN9 A;  2LCE A;  2EM5 A;  2EOS A;  2ELZ A;  4X9J A;  2RSI A;  5KL4 A;  1X6F A;  2EMY A;  2YTE A;  2JPA A;  2EPC A;  2M9A A;  2EJ4 A;  2EOZ A;  2MKD A;  2VRD A;  1BB8 A;  2CSH A;  2EML A;  2EPU A;  3M99 B;  1A1J A;  2DMI A;  2EMA A;  2LVH A;  2E72 A;  2EL6 A;  2EMC A;  2A25 A;  2WCC 3;  2LO3 A;  2EOM A;  2EL4 A;  2GHF A;  2EN7 A;  2ADR A;  1RMD A;  5KL5 A;  1Z1B A;  1LLM C;  2EOQ A;  2EPZ A;  1P47 A;  2DRP A;  2EP3 A;  3MHH C;  2EOX A;  2HGH A;  2EQ1 A;  2WBT A;  3EPJ A;  2PRT A;  4IJD A;  2EOF A;  4R2E A;  2BB8 A;  2EMF A;  2EMX A;  2EOE A;  2EM0 A;  2EN4 A;  4WSG A;  4R2P A;  2CTD A;  2EMK A;  2EOO A;  2EM3 A;  2NAB A;  2YRH A;  1A1L A;  1X3C A;  2EM6 A;  2EN6 A;  2YTJ A;  1B69 A;  2EPR A;  5KL7 A;  3EPH A;  2LT7 A;  4M9V C;  2ENA A;  1BBO A;  4FK5 C;  2GLI A;  2EPP A;  1A1K A;  4R2Q A;  1UBD C;  2YU8 A;  2EM2 A;  2RPC A;  1TF6 A;  2EM9 A;  2YRK A;  2WBU A;  2YTP A;  2JP9 A;  1G2D C;  1UN6 B;  1ZU1 A;  2MDG A;  2ENC A;  3UK3 C;  2EN3 A;  4R2R A;  1WJP A;  2DLK A;  2EM4 A;  1DGC A;  2ENH A;  4R2A A;  2I13 A;  2YRM A;  2EOY A;  2YTN A;  1ZAA C;  2YSP A;  1YUI A;  1G2F C;  2YSO A;  1TF3 A;  2YU5 A;  1MEY C;  2EMB A;  1YUJ A;  1NCS A;  3VHT B;  2YTG A;  2DLQ A;  2EN1 A;  4R2C A;  1A1F A;  2EOH A;  2CT1 A;  2EQ3 A;  2LV2 A;  2YTI A;  3MHS C;  2YTO A;  4F6M A;  1JK2 A;  2EN8 A;  2EMG A;  1X6E A;  1YSA C;  1A1H A;  3EPK A;  2EM7 A;  2EMH A;  5KL6 A;  2EOR A;  2YTF A;  2EL5 A;  4R2S A;  2WBS A;  2EQ0 A;  2DGC A;  5KL2 A;  2EN2 A;  4IS1 C;  1X5W A;  2EE8 A;  2EPX A;  2ELY A;  4F6N A;  1JK1 A;  1AAY A;  2EMW A;  2YTQ A;  1X6H A;  1ZR9 A;  1A1I A;  2EOJ A;  2EM8 A;  2EOI A;  2J7J A;  2YTD A;  4GZN C;  1KJK A;  1A1G A;  4F2J C;  3EPL A;  4R2D A;  1F2I G;  2EMZ A;  2MKN A;  2R1F A;  5KL3 A;  2D9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...