1YUIA

Solution nmr structure of the gaga factor/dna complex, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yuiA00
2YTIA 2ADRA 1A1GA 4X9JA 2EOMA 2YTEA 4R2EA 2WBUA 2CTDA 2EMLA 4F6MA 3EPHA 2EJ4A 1ZR9A 2EPPA 2EPCA 2EM6A 2MKDA 4R2DA 1YUIA 2HGHA 4R2QA 1ZAAC 2MDGA 2LT7A 1DGCA 2CSHA 2BB8A 2GHFA 2LO3A 4F6NA 2ENCA 2EOOA 1X3CA 4R2CA 2WCC3 2EL4A 1ZU1A 2EORA 2EM7A 2EPXA 4R2PA 2EN7A 4GZNC 4IJDA 2EN4A 2WBTA 1X6EA 2EPAA 2YSOA 2EP3A 2EMKA 2RSIA 5KL7A 2EOIA 2EM5A 2EMGA 1F2IG 2EM3A 4FK5C 1X5WA 2EPUA 2EQ3A 1X6HA 1A1IA 2PRTA 1A1KA 1TN9A 1G2DC 2EQ1A 2EOSA 4F2JC 1A1FA 2YSPA 2DGCA 5KL6A 2YTQA 1YSAC 2EMXA 2DRPA 1JK1A 2R1FA 2EM0A 2DMIA 2YTFA 2WBSA 2EOQA 2M9AA 1UBDC 2EOEA 2GLIA 2EOJA 2LCEA 2YU5A 1A1JA 2LV2A 3MHSC 1MEYC 2EMZA 1JK2A 2EOFA 4M9VC 1AAYA 5KL2A 1KJKA 2EN2A 4IS1C 3VHTB 2YTDA 2YTPA 2I13A 2DLQA 3M99B 1LLMC 1BBOA 2YTNA 2ENHA 1RMDA 2EQ0A 2EMAA 2EMFA 2YTOA 2VRDA 2A25A 2YRMA 5KL5A 1A1LA 1B69A 2ENAA 4R2AA 1WJPA 2YRKA 2E72A 1TF6A 5KL4A 2EMYA 2EM9A 2RPCA 1BB8A 2LVHA 2EM2A 2EE8A 1A1HA 2EN3A 2EL6A 2ELZA 2EM8A 2EOHA 2CT1A 2MKNA 2EN8A 2EMWA 2YTGA 2JPAA 3UK3C 2EMIA 1YUJA 2EM4A 3EPKA 2NABA 2D9HA 3MHHC 4R2RA 5KL3A 2JP9A 2ELYA 2YU8A 2DLKA 2EL5A 2EPRA 2EOYA 1G2FC 1X6FA 4WSGA 4R2SA 2EN6A 3EPJA 2EN1A 1P47A 1NCSA 2EPZA 2EMCA 2YTJA 1TF3A 2J7JA 1Z1BA 2YRHA 2EOZA 1UN6B 3EPLA 2EMBA 2EOXA 2EMHA
chains in the Genus database with same CATH superfamily
2YTIA 4HEIA 2EOMA 2YTEA 2WBUA 4F6MA 4AQYE 4DR4E 2EJ4A 2EPPA 2EPCA 4NHRA 4Q35B 2V8QB 2CPNA 2MC6A 2GHFA 4M2ZA 4BMJA 2BBGA 2EORA 3T1YE 1I94E 2EM7A 1GZ6A 4IJDA 2EN4A 2V87A 1X6EA 4X66E 2RSIA 4B3RE 1EH8A 1T4NA 2FTXB 2M7QA 2PRTA 2EPKX 1TN9A 1IBLE 2MC5A 4X8WA 2EPNA 4F2JC 2DGCA 1YPNA 2YTQA 3JTZA 2DRPA 3LMLA 2R1FA 4OOGC 1EH6A 2UXCE 2EPLX 4O43A 1A1JA 1MEYC 2EMZA 1EKZA 4WX9A 4M9VC 1IBME 1FKAE 1KJKA 4P7DA 3ZOQB 2YTDA 2I13A 2DLQA 2RS6A 3M99B 4BBYA 4O24A 5AE1A 2ENHA 2B3TB 4ZYDA 4LF6E 2EMAA 2YTOA 4OX9E 3F6HA 2B7TA 4DV3E 4RH8A 5FLXC 1O0WA 2L6MA 5AASA 4WFTA 4BS9A 4JI1E 2EM9A 2RPCA 2LVHA 1PJTA 4NXNE 3UK3C 4GKKE 2L3CA 2EMIA 3IWCA 2EM4A 2V86A 2D9HA 2JOBA 3MHHC 4R2RA 1IBKE 5ADZA 4DR1E 1XMQE 1EH7A 4M30A 2EZ6A 2YU8A 3C6KA 3HPZA 5A2QC 1DQ3A 4LF5E 4WSGA 2KOUA 4GKJE 4YY3E 1NCSA 3T1HE 2N3HA 2EPZA 2Q8UA 1IQOA 2FV4B 2E1MA 1RC7A 4MLVA 3THNA 2EMBA 2LUQA 4LFCE 1A1GA 4R2EA 2CTDA 1GQEA 1YFHA 3EPHA 4DR6E 1GTKA 1YUIA 4R2DA 4N4RB 1X49A 4R2QA 1MGTA 2L3JA 2CSHA 3QG5C 4GEQB 4F6NA 1PKPA 2EOOA 4R2PA 4GZNC 1J26A 4DMIA 2I9IA 5A6BA 2EMKA 2E5LE 3KWRA 2EMGA 2HC5A 2G7HA 2EPUA 2UUCE 1X6HA 1HNZE 3BGHA 4LTYA 1A1FA 1IQSA 3F6GA 4LF7E 2LRSA 2LJHA 2LTSA 4I8OA 2EMXA 1YYKA 3J81C 5IWAE 4NXME 1JK1A 5IXMB 1AH5A 2DMIA 2YTFA 2LBSB 4R8OA 2WBSA 2M9AA 1UBDC 2GLIA 1RQ0A 2EOJA 2NUFA 3P1XA 2LCEA 5AC4A 4DR2E 2K7IA 2IHR1 4WYQB 2EOFA 2EPOA 2V85A 1X48A 3VHTB 2VF1A 2YTPA 1L4SA 1PJSA 3AUZA 4HTGA 4JV5E 5AE2A 3ADLA 1RMDA 4NZVA 4DUZE 2VRDA 4JYAE 2L2KB 1SR9A 2KONA 2ODRC 2JVAA 3ECRA 1WXRA 3RMPA 4F9BB 2YRKA 2ZM6E 1IMUA 3KZYA 4DV6E 4WXCA 4JI3E 3HQ1A 1BB8A 5A6BD 1A1HA 1N33E 2EL6A 4DR7E 2CT1A 2JWOA 2EN8A 4L8NA 2EMWA 2RS7A 2LTRA 1YUJA 3EPKA 4DR3E 1YYOA 3C6MA 5KL3A 5A6AA 5LMNE 4LFBE 5LMUE 3VK6A 4ZYGA 2EL5A 1T4LB 4M0VA 2UUAE 2RSMA 2EOYA 2MDRA 4DV2E 2LUPB 4DV7E 3IWDA 1X6FA 3C4TA 1N36E 1G2FC 4F9AB 3EPJA 3OMLA 2EMCA 2YTJA 3IWBA 4BC9A 2N8XA 2YSOA 2N3GA 2JYAA 3C4BA 3ADJA 2KHXA 4X9JA 5A6JA 2VQFE 1ZBQA 3THOB 5IT9C 3ADIA 2NUEA 2B9DA 1ZR9A 1HNWE 2HGHA 1ZAAC 2LT7A 1DGCA 4Q28A 2BB8A 5CFFE 1KYQA 2ENCA 3DJWA 1X3CA 4ZYEA 3L00A 2EPXA 2EN7A 5LLQA 2UXBE 5BR8E 2EPAA 2K4VA 2EP3A 2L33A 4P78A 2HJJA 2JR1A 1QU6A 1UILA 1T39A 4O4KA 1A1IA 4JI2E 1A1KA 2EQ1A 2F8BA 1WRJA 2LJUA 5KL6A 4ZYHA 4DR5E 3J7AG 2DB2A 3EQ1A 1WHQA 4LF4E 2EPMX 2EOQA 4DKKA 2NUGA 2RQLA 3MHSC 4X64E 4TUIA 1JK2A 1QNTA 4DV4E 1AAYA 4JI6E 3J7Yp 4J8ZA 4IS1C 2UU9E 4X65E 1STUA 5A6KA 2LMZA 3HPSA 2DMYA 2YWQA 2NA2A 4JI4E 4B3SE 2FGGA 4JI8E 2A25A 3MSWA 4KWYA 3VYXA 2JY9A 4R2AA 4RHBB 5DNYA 2E72A 4DV1E 2DSYA 2HHHE 4LFAE 3J80C 2EM2A 2L2MA 3ADGA 2EN3A 5AE3A 2YPNA 2ELZA 4JI0E 2EOHA 4WXDA 2MKNA 4DV0E 3K6QA 1ZBTA 2LE2A 1DI2A 2NABA 3DF6A 4B3TE 2V88A 4X62E 5A69A 1PDAA 2V89A 2VE7C 4LF9E 1T4OA 2EN1A 3BF2A 3VYYA 1XNQE 4JI5E 1FJGE 1SFEA 1N32E 1PJQA 2YRHA 3JAMC 2EOZA 1UN6B 2EOXA 2ADRA 4DV5E 4R03A 4B3ME 4L5NC 2EMLA 2DIXA 5AC5A 2EM6A 2MKDA 4TUGA 2MDGA 2GPIA 2LO3A 1XMOE 1J5EE 4R2CA 4BC7A 2WCC3 2EL4A 1ZU1A 1XNRE 1YZ9A 4JI7E 2WBTA 5KL7A 3HXLA 2EOIA 2EM5A 4WPYA 1F2IG 2EM3A 4FK5C 1X5WA 2WZOA 2EQ3A 1HR0E 2B7VA 1G2DC 2EOSA 1NEIA 1X47A 2H36X 2JXPA 2YSPA 4WSPA 2L92A 2UUBE 4F9CB 1YSAC 3BIDA 2RTXA 2VQEE 2EM0A 2L2NA 2EWLA 2EOEA 1WHNA 2YU5A 2R76A 4KZSA 2UXDE 2LV2A 5KL2A 1YYWA 2EN2A 5TSEA 1LLMC 1BBOA 2YTNA 5IV8B 2EQ0A 3BBGA 5T6JA 4DUYE 2F4VE 2EMFA 2YZTA 1A1LA 2YRMA 4O5GA 5KL5A 1B69A 4YHHE 2ENAA 4KHPE 1N34E 1WJPA 4BHCA 4F54A 5F3WA 1TF6A 5KL4A 2EMYA 5LL6R 3AV0A 2EE8A 3H09A 2EM8A 2M1SA 2YTGA 1HNXE 2JPAA 1BBGA 4MLQA 1T38A 3TQMA 4LF8E 4K0KE 2JOXA 2M4IA 2V83A 2JP9A 2ELYA 2DLKA 3KZZA 2ODRD 3HTXA 2L8TA 3OTOE 4BCAA 2EPRA 3JU0A 1UHZA 4R2SA 2EN6A 1P47A 4LU9A 2YT4A 3FIGA 1TF3A 2J7JA 1N3GA 4BHBA 1Z1BA 3LLHA 3EPLA 2EMHA
chains in the Genus database with same CATH topology
2YTIA 2ADRA 1A1GA 4X9JA 2EOMA 2YTEA 4R2EA 2WBUA 2CTDA 2EMLA 4F6MA 3EPHA 2EJ4A 1ZR9A 2EPPA 2EPCA 2EM6A 2MKDA 4R2DA 1YUIA 2HGHA 4R2QA 1ZAAC 2MDGA 2LT7A 1DGCA 2CSHA 2BB8A 2GHFA 2LO3A 4F6NA 2ENCA 2EOOA 1X3CA 4R2CA 2WCC3 2EL4A 1ZU1A 2EORA 2EM7A 2EPXA 4R2PA 2EN7A 4GZNC 4IJDA 2EN4A 2WBTA 1X6EA 2EPAA 2YSOA 2EP3A 2EMKA 2RSIA 5KL7A 2EOIA 2EM5A 2EMGA 1F2IG 2EM3A 4FK5C 1X5WA 2EPUA 2EQ3A 1X6HA 1A1IA 2PRTA 1A1KA 1TN9A 1G2DC 2EQ1A 2EOSA 4F2JC 1A1FA 2YSPA 2DGCA 5KL6A 2YTQA 1YSAC 2EMXA 2DRPA 1JK1A 2R1FA 2EM0A 2DMIA 2YTFA 2WBSA 2EOQA 2M9AA 1UBDC 2EOEA 2GLIA 2EOJA 2LCEA 2YU5A 1A1JA 2LV2A 3MHSC 1MEYC 2EMZA 1JK2A 2EOFA 4M9VC 1AAYA 5KL2A 1KJKA 2EN2A 4IS1C 3VHTB 2YTDA 2YTPA 2I13A 2DLQA 3M99B 1LLMC 1BBOA 2YTNA 2ENHA 1RMDA 2EQ0A 2EMAA 2EMFA 2YTOA 2VRDA 2A25A 2YRMA 5KL5A 1A1LA 1B69A 2ENAA 4R2AA 1WJPA 2YRKA 2E72A 1TF6A 5KL4A 2EMYA 2EM9A 2RPCA 1BB8A 2LVHA 2EM2A 2EE8A 1A1HA 2EN3A 2EL6A 2ELZA 2EM8A 2EOHA 2CT1A 2MKNA 2EN8A 2EMWA 2YTGA 2JPAA 3UK3C 2EMIA 1YUJA 2EM4A 3EPKA 2NABA 2D9HA 3MHHC 4R2RA 5KL3A 2JP9A 2ELYA 2YU8A 2DLKA 2EL5A 2EPRA 2EOYA 1G2FC 1X6FA 4WSGA 4R2SA 2EN6A 3EPJA 2EN1A 1P47A 1NCSA 2EPZA 2EMCA 2YTJA 1TF3A 2J7JA 1Z1BA 2YRHA 2EOZA 1UN6B 3EPLA 2EMBA 2EOXA 2EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTI A;  2ADR A;  1A1G A;  4X9J A;  2EOM A;  2YTE A;  4R2E A;  2WBU A;  2CTD A;  2EML A;  4F6M A;  3EPH A;  2EJ4 A;  1ZR9 A;  2EPP A;  2EPC A;  2EM6 A;  2MKD A;  4R2D A;  1YUI A;  2HGH A;  4R2Q A;  1ZAA C;  2MDG A;  2LT7 A;  1DGC A;  2CSH A;  2BB8 A;  2GHF A;  2LO3 A;  4F6N A;  2ENC A;  2EOO A;  1X3C A;  4R2C A;  2WCC 3;  2EL4 A;  1ZU1 A;  2EOR A;  2EM7 A;  2EPX A;  4R2P A;  2EN7 A;  4GZN C;  4IJD A;  2EN4 A;  2WBT A;  1X6E A;  2EPA A;  2YSO A;  2EP3 A;  2EMK A;  2RSI A;  5KL7 A;  2EOI A;  2EM5 A;  2EMG A;  1F2I G;  2EM3 A;  4FK5 C;  1X5W A;  2EPU A;  2EQ3 A;  1X6H A;  1A1I A;  2PRT A;  1A1K A;  1TN9 A;  1G2D C;  2EQ1 A;  2EOS A;  4F2J C;  1A1F A;  2YSP A;  2DGC A;  5KL6 A;  2YTQ A;  1YSA C;  2EMX A;  2DRP A;  1JK1 A;  2R1F A;  2EM0 A;  2DMI A;  2YTF A;  2WBS A;  2EOQ A;  2M9A A;  1UBD C;  2EOE A;  2GLI A;  2EOJ A;  2LCE A;  2YU5 A;  1A1J A;  2LV2 A;  3MHS C;  1MEY C;  2EMZ A;  1JK2 A;  2EOF A;  4M9V C;  1AAY A;  5KL2 A;  1KJK A;  2EN2 A;  4IS1 C;  3VHT B;  2YTD A;  2YTP A;  2I13 A;  2DLQ A;  3M99 B;  1LLM C;  1BBO A;  2YTN A;  2ENH A;  1RMD A;  2EQ0 A;  2EMA A;  2EMF A;  2YTO A;  2VRD A;  2A25 A;  2YRM A;  5KL5 A;  1A1L A;  1B69 A;  2ENA A;  4R2A A;  1WJP A;  2YRK A;  2E72 A;  1TF6 A;  5KL4 A;  2EMY A;  2EM9 A;  2RPC A;  1BB8 A;  2LVH A;  2EM2 A;  2EE8 A;  1A1H A;  2EN3 A;  2EL6 A;  2ELZ A;  2EM8 A;  2EOH A;  2CT1 A;  2MKN A;  2EN8 A;  2EMW A;  2YTG A;  2JPA A;  3UK3 C;  2EMI A;  1YUJ A;  2EM4 A;  3EPK A;  2NAB A;  2D9H A;  3MHH C;  4R2R A;  5KL3 A;  2JP9 A;  2ELY A;  2YU8 A;  2DLK A;  2EL5 A;  2EPR A;  2EOY A;  1G2F C;  1X6F A;  4WSG A;  4R2S A;  2EN6 A;  3EPJ A;  2EN1 A;  1P47 A;  1NCS A;  2EPZ A;  2EMC A;  2YTJ A;  1TF3 A;  2J7J A;  1Z1B A;  2YRH A;  2EOZ A;  1UN6 B;  3EPL A;  2EMB A;  2EOX A;  2EMH A; 
#chains in the Genus database with same CATH topology
 2YTI A;  4HEI A;  2EOM A;  2YTE A;  2WBU A;  4F6M A;  4AQY E;  4DR4 E;  2EJ4 A;  2EPP A;  2EPC A;  4NHR A;  4Q35 B;  2V8Q B;  2CPN A;  2MC6 A;  2GHF A;  4M2Z A;  4BMJ A;  2BBG A;  2EOR A;  3T1Y E;  1I94 E;  2EM7 A;  1GZ6 A;  4IJD A;  2EN4 A;  2V87 A;  1X6E A;  4X66 E;  2RSI A;  4B3R E;  1EH8 A;  1T4N A;  2FTX B;  2M7Q A;  2PRT A;  2EPK X;  1TN9 A;  1IBL E;  2MC5 A;  4X8W A;  2EPN A;  4F2J C;  2DGC A;  1YPN A;  2YTQ A;  3JTZ A;  2DRP A;  3LML A;  2R1F A;  4OOG C;  1EH6 A;  2UXC E;  2EPL X;  4O43 A;  1A1J A;  1MEY C;  2EMZ A;  1EKZ A;  4WX9 A;  4M9V C;  1IBM E;  1FKA E;  1KJK A;  4P7D A;  3ZOQ B;  2YTD A;  2I13 A;  2DLQ A;  2RS6 A;  3M99 B;  4BBY A;  4O24 A;  5AE1 A;  2ENH A;  2B3T B;  4ZYD A;  4LF6 E;  2EMA A;  2YTO A;  4OX9 E;  3F6H A;  2B7T A;  4DV3 E;  4RH8 A;  5FLX C;  1O0W A;  2L6M A;  5AAS A;  4WFT A;  4BS9 A;  4JI1 E;  2EM9 A;  2RPC A;  2LVH A;  1PJT A;  4NXN E;  3UK3 C;  4GKK E;  2L3C A;  2EMI A;  3IWC A;  2EM4 A;  2V86 A;  2D9H A;  2JOB A;  3MHH C;  4R2R A;  1IBK E;  5ADZ A;  4DR1 E;  1XMQ E;  1EH7 A;  4M30 A;  2EZ6 A;  2YU8 A;  3C6K A;  3HPZ A;  5A2Q C;  1DQ3 A;  4LF5 E;  4WSG A;  2KOU A;  4GKJ E;  4YY3 E;  1NCS A;  3T1H E;  2N3H A;  2EPZ A;  2Q8U A;  1IQO A;  2FV4 B;  2E1M A;  1RC7 A;  4MLV A;  3THN A;  2EMB A;  2LUQ A;  4LFC E;  1A1G A;  4R2E A;  2CTD A;  1GQE A;  1YFH A;  3EPH A;  4DR6 E;  1GTK A;  1YUI A;  4R2D A;  4N4R B;  1X49 A;  4R2Q A;  1MGT A;  2L3J A;  2CSH A;  3QG5 C;  4GEQ B;  4F6N A;  1PKP A;  2EOO A;  4R2P A;  4GZN C;  1J26 A;  4DMI A;  2I9I A;  5A6B A;  2EMK A;  2E5L E;  3KWR A;  2EMG A;  2HC5 A;  2G7H A;  2EPU A;  2UUC E;  1X6H A;  1HNZ E;  3BGH A;  4LTY A;  1A1F A;  1IQS A;  3F6G A;  4LF7 E;  2LRS A;  2LJH A;  2LTS A;  4I8O A;  2EMX A;  1YYK A;  3J81 C;  5IWA E;  4NXM E;  1JK1 A;  5IXM B;  1AH5 A;  2DMI A;  2YTF A;  2LBS B;  4R8O A;  2WBS A;  2M9A A;  1UBD C;  2GLI A;  1RQ0 A;  2EOJ A;  2NUF A;  3P1X A;  2LCE A;  5AC4 A;  4DR2 E;  2K7I A;  2IHR 1;  4WYQ B;  2EOF A;  2EPO A;  2V85 A;  1X48 A;  3VHT B;  2VF1 A;  2YTP A;  1L4S A;  1PJS A;  3AUZ A;  4HTG A;  4JV5 E;  5AE2 A;  3ADL A;  1RMD A;  4NZV A;  4DUZ E;  2VRD A;  4JYA E;  2L2K B;  1SR9 A;  2KON A;  2ODR C;  2JVA A;  3ECR A;  1WXR A;  3RMP A;  4F9B B;  2YRK A;  2ZM6 E;  1IMU A;  3KZY A;  4DV6 E;  4WXC A;  4JI3 E;  3HQ1 A;  1BB8 A;  5A6B D;  1A1H A;  1N33 E;  2EL6 A;  4DR7 E;  2CT1 A;  2JWO A;  2EN8 A;  4L8N A;  2EMW A;  2RS7 A;  2LTR A;  1YUJ A;  3EPK A;  4DR3 E;  1YYO A;  3C6M A;  5KL3 A;  5A6A A;  5LMN E;  4LFB E;  5LMU E;  3VK6 A;  4ZYG A;  2EL5 A;  1T4L B;  4M0V A;  2UUA E;  2RSM A;  2EOY A;  2MDR A;  4DV2 E;  2LUP B;  4DV7 E;  3IWD A;  1X6F A;  3C4T A;  1N36 E;  1G2F C;  4F9A B;  3EPJ A;  3OML A;  2EMC A;  2YTJ A;  3IWB A;  4BC9 A;  2N8X A;  2YSO A;  2N3G A;  2JYA A;  3C4B A;  3ADJ A;  2KHX A;  4X9J A;  5A6J A;  2VQF E;  1ZBQ A;  3THO B;  5IT9 C;  3ADI A;  2NUE A;  2B9D A;  1ZR9 A;  1HNW E;  2HGH A;  1ZAA C;  2LT7 A;  1DGC A;  4Q28 A;  2BB8 A;  5CFF E;  1KYQ A;  2ENC A;  3DJW A;  1X3C A;  4ZYE A;  3L00 A;  2EPX A;  2EN7 A;  5LLQ A;  2UXB E;  5BR8 E;  2EPA A;  2K4V A;  2EP3 A;  2L33 A;  4P78 A;  2HJJ A;  2JR1 A;  1QU6 A;  1UIL A;  1T39 A;  4O4K A;  1A1I A;  4JI2 E;  1A1K A;  2EQ1 A;  2F8B A;  1WRJ A;  2LJU A;  5KL6 A;  4ZYH A;  4DR5 E;  3J7A G;  2DB2 A;  3EQ1 A;  1WHQ A;  4LF4 E;  2EPM X;  2EOQ A;  4DKK A;  2NUG A;  2RQL A;  3MHS C;  4X64 E;  4TUI A;  1JK2 A;  1QNT A;  4DV4 E;  1AAY A;  4JI6 E;  3J7Y p;  4J8Z A;  4IS1 C;  2UU9 E;  4X65 E;  1STU A;  5A6K A;  2LMZ A;  3HPS A;  2DMY A;  2YWQ A;  2NA2 A;  4JI4 E;  4B3S E;  2FGG A;  4JI8 E;  2A25 A;  3MSW A;  4KWY A;  3VYX A;  2JY9 A;  4R2A A;  4RHB B;  5DNY A;  2E72 A;  4DV1 E;  2DSY A;  2HHH E;  4LFA E;  3J80 C;  2EM2 A;  2L2M A;  3ADG A;  2EN3 A;  5AE3 A;  2YPN A;  2ELZ A;  4JI0 E;  2EOH A;  4WXD A;  2MKN A;  4DV0 E;  3K6Q A;  1ZBT A;  2LE2 A;  1DI2 A;  2NAB A;  3DF6 A;  4B3T E;  2V88 A;  4X62 E;  5A69 A;  1PDA A;  2V89 A;  2VE7 C;  4LF9 E;  1T4O A;  2EN1 A;  3BF2 A;  3VYY A;  1XNQ E;  4JI5 E;  1FJG E;  1SFE A;  1N32 E;  1PJQ A;  2YRH A;  3JAM C;  2EOZ A;  1UN6 B;  2EOX A;  2ADR A;  4DV5 E;  4R03 A;  4B3M E;  4L5N C;  2EML A;  2DIX A;  5AC5 A;  2EM6 A;  2MKD A;  4TUG A;  2MDG A;  2GPI A;  2LO3 A;  1XMO E;  1J5E E;  4R2C A;  4BC7 A;  2WCC 3;  2EL4 A;  1ZU1 A;  1XNR E;  1YZ9 A;  4JI7 E;  2WBT A;  5KL7 A;  3HXL A;  2EOI A;  2EM5 A;  4WPY A;  1F2I G;  2EM3 A;  4FK5 C;  1X5W A;  2WZO A;  2EQ3 A;  1HR0 E;  2B7V A;  1G2D C;  2EOS A;  1NEI A;  1X47 A;  2H36 X;  2JXP A;  2YSP A;  4WSP A;  2L92 A;  2UUB E;  4F9C B;  1YSA C;  3BID A;  2RTX A;  2VQE E;  2EM0 A;  2L2N A;  2EWL A;  2EOE A;  1WHN A;  2YU5 A;  2R76 A;  4KZS A;  2UXD E;  2LV2 A;  5KL2 A;  1YYW A;  2EN2 A;  5TSE A;  1LLM C;  1BBO A;  2YTN A;  5IV8 B;  2EQ0 A;  3BBG A;  5T6J A;  4DUY E;  2F4V E;  2EMF A;  2YZT A;  1A1L A;  2YRM A;  4O5G A;  5KL5 A;  1B69 A;  4YHH E;  2ENA A;  4KHP E;  1N34 E;  1WJP A;  4BHC A;  4F54 A;  5F3W A;  1TF6 A;  5KL4 A;  2EMY A;  5LL6 R;  3AV0 A;  2EE8 A;  3H09 A;  2EM8 A;  2M1S A;  2YTG A;  1HNX E;  2JPA A;  1BBG A;  4MLQ A;  1T38 A;  3TQM A;  4LF8 E;  4K0K E;  2JOX A;  2M4I A;  2V83 A;  2JP9 A;  2ELY A;  2DLK A;  3KZZ A;  2ODR D;  3HTX A;  2L8T A;  3OTO E;  4BCA A;  2EPR A;  3JU0 A;  1UHZ A;  4R2S A;  2EN6 A;  1P47 A;  4LU9 A;  2YT4 A;  3FIG A;  1TF3 A;  2J7J A;  1N3G A;  4BHB A;  1Z1B A;  3LLH A;  3EPL A;  2EMH A; 
#chains in the Genus database with same CATH homology
 2YTI A;  2ADR A;  1A1G A;  4X9J A;  2EOM A;  2YTE A;  4R2E A;  2WBU A;  2CTD A;  2EML A;  4F6M A;  3EPH A;  2EJ4 A;  1ZR9 A;  2EPP A;  2EPC A;  2EM6 A;  2MKD A;  4R2D A;  1YUI A;  2HGH A;  4R2Q A;  1ZAA C;  2MDG A;  2LT7 A;  1DGC A;  2CSH A;  2BB8 A;  2GHF A;  2LO3 A;  4F6N A;  2ENC A;  2EOO A;  1X3C A;  4R2C A;  2WCC 3;  2EL4 A;  1ZU1 A;  2EOR A;  2EM7 A;  2EPX A;  4R2P A;  2EN7 A;  4GZN C;  4IJD A;  2EN4 A;  2WBT A;  1X6E A;  2EPA A;  2YSO A;  2EP3 A;  2EMK A;  2RSI A;  5KL7 A;  2EOI A;  2EM5 A;  2EMG A;  1F2I G;  2EM3 A;  4FK5 C;  1X5W A;  2EPU A;  2EQ3 A;  1X6H A;  1A1I A;  2PRT A;  1A1K A;  1TN9 A;  1G2D C;  2EQ1 A;  2EOS A;  4F2J C;  1A1F A;  2YSP A;  2DGC A;  5KL6 A;  2YTQ A;  1YSA C;  2EMX A;  2DRP A;  1JK1 A;  2R1F A;  2EM0 A;  2DMI A;  2YTF A;  2WBS A;  2EOQ A;  2M9A A;  1UBD C;  2EOE A;  2GLI A;  2EOJ A;  2LCE A;  2YU5 A;  1A1J A;  2LV2 A;  3MHS C;  1MEY C;  2EMZ A;  1JK2 A;  2EOF A;  4M9V C;  1AAY A;  5KL2 A;  1KJK A;  2EN2 A;  4IS1 C;  3VHT B;  2YTD A;  2YTP A;  2I13 A;  2DLQ A;  3M99 B;  1LLM C;  1BBO A;  2YTN A;  2ENH A;  1RMD A;  2EQ0 A;  2EMA A;  2EMF A;  2YTO A;  2VRD A;  2A25 A;  2YRM A;  5KL5 A;  1A1L A;  1B69 A;  2ENA A;  4R2A A;  1WJP A;  2YRK A;  2E72 A;  1TF6 A;  5KL4 A;  2EMY A;  2EM9 A;  2RPC A;  1BB8 A;  2LVH A;  2EM2 A;  2EE8 A;  1A1H A;  2EN3 A;  2EL6 A;  2ELZ A;  2EM8 A;  2EOH A;  2CT1 A;  2MKN A;  2EN8 A;  2EMW A;  2YTG A;  2JPA A;  3UK3 C;  2EMI A;  1YUJ A;  2EM4 A;  3EPK A;  2NAB A;  2D9H A;  3MHH C;  4R2R A;  5KL3 A;  2JP9 A;  2ELY A;  2YU8 A;  2DLK A;  2EL5 A;  2EPR A;  2EOY A;  1G2F C;  1X6F A;  4WSG A;  4R2S A;  2EN6 A;  3EPJ A;  2EN1 A;  1P47 A;  1NCS A;  2EPZ A;  2EMC A;  2YTJ A;  1TF3 A;  2J7J A;  1Z1B A;  2YRH A;  2EOZ A;  1UN6 B;  3EPL A;  2EMB A;  2EOX A;  2EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...