1YUIA

Solution nmr structure of the gaga factor/dna complex, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yuiA00
1YUJA 2EPUA 2WCC3 2DLKA 2EMIA 2RPCA 2LT7A 2HGHA 2ELZA 2M9AA 3EPJA 2EM4A 2EOXA 1A1KA 2RSIA 2YTFA 2EN1A 4F6MA 4GZNC 1A1IA 2EM2A 1A1FA 2EMKA 2EMXA 1X6FA 2EL4A 2EPZA 2PRTA 3UK3C 1A1HA 2YTQA 2GLIA 2EPXA 1NCSA 2EOYA 2EMFA 4F2JC 2EMBA 1RMDA 2VRDA 2LO3A 1KJKA 4R2EA 2EOZA 2YTEA 2WBTA 2EOMA 1X3CA 2YTGA 1B69A 5KL5A 2EM8A 1BBOA 1JK1A 2BB8A 2WBSA 4F6NA 2YTNA 3EPKA 2A25A 2EPCA 1UN6B 2EPAA 2ENAA 1X6HA 2EL6A 2EMLA 1G2DC 2EN2A 2EMCA 1ZU1A 1AAYA 1G2FC 2YTOA 2EN3A 1TF3A 2EPPA 1BB8A 2EN7A 2EE8A 2EP3A 2YRKA 4IJDA 2WBUA 1F2IG 2EM6A 2MDGA 2EOHA 2EOOA 2GHFA 1YUIA 4IS1C 2I13A 4M9VC 2YU5A 2EOFA 1DGCA 2YU8A 4R2QA 1TN9A 2DGCA 3M99B 2EQ1A 2YSOA 2EJ4A 2LCEA 2YTDA 1P47A 4R2AA 2EMAA 2EOEA 4R2DA 2EN4A 3MHSC 2EN6A 2EMYA 2EOIA 2DLQA 2E72A 2EM0A 4WSGA 4R2PA 5KL3A 5KL4A 2CT1A 2ELYA 2YTIA 2EM5A 1WJPA 2EMWA 2YRHA 4FK5C 2ENHA 4X9JA 1A1LA 1ZAAC 2YRMA 4R2RA 2NABA 1ZR9A 2EOJA 2EQ0A 3EPLA 2J7JA 1A1JA 2YTJA 2R1FA 5KL2A 2CSHA 2EQ3A 1YSAC 3VHTB 3MHHC 2DMIA 2EMGA 2YTPA 2EM3A 4R2CA 2ENCA 1Z1BA 2MKDA 2JP9A 2EL5A 2D9HA 2EORA 1JK2A 4R2SA 2LV2A 2MKNA 2DRPA 5KL6A 5KL7A 2EM9A 2EOSA 2YSPA 2EPRA 1TF6A 2CTDA 1LLMC 1MEYC 2EMHA 2JPAA 1X6EA 2EM7A 2EMZA 2EOQA 1UBDC 1A1GA 2ADRA 3EPHA 2LVHA 2EN8A 1X5WA
chains in the Genus database with same CATH superfamily
4BHCA 3JAMC 2EPUA 5LMUE 2WCC3 1WHQA 4DV2E 4LF6E 3ADIA 2JOXA 3EPJA 1RQ0A 2RSIA 4MLQA 2EMKA 2EMXA 2EL4A 2PRTA 1STUA 5TSEA 1A1HA 2EOYA 1N32E 2V85A 3BGHA 3J81C 2VRDA 3LMLA 1KJKA 1KYQA 2CPNA 2YTEA 1WHNA 1B69A 4YHHE 3THNA 4HTGA 2YTNA 4Q35B 4WXDA 2YT4A 2ZM6E 2UUCE 1RC7A 2EPCA 1UN6B 3HTXA 2EPAA 4F54A 1PKPA 3KZZA 2EMLA 4DV1E 2F8BA 4JI7E 1G2DC 2EN3A 4DR4E 4IJDA 2WBUA 1F2IG 1YUIA 2EOOA 2I13A 5AC4A 4RHBB 4KZSA 1DGCA 2YU8A 1FKAE 4JI5E 2H36X 2EJ4A 1P47A 1IQOA 2EMAA 2L2NA 1IBME 4LFBE 2HC5A 4WSGA 2EM0A 4R2PA 4X62E 5KL4A 2DSYA 2GPIA 3T1YE 2ELYA 3VYXA 4FK5C 2EM5A 4X9JA 2ENHA 5BR8E 1YFHA 2EOJA 4GEQB 2JOBA 4DMIA 4WYQB 1BBGA 3ADJA 1A1JA 1XNQE 2R1FA 2CSHA 1GQEA 2DIXA 5A6JA 1ZBQA 2DMIA 2EM3A 2E5LE 3H09A 2EORA 2V8QB 4KHPE 4DV6E 2LRSA 2KHXA 1XMQE 1TF6A 2RS6A 1LLMC 2V87A 4ZYEA 4B3ME 1YPNA 2V89A 2DB2A 3EPHA 2LVHA 2VQFE 4JI3E 2YWQA 2LE2A 1YYOA 2L3JA 2DLKA 2HGHA 2MDRA 2ELZA 2M9AA 2KONA 2EM4A 2EOXA 1PDAA 2BBGA 1AH5A 3J7AG 4DV3E 2YTFA 1HNZE 4GZNC 3ZOQB 2UUBE 3IWDA 3J7Yp 1EH6A 3KWRA 1IMUA 4DKKA 4B3RE 3C6KA 4F2JC 1RMDA 2HJJA 2MC5A 4R2EA 4ZYHA 3RMPA 3C6MA 2EOMA 2YTGA 2RTXA 3ECRA 1GZ6A 2EM8A 1BBOA 3KZYA 2BB8A 4NXME 1GTKA 3EPKA 2M7QA 2A25A 2L2KB 1IBKE 1X6HA 4KWYA 1T4NA 2EMCA 1AAYA 2JXPA 2N3HA 2YZTA 1TF3A 1L4SA 2EE8A 2YRKA 2GHFA 1X48A 4P7DA 4IS1C 4JI6E 2NUFA 2YU5A 2EOFA 1TN9A 4YY3E 1FJGE 3IWBA 4X8WA 2V88A 1QU6A 2YSOA 3OMLA 2UXDE 5AASA 4M30A 4DUYE 4R2AA 2M1SA 2RS7A 4R2DA 3ADLA 1J5EE 2EPNA 2FV4B 3K6QA 2EOIA 2DLQA 4LU9A 2K4VA 1DQ3A 2LJUA 2CT1A 2B7VA 2EMWA 1ZAAC 1A1LA 2FGGA 2WZOA 2NABA 1ZR9A 2ODRC 3ADGA 1O0WA 1I94E 3BBGA 2V83A 5KL2A 4JI8E 1J26A 4DR3E 1YSAC 2EMGA 4DR2E 4BMJA 4WPYA 1Z1BA 2I9IA 5A6BA 2EZ6A 2D9HA 3VYYA 1JK2A 4X64E 5AE2A 2MKNA 2LTSA 4DR7E 4F9CB 1WXRA 1DI2A 2JVAA 3BF2A 2EPRA 2VQEE 1MEYC 2EMHA 1X6EA 1YYWA 4GKJE 4X66E 4O43A 2EOQA 2EPMX 1N3GA 1X5WA 4NXNE 2JY9A 1HR0E 4JI2E 1YUJA 2LBSB 3HQ1A 2LUQA 2YPNA 2L6MA 2EMIA 4JV5E 1EKZA 1UILA 5T6JA 2LMZA 4NHRA 1EH7A 2EN1A 4F6MA 1A1IA 2EM2A 2EPKX 5F3WA 1A1FA 1X6FA 2EPZA 2G7HA 1YZ9A 4L8NA 2L3CA 3UK3C 2UXCE 5A6BD 4LF5E 4P78A 2LO3A 5A69A 4L5NC 5FLXC 2EOZA 5AE1A 5A6KA 2WBTA 1X3CA 2N3GA 4LF8E 2VE7C 4I8OA 5KL5A 1JK1A 4BC7A 2WBSA 4F6NA 3F6GA 4BHBA 1PJSA 2FTXB 4LTYA 3J80C 5A2QC 2RSMA 2EN2A 4BS9A 1G2FC 2YTOA 5IWAE 1BB8A 2EN7A 2EP3A 2JWOA 4J8ZA 2EM6A 1T4OA 2EOHA 4WXCA 2VF1A 3THOB 4B3TE 4B3SE 1T39A 2DGCA 2YTDA 4TUIA 2EOEA 2RQLA 3MHSC 2EN6A 3HPSA 2M4IA 2UUAE 2E72A 2L92A 5IT9C 5KL3A 2B7TA 3AV0A 2ODRD 3HXLA 4F9AB 3JU0A 5LMNE 2UXBE 4DUZE 4GKKE 3EQ1A 5IV8B 3EPLA 3HPZA 2J7JA 2NA2A 3C4BA 2L8TA 2JYAA 1N36E 4BBYA 4JYAE 2EQ3A 2B3TB 4WFTA 3VHTB 2HHHE 4JI1E 2YTPA 4RH8A 2LJHA 2ENCA 4R2CA 4BCAA 2JP9A 2KOUA 1ZBTA 2EPOA 4R2SA 4TUGA 4BC9A 4Q28A 2NUGA 2DRPA 3AUZA 5KL6A 2EM9A 2EOSA 4HEIA 2YSPA 4M2ZA 2Q8UA 4R03A 2EMZA 2EM7A 3BIDA 4O5GA 3T1HE 2N8XA 2ADRA 2E1MA 2F4VE 1PJQA 4R8OA 2EN8A 3LLHA 5CFFE 2LUPB 3OTOE 2MC6A 2LT7A 2RPCA 4DV5E 1WRJA 1A1KA 4ZYDA 4ZYGA 3DF6A 4DV0E 4NZVA 2GLIA 2YTQA 2EPXA 4M0VA 1NCSA 2EMFA 1QNTA 2EMBA 1EH8A 4O4KA 2EWLA 4O24A 4X65E 3QG5C 1XNRE 3L00A 1HNWE 4OOGC 4MLVA 2R76A 4AQYE 3C4TA 2ENAA 2EL6A 1ZU1A 3TQMA 1YYKA 1MGTA 2EPPA 4JI4E 3IWCA 1SR9A 2MDGA 4OX9E 1N33E 3VK6A 2B9DA 1T4LB 4DR1E 4M9VC 2EPLX 1NEIA 4R2QA 3M99B 4F9BB 2EQ1A 2UU9E 1UHZA 2LCEA 2K7IA 4DR6E 1X49A 5LLQA 4K0KE 5DNYA 2EN4A 2JR1A 5AC5A 2EMYA 2L2MA 3MSWA 4N4RB 2V86A 4LF9E 1X47A 4LF7E 1IBLE 4LFAE 1HNXE 1T38A 2YTIA 1WJPA 2YRHA 5IXMB 3F6HA 2YRMA 3FIGA 4R2RA 5LL6R 3DJWA 2EQ0A 4WSPA 1PJTA 2YTJA 5ADZA 3P1XA 3MHHC 1N34E 5A6AA 4LF4E 2MKDA 4LFCE 2EL5A 4DR5E 2LTRA 4DV4E 2NUEA 2LV2A 2L33A 4DV7E 2DMYA 5KL7A 1IQSA 2CTDA 2IHR1 3JTZA 2JPAA 4JI0E 5AE3A 1XMOE 1UBDC 1A1GA 1SFEA 4WX9A
chains in the Genus database with same CATH topology
1YUJA 2EPUA 2WCC3 2DLKA 2EMIA 2RPCA 2LT7A 2HGHA 2ELZA 2M9AA 3EPJA 2EM4A 2EOXA 1A1KA 2RSIA 2YTFA 2EN1A 4F6MA 4GZNC 1A1IA 2EM2A 1A1FA 2EMKA 2EMXA 1X6FA 2EL4A 2EPZA 2PRTA 3UK3C 1A1HA 2YTQA 2GLIA 2EPXA 1NCSA 2EOYA 2EMFA 4F2JC 2EMBA 1RMDA 2VRDA 2LO3A 1KJKA 4R2EA 2EOZA 2YTEA 2WBTA 2EOMA 1X3CA 2YTGA 1B69A 5KL5A 2EM8A 1BBOA 1JK1A 2BB8A 2WBSA 4F6NA 2YTNA 3EPKA 2A25A 2EPCA 1UN6B 2EPAA 2ENAA 1X6HA 2EL6A 2EMLA 1G2DC 2EN2A 2EMCA 1ZU1A 1AAYA 1G2FC 2YTOA 2EN3A 1TF3A 2EPPA 1BB8A 2EN7A 2EE8A 2EP3A 2YRKA 4IJDA 2WBUA 1F2IG 2EM6A 2MDGA 2EOHA 2EOOA 2GHFA 1YUIA 4IS1C 2I13A 4M9VC 2YU5A 2EOFA 1DGCA 2YU8A 4R2QA 1TN9A 2DGCA 3M99B 2EQ1A 2YSOA 2EJ4A 2LCEA 2YTDA 1P47A 4R2AA 2EMAA 2EOEA 4R2DA 2EN4A 3MHSC 2EN6A 2EMYA 2EOIA 2DLQA 2E72A 2EM0A 4WSGA 4R2PA 5KL3A 5KL4A 2CT1A 2ELYA 2YTIA 2EM5A 1WJPA 2EMWA 2YRHA 4FK5C 2ENHA 4X9JA 1A1LA 1ZAAC 2YRMA 4R2RA 2NABA 1ZR9A 2EOJA 2EQ0A 3EPLA 2J7JA 1A1JA 2YTJA 2R1FA 5KL2A 2CSHA 2EQ3A 1YSAC 3VHTB 3MHHC 2DMIA 2EMGA 2YTPA 2EM3A 4R2CA 2ENCA 1Z1BA 2MKDA 2JP9A 2EL5A 2D9HA 2EORA 1JK2A 4R2SA 2LV2A 2MKNA 2DRPA 5KL6A 5KL7A 2EM9A 2EOSA 2YSPA 2EPRA 1TF6A 2CTDA 1LLMC 1MEYC 2EMHA 2JPAA 1X6EA 2EM7A 2EMZA 2EOQA 1UBDC 1A1GA 2ADRA 3EPHA 2LVHA 2EN8A 1X5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUJ A;  2EPU A;  2WCC 3;  2DLK A;  2EMI A;  2RPC A;  2LT7 A;  2HGH A;  2ELZ A;  2M9A A;  3EPJ A;  2EM4 A;  2EOX A;  1A1K A;  2RSI A;  2YTF A;  2EN1 A;  4F6M A;  4GZN C;  1A1I A;  2EM2 A;  1A1F A;  2EMK A;  2EMX A;  1X6F A;  2EL4 A;  2EPZ A;  2PRT A;  3UK3 C;  1A1H A;  2YTQ A;  2GLI A;  2EPX A;  1NCS A;  2EOY A;  2EMF A;  4F2J C;  2EMB A;  1RMD A;  2VRD A;  2LO3 A;  1KJK A;  4R2E A;  2EOZ A;  2YTE A;  2WBT A;  2EOM A;  1X3C A;  2YTG A;  1B69 A;  5KL5 A;  2EM8 A;  1BBO A;  1JK1 A;  2BB8 A;  2WBS A;  4F6N A;  2YTN A;  3EPK A;  2A25 A;  2EPC A;  1UN6 B;  2EPA A;  2ENA A;  1X6H A;  2EL6 A;  2EML A;  1G2D C;  2EN2 A;  2EMC A;  1ZU1 A;  1AAY A;  1G2F C;  2YTO A;  2EN3 A;  1TF3 A;  2EPP A;  1BB8 A;  2EN7 A;  2EE8 A;  2EP3 A;  2YRK A;  4IJD A;  2WBU A;  1F2I G;  2EM6 A;  2MDG A;  2EOH A;  2EOO A;  2GHF A;  1YUI A;  4IS1 C;  2I13 A;  4M9V C;  2YU5 A;  2EOF A;  1DGC A;  2YU8 A;  4R2Q A;  1TN9 A;  2DGC A;  3M99 B;  2EQ1 A;  2YSO A;  2EJ4 A;  2LCE A;  2YTD A;  1P47 A;  4R2A A;  2EMA A;  2EOE A;  4R2D A;  2EN4 A;  3MHS C;  2EN6 A;  2EMY A;  2EOI A;  2DLQ A;  2E72 A;  2EM0 A;  4WSG A;  4R2P A;  5KL3 A;  5KL4 A;  2CT1 A;  2ELY A;  2YTI A;  2EM5 A;  1WJP A;  2EMW A;  2YRH A;  4FK5 C;  2ENH A;  4X9J A;  1A1L A;  1ZAA C;  2YRM A;  4R2R A;  2NAB A;  1ZR9 A;  2EOJ A;  2EQ0 A;  3EPL A;  2J7J A;  1A1J A;  2YTJ A;  2R1F A;  5KL2 A;  2CSH A;  2EQ3 A;  1YSA C;  3VHT B;  3MHH C;  2DMI A;  2EMG A;  2YTP A;  2EM3 A;  4R2C A;  2ENC A;  1Z1B A;  2MKD A;  2JP9 A;  2EL5 A;  2D9H A;  2EOR A;  1JK2 A;  4R2S A;  2LV2 A;  2MKN A;  2DRP A;  5KL6 A;  5KL7 A;  2EM9 A;  2EOS A;  2YSP A;  2EPR A;  1TF6 A;  2CTD A;  1LLM C;  1MEY C;  2EMH A;  2JPA A;  1X6E A;  2EM7 A;  2EMZ A;  2EOQ A;  1UBD C;  1A1G A;  2ADR A;  3EPH A;  2LVH A;  2EN8 A;  1X5W A; 
#chains in the Genus database with same CATH topology
 4BHC A;  3JAM C;  2EPU A;  5LMU E;  2WCC 3;  1WHQ A;  4DV2 E;  4LF6 E;  3ADI A;  2JOX A;  3EPJ A;  1RQ0 A;  2RSI A;  4MLQ A;  2EMK A;  2EMX A;  2EL4 A;  2PRT A;  1STU A;  5TSE A;  1A1H A;  2EOY A;  1N32 E;  2V85 A;  3BGH A;  3J81 C;  2VRD A;  3LML A;  1KJK A;  1KYQ A;  2CPN A;  2YTE A;  1WHN A;  1B69 A;  4YHH E;  3THN A;  4HTG A;  2YTN A;  4Q35 B;  4WXD A;  2YT4 A;  2ZM6 E;  2UUC E;  1RC7 A;  2EPC A;  1UN6 B;  3HTX A;  2EPA A;  4F54 A;  1PKP A;  3KZZ A;  2EML A;  4DV1 E;  2F8B A;  4JI7 E;  1G2D C;  2EN3 A;  4DR4 E;  4IJD A;  2WBU A;  1F2I G;  1YUI A;  2EOO A;  2I13 A;  5AC4 A;  4RHB B;  4KZS A;  1DGC A;  2YU8 A;  1FKA E;  4JI5 E;  2H36 X;  2EJ4 A;  1P47 A;  1IQO A;  2EMA A;  2L2N A;  1IBM E;  4LFB E;  2HC5 A;  4WSG A;  2EM0 A;  4R2P A;  4X62 E;  5KL4 A;  2DSY A;  2GPI A;  3T1Y E;  2ELY A;  3VYX A;  4FK5 C;  2EM5 A;  4X9J A;  2ENH A;  5BR8 E;  1YFH A;  2EOJ A;  4GEQ B;  2JOB A;  4DMI A;  4WYQ B;  1BBG A;  3ADJ A;  1A1J A;  1XNQ E;  2R1F A;  2CSH A;  1GQE A;  2DIX A;  5A6J A;  1ZBQ A;  2DMI A;  2EM3 A;  2E5L E;  3H09 A;  2EOR A;  2V8Q B;  4KHP E;  4DV6 E;  2LRS A;  2KHX A;  1XMQ E;  1TF6 A;  2RS6 A;  1LLM C;  2V87 A;  4ZYE A;  4B3M E;  1YPN A;  2V89 A;  2DB2 A;  3EPH A;  2LVH A;  2VQF E;  4JI3 E;  2YWQ A;  2LE2 A;  1YYO A;  2L3J A;  2DLK A;  2HGH A;  2MDR A;  2ELZ A;  2M9A A;  2KON A;  2EM4 A;  2EOX A;  1PDA A;  2BBG A;  1AH5 A;  3J7A G;  4DV3 E;  2YTF A;  1HNZ E;  4GZN C;  3ZOQ B;  2UUB E;  3IWD A;  3J7Y p;  1EH6 A;  3KWR A;  1IMU A;  4DKK A;  4B3R E;  3C6K A;  4F2J C;  1RMD A;  2HJJ A;  2MC5 A;  4R2E A;  4ZYH A;  3RMP A;  3C6M A;  2EOM A;  2YTG A;  2RTX A;  3ECR A;  1GZ6 A;  2EM8 A;  1BBO A;  3KZY A;  2BB8 A;  4NXM E;  1GTK A;  3EPK A;  2M7Q A;  2A25 A;  2L2K B;  1IBK E;  1X6H A;  4KWY A;  1T4N A;  2EMC A;  1AAY A;  2JXP A;  2N3H A;  2YZT A;  1TF3 A;  1L4S A;  2EE8 A;  2YRK A;  2GHF A;  1X48 A;  4P7D A;  4IS1 C;  4JI6 E;  2NUF A;  2YU5 A;  2EOF A;  1TN9 A;  4YY3 E;  1FJG E;  3IWB A;  4X8W A;  2V88 A;  1QU6 A;  2YSO A;  3OML A;  2UXD E;  5AAS A;  4M30 A;  4DUY E;  4R2A A;  2M1S A;  2RS7 A;  4R2D A;  3ADL A;  1J5E E;  2EPN A;  2FV4 B;  3K6Q A;  2EOI A;  2DLQ A;  4LU9 A;  2K4V A;  1DQ3 A;  2LJU A;  2CT1 A;  2B7V A;  2EMW A;  1ZAA C;  1A1L A;  2FGG A;  2WZO A;  2NAB A;  1ZR9 A;  2ODR C;  3ADG A;  1O0W A;  1I94 E;  3BBG A;  2V83 A;  5KL2 A;  4JI8 E;  1J26 A;  4DR3 E;  1YSA C;  2EMG A;  4DR2 E;  4BMJ A;  4WPY A;  1Z1B A;  2I9I A;  5A6B A;  2EZ6 A;  2D9H A;  3VYY A;  1JK2 A;  4X64 E;  5AE2 A;  2MKN A;  2LTS A;  4DR7 E;  4F9C B;  1WXR A;  1DI2 A;  2JVA A;  3BF2 A;  2EPR A;  2VQE E;  1MEY C;  2EMH A;  1X6E A;  1YYW A;  4GKJ E;  4X66 E;  4O43 A;  2EOQ A;  2EPM X;  1N3G A;  1X5W A;  4NXN E;  2JY9 A;  1HR0 E;  4JI2 E;  1YUJ A;  2LBS B;  3HQ1 A;  2LUQ A;  2YPN A;  2L6M A;  2EMI A;  4JV5 E;  1EKZ A;  1UIL A;  5T6J A;  2LMZ A;  4NHR A;  1EH7 A;  2EN1 A;  4F6M A;  1A1I A;  2EM2 A;  2EPK X;  5F3W A;  1A1F A;  1X6F A;  2EPZ A;  2G7H A;  1YZ9 A;  4L8N A;  2L3C A;  3UK3 C;  2UXC E;  5A6B D;  4LF5 E;  4P78 A;  2LO3 A;  5A69 A;  4L5N C;  5FLX C;  2EOZ A;  5AE1 A;  5A6K A;  2WBT A;  1X3C A;  2N3G A;  4LF8 E;  2VE7 C;  4I8O A;  5KL5 A;  1JK1 A;  4BC7 A;  2WBS A;  4F6N A;  3F6G A;  4BHB A;  1PJS A;  2FTX B;  4LTY A;  3J80 C;  5A2Q C;  2RSM A;  2EN2 A;  4BS9 A;  1G2F C;  2YTO A;  5IWA E;  1BB8 A;  2EN7 A;  2EP3 A;  2JWO A;  4J8Z A;  2EM6 A;  1T4O A;  2EOH A;  4WXC A;  2VF1 A;  3THO B;  4B3T E;  4B3S E;  1T39 A;  2DGC A;  2YTD A;  4TUI A;  2EOE A;  2RQL A;  3MHS C;  2EN6 A;  3HPS A;  2M4I A;  2UUA E;  2E72 A;  2L92 A;  5IT9 C;  5KL3 A;  2B7T A;  3AV0 A;  2ODR D;  3HXL A;  4F9A B;  3JU0 A;  5LMN E;  2UXB E;  4DUZ E;  4GKK E;  3EQ1 A;  5IV8 B;  3EPL A;  3HPZ A;  2J7J A;  2NA2 A;  3C4B A;  2L8T A;  2JYA A;  1N36 E;  4BBY A;  4JYA E;  2EQ3 A;  2B3T B;  4WFT A;  3VHT B;  2HHH E;  4JI1 E;  2YTP A;  4RH8 A;  2LJH A;  2ENC A;  4R2C A;  4BCA A;  2JP9 A;  2KOU A;  1ZBT A;  2EPO A;  4R2S A;  4TUG A;  4BC9 A;  4Q28 A;  2NUG A;  2DRP A;  3AUZ A;  5KL6 A;  2EM9 A;  2EOS A;  4HEI A;  2YSP A;  4M2Z A;  2Q8U A;  4R03 A;  2EMZ A;  2EM7 A;  3BID A;  4O5G A;  3T1H E;  2N8X A;  2ADR A;  2E1M A;  2F4V E;  1PJQ A;  4R8O A;  2EN8 A;  3LLH A;  5CFF E;  2LUP B;  3OTO E;  2MC6 A;  2LT7 A;  2RPC A;  4DV5 E;  1WRJ A;  1A1K A;  4ZYD A;  4ZYG A;  3DF6 A;  4DV0 E;  4NZV A;  2GLI A;  2YTQ A;  2EPX A;  4M0V A;  1NCS A;  2EMF A;  1QNT A;  2EMB A;  1EH8 A;  4O4K A;  2EWL A;  4O24 A;  4X65 E;  3QG5 C;  1XNR E;  3L00 A;  1HNW E;  4OOG C;  4MLV A;  2R76 A;  4AQY E;  3C4T A;  2ENA A;  2EL6 A;  1ZU1 A;  3TQM A;  1YYK A;  1MGT A;  2EPP A;  4JI4 E;  3IWC A;  1SR9 A;  2MDG A;  4OX9 E;  1N33 E;  3VK6 A;  2B9D A;  1T4L B;  4DR1 E;  4M9V C;  2EPL X;  1NEI A;  4R2Q A;  3M99 B;  4F9B B;  2EQ1 A;  2UU9 E;  1UHZ A;  2LCE A;  2K7I A;  4DR6 E;  1X49 A;  5LLQ A;  4K0K E;  5DNY A;  2EN4 A;  2JR1 A;  5AC5 A;  2EMY A;  2L2M A;  3MSW A;  4N4R B;  2V86 A;  4LF9 E;  1X47 A;  4LF7 E;  1IBL E;  4LFA E;  1HNX E;  1T38 A;  2YTI A;  1WJP A;  2YRH A;  5IXM B;  3F6H A;  2YRM A;  3FIG A;  4R2R A;  5LL6 R;  3DJW A;  2EQ0 A;  4WSP A;  1PJT A;  2YTJ A;  5ADZ A;  3P1X A;  3MHH C;  1N34 E;  5A6A A;  4LF4 E;  2MKD A;  4LFC E;  2EL5 A;  4DR5 E;  2LTR A;  4DV4 E;  2NUE A;  2LV2 A;  2L33 A;  4DV7 E;  2DMY A;  5KL7 A;  1IQS A;  2CTD A;  2IHR 1;  3JTZ A;  2JPA A;  4JI0 E;  5AE3 A;  1XMO E;  1UBD C;  1A1G A;  1SFE A;  4WX9 A; 
#chains in the Genus database with same CATH homology
 1YUJ A;  2EPU A;  2WCC 3;  2DLK A;  2EMI A;  2RPC A;  2LT7 A;  2HGH A;  2ELZ A;  2M9A A;  3EPJ A;  2EM4 A;  2EOX A;  1A1K A;  2RSI A;  2YTF A;  2EN1 A;  4F6M A;  4GZN C;  1A1I A;  2EM2 A;  1A1F A;  2EMK A;  2EMX A;  1X6F A;  2EL4 A;  2EPZ A;  2PRT A;  3UK3 C;  1A1H A;  2YTQ A;  2GLI A;  2EPX A;  1NCS A;  2EOY A;  2EMF A;  4F2J C;  2EMB A;  1RMD A;  2VRD A;  2LO3 A;  1KJK A;  4R2E A;  2EOZ A;  2YTE A;  2WBT A;  2EOM A;  1X3C A;  2YTG A;  1B69 A;  5KL5 A;  2EM8 A;  1BBO A;  1JK1 A;  2BB8 A;  2WBS A;  4F6N A;  2YTN A;  3EPK A;  2A25 A;  2EPC A;  1UN6 B;  2EPA A;  2ENA A;  1X6H A;  2EL6 A;  2EML A;  1G2D C;  2EN2 A;  2EMC A;  1ZU1 A;  1AAY A;  1G2F C;  2YTO A;  2EN3 A;  1TF3 A;  2EPP A;  1BB8 A;  2EN7 A;  2EE8 A;  2EP3 A;  2YRK A;  4IJD A;  2WBU A;  1F2I G;  2EM6 A;  2MDG A;  2EOH A;  2EOO A;  2GHF A;  1YUI A;  4IS1 C;  2I13 A;  4M9V C;  2YU5 A;  2EOF A;  1DGC A;  2YU8 A;  4R2Q A;  1TN9 A;  2DGC A;  3M99 B;  2EQ1 A;  2YSO A;  2EJ4 A;  2LCE A;  2YTD A;  1P47 A;  4R2A A;  2EMA A;  2EOE A;  4R2D A;  2EN4 A;  3MHS C;  2EN6 A;  2EMY A;  2EOI A;  2DLQ A;  2E72 A;  2EM0 A;  4WSG A;  4R2P A;  5KL3 A;  5KL4 A;  2CT1 A;  2ELY A;  2YTI A;  2EM5 A;  1WJP A;  2EMW A;  2YRH A;  4FK5 C;  2ENH A;  4X9J A;  1A1L A;  1ZAA C;  2YRM A;  4R2R A;  2NAB A;  1ZR9 A;  2EOJ A;  2EQ0 A;  3EPL A;  2J7J A;  1A1J A;  2YTJ A;  2R1F A;  5KL2 A;  2CSH A;  2EQ3 A;  1YSA C;  3VHT B;  3MHH C;  2DMI A;  2EMG A;  2YTP A;  2EM3 A;  4R2C A;  2ENC A;  1Z1B A;  2MKD A;  2JP9 A;  2EL5 A;  2D9H A;  2EOR A;  1JK2 A;  4R2S A;  2LV2 A;  2MKN A;  2DRP A;  5KL6 A;  5KL7 A;  2EM9 A;  2EOS A;  2YSP A;  2EPR A;  1TF6 A;  2CTD A;  1LLM C;  1MEY C;  2EMH A;  2JPA A;  1X6E A;  2EM7 A;  2EMZ A;  2EOQ A;  1UBD C;  1A1G A;  2ADR A;  3EPH A;  2LVH A;  2EN8 A;  1X5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...