1YUIA

Solution nmr structure of the gaga factor/dna complex, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yuiA00
2EL4A 2CTDA 4M9VC 2YTJA 2LT7A 1ZU1A 2JP9A 2CT1A 2EMIA 2WBSA 2EN1A 4R2RA 2EOXA 2VRDA 2YRMA 4R2QA 2R1FA 4WSGA 2EN8A 2EN4A 3EPLA 2EMGA 2WBUA 2YTPA 1P47A 5KL4A 2YRKA 2EM7A 2YSOA 2EL6A 2EPXA 2MKDA 2MDGA 1WJPA 1X6HA 2YTIA 1A1HA 2A25A 1ZAAC 2EMFA 2YTQA 1B69A 2DGCA 2ENCA 1ZR9A 1YUJA 4X9JA 1A1GA 1LLMC 2EPUA 2I13A 2RSIA 1NCSA 2EN7A 2ADRA 2EM2A 2YU5A 2EJ4A 5KL3A 4R2DA 2EMHA 2ENAA 4F2JC 2ELYA 2JPAA 2EQ1A 2EM5A 2EMYA 2EM3A 2EQ3A 2RPCA 2YRHA 2YSPA 1A1KA 2EPCA 2M9AA 1A1LA 2EMCA 2EOZA 3M99B 2YTFA 2DRPA 3UK3C 1RMDA 2GLIA 3VHTB 2YTOA 1TN9A 1BB8A 2CSHA 4R2PA 3MHSC 4GZNC 2LVHA 2LV2A 1F2IG 2EMBA 1TF6A 2E72A 2YTGA 4IS1C 2HGHA 2EOIA 1MEYC 2EOEA 2WCC3 2EQ0A 1BBOA 2EMZA 2EPPA 1A1JA 2EM6A 2EMKA 2J7JA 2ELZA 1A1FA 1YUIA 2YU8A 4R2AA 2EP3A 5KL5A 1UBDC 2EN6A 1X3CA 4R2SA 2YTDA 2EN3A 2DLKA 2EL5A 2EPAA 4F6NA 3EPKA 2EM9A 2MKNA 2EOSA 3MHHC 2EMXA 1UN6B 2LO3A 1JK1A 5KL6A 4R2EA 2DMIA 1G2DC 1G2FC 2EOJA 5KL2A 4F6MA 3EPHA 2YTNA 4R2CA 4FK5C 2EOHA 2YTEA 2EOFA 2EM8A 2EMAA 2EOMA 1X6EA 2BB8A 1YSAC 1X6FA 1JK2A 2ENHA 2GHFA 1A1IA 3EPJA 2EM0A 2EOQA 2EPZA 2EMLA 2EN2A 2EORA 4IJDA 1TF3A 2NABA 1X5WA 1Z1BA 2EM4A 2EOYA 2EMWA 5KL7A 2PRTA 1DGCA 1KJKA 2EOOA 1AAYA 2EE8A 2EPRA 2DLQA 2WBTA 2LCEA 2D9HA
chains in the Genus database with same CATH superfamily
2WZOA 3HPZA 2EL4A 1N3GA 2EMIA 1X49A 4R2RA 3HXLA 2VRDA 2G7HA 2YRMA 2R1FA 4WSGA 3EPLA 2EMGA 2JOXA 2DIXA 2MKDA 3JAMC 2GPIA 2HHHE 2YZTA 2DGCA 2ENCA 1A1GA 2DMYA 1IQOA 4X65E 3ADIA 4BMJA 1X48A 1NCSA 2EM2A 2YU5A 4DV2E 2LTRA 3BF2A 2EMHA 3J7Yp 2FV4B 4BHBA 2EZ6A 2JPAA 2EMYA 1T38A 5ADZA 3DJWA 2RPCA 2YSPA 2EMCA 3OMLA 2YTFA 4BS9A 2DRPA 2IHR1 2YWQA 2GLIA 2UXCE 1IBKE 1PJQA 1N33E 1F2IG 2HC5A 2EOIA 1J26A 2EOEA 2EQ0A 1BBOA 4DUZE 2EMKA 1BBGA 2J7JA 3J80C 4DR5E 2CPNA 4R2SA 2UUCE 2K7IA 1T4OA 2EN3A 1PDAA 1XNQE 1UHZA 1PJTA 1GZ6A 2EPAA 3C4TA 2B7TA 5FLXC 4RH8A 4BC9A 1JK1A 1SR9A 2V87A 4DV4E 4JI7E 1ZBQA 4JYAE 3VYYA 2NUEA 1STUA 1WXRA 4LF5E 3AUZA 4R2CA 4DR2E 2EMAA 1X6EA 2M4IA 1X6FA 1IBME 2EOQA 4ZYEA 2EMLA 2EORA 4IJDA 3DF6A 2JVAA 1EH6A 1Z1BA 2EPLX 2EOYA 5KL7A 1DGCA 2N3GA 5BR8E 4F9BB 5A6BD 4P78A 1EH7A 4M30A 2YTJA 1ZU1A 4GEQB 4JI3E 2EN1A 1T4NA 4X66E 4I8OA 2EN4A 2WBUA 2YTPA 4KWYA 5KL4A 2UXDE 2EL6A 4WFTA 4R8OA 2MDGA 4M0VA 4KHPE 2A25A 5AC4A 1ZAAC 1FJGE 2YTQA 2EWLA 2RTXA 4RHBB 4LFBE 4GKJE 3L00A 3J81C 3JU0A 1QNTA 4OOGC 5IV8B 2VF1A 2EJ4A 4R2DA 4BCAA 4K0KE 3RMPA 2EQ3A 2YRHA 1A1KA 1A1LA 2DB2A 4JI6E 2EOZA 4LF4E 3MSWA 2YPNA 5A6BA 3IWDA 3HQ1A 2FGGA 3VHTB 4DUYE 4BHCA 2E5LE 2ODRD 2YTOA 4HTGA 4R2PA 3MHSC 4Q35B 2HGHA 2LV2A 3ADGA 2LTSA 1TF6A 4IS1C 2MC5A 2KOUA 2WCC3 1WHQA 1A1JA 2EM6A 5IT9C 4JI1E 4LTYA 2ELZA 1WRJA 4LF8E 3BGHA 4JI5E 1UBDC 2L33A 3P1XA 1T4LB 4TUIA 5A6AA 3C6KA 3ZOQB 5A6JA 3THNA 5DNYA 2EM9A 2L2KB 1L4SA 3MHHC 2EMXA 1UN6B 2LO3A 3VK6A 1HNZE 4R2EA 1RC7A 4JI4E 2EOJA 2YT4A 2V85A 5KL2A 4WYQB 5CFFE 4LFAE 2EPMX 4R03A 3EPHA 4DR6E 4MLVA 2H36X 4WXDA 4YHHE 4FK5C 2EOHA 2EOFA 1FKAE 2JY9A 1JK2A 2V83A 2MDRA 3EPJA 4GKKE 3JTZA 2JWOA 2LRSA 2NABA 3LLHA 3TQMA 2M7QA 2EMWA 2RS7A 4TUGA 2PRTA 1GTKA 2DSYA 1XNRE 4NXNE 1KJKA 4DV0E 4AQYE 1EH8A 2DLQA 2F8BA 4X8WA 3VYXA 3QG5C 4L8NA 4JI0E 2CTDA 3IWCA 2LT7A 2CT1A 4MLQA 4DR3E 4R2QA 2N8XA 4B3SE 2EN8A 2UUAE 5F3WA 2YRKA 1YFHA 1RQ0A 4JI2E 5LLQA 1NEIA 1X6HA 4X62E 5LMNE 2LMZA 4ZYHA 2EMFA 3ADLA 1ZBTA 1SFEA 2JOBA 2F4VE 1LLMC 2L3JA 4Q28A 5AE2A 2EN7A 2ADRA 4DR4E 4KZSA 1KYQA 5KL3A 2ENAA 2VE7C 3C4BA 2ELYA 4P7DA 2EM5A 2ODRC 3F6HA 1IQSA 2EM3A 1YYOA 1WHNA 2L6MA 1DQ3A 2EPCA 2V88A 3UK3C 3LMLA 5TSEA 2N3HA 2UUBE 3HPSA 2BBGA 1TN9A 1BB8A 2CSHA 5A69A 2LVHA 1HNXE 2E72A 2YTGA 1I94E 1MEYC 5AASA 2JYAA 1X47A 5LL6R 2UU9E 2YU8A 4WXCA 2EP3A 4O24A 2EN6A 1X3CA 2YTDA 2DLKA 2RSMA 2EL5A 4DKKA 4F6NA 3C6MA 2L2NA 3FIGA 2EOSA 4DV3E 5A6KA 3KZYA 2DMIA 4NZVA 1YYWA 3IWBA 1AH5A 2L8TA 2V89A 2YTNA 1T39A 3T1HE 1YPNA 2ENHA 2GHFA 2EM0A 2EN2A 4O4KA 2RS6A 4JV5E 1YZ9A 3HTXA 4LF9E 3BBGA 2EOOA 2L2MA 2EE8A 4DV5E 1YYKA 2K4VA 2M1SA 2WBTA 2LCEA 2D9HA 4M9VC 2JP9A 2WBSA 2JR1A 2EOXA 5A2QC 4NXME 1P47A 2YSOA 2EM7A 2EPXA 2E1MA 1EKZA 1WJPA 4LF6E 2LBSB 2YTIA 1A1HA 2B7VA 1B69A 4NHRA 5AE1A 1IBLE 2MC6A 1ZR9A 1YUJA 3J7AG 2LUPB 4X9JA 4J8ZA 5IWAE 4B3ME 2EPUA 2I13A 2HJJA 2RSIA 4O5GA 1O0WA 3ADJA 1HR0E 2UXBE 2LJUA 4B3TE 3BIDA 4F2JC 2EQ1A 2LE2A 3OTOE 2Q8UA 2M9AA 4DV6E 1GQEA 3M99B 1MGTA 4N4RB 5IXMB 1RMDA 4DR7E 2NUGA 2KHXA 3F6GA 4WX9A 4GZNC 2ZM6E 2EMBA 2JXPA 4LFCE 3THOB 4ZYGA 4L5NC 1HNWE 2VQFE 2EMZA 4X64E 2EPPA 1N32E 4F54A 3AV0A 4F9AB 3KWRA 1A1FA 1YUIA 4R2AA 5KL5A 4ZYDA 2L3CA 2NA2A 2B3TB 2R76A 1IMUA 1J5EE 3EQ1A 2EPKX 4F9CB 4O43A 2RQLA 2NUFA 2FTXB 3EPKA 3K6QA 4JI8E 4OX9E 2MKNA 5T6JA 2I9IA 3H09A 5KL6A 1G2DC 5AC5A 4DR1E 1UILA 4DMIA 1G2FC 4DV7E 2V8QB 1DI2A 5AE3A 4F6MA 4HEIA 2EPOA 2B9DA 2YTEA 2EM8A 3T1YE 1XMOE 4B3RE 2EOMA 2BB8A 1YSAC 4LU9A 4YY3E 1A1IA 1N34E 4M2ZA 2EPZA 1QU6A 1XMQE 1TF3A 2LJHA 1X5WA 4DV1E 2EM4A 2KONA 1N36E 2EPNA 4BBYA 1PJSA 2L92A 4WPYA 4LF7E 2LUQA 4BC7A 1PKPA 2VQEE 1AAYA 2EPRA 2V86A 4WSPA 5LMUE 3KZZA 3ECRA
chains in the Genus database with same CATH topology
2EL4A 2CTDA 4M9VC 2YTJA 2LT7A 1ZU1A 2JP9A 2CT1A 2EMIA 2WBSA 2EN1A 4R2RA 2EOXA 2VRDA 2YRMA 4R2QA 2R1FA 4WSGA 2EN8A 2EN4A 3EPLA 2EMGA 2WBUA 2YTPA 1P47A 5KL4A 2YRKA 2EM7A 2YSOA 2EL6A 2EPXA 2MKDA 2MDGA 1WJPA 1X6HA 2YTIA 1A1HA 2A25A 1ZAAC 2EMFA 2YTQA 1B69A 2DGCA 2ENCA 1ZR9A 1YUJA 4X9JA 1A1GA 1LLMC 2EPUA 2I13A 2RSIA 1NCSA 2EN7A 2ADRA 2EM2A 2YU5A 2EJ4A 5KL3A 4R2DA 2EMHA 2ENAA 4F2JC 2ELYA 2JPAA 2EQ1A 2EM5A 2EMYA 2EM3A 2EQ3A 2RPCA 2YRHA 2YSPA 1A1KA 2EPCA 2M9AA 1A1LA 2EMCA 2EOZA 3M99B 2YTFA 2DRPA 3UK3C 1RMDA 2GLIA 3VHTB 2YTOA 1TN9A 1BB8A 2CSHA 4R2PA 3MHSC 4GZNC 2LVHA 2LV2A 1F2IG 2EMBA 1TF6A 2E72A 2YTGA 4IS1C 2HGHA 2EOIA 1MEYC 2EOEA 2WCC3 2EQ0A 1BBOA 2EMZA 2EPPA 1A1JA 2EM6A 2EMKA 2J7JA 2ELZA 1A1FA 1YUIA 2YU8A 4R2AA 2EP3A 5KL5A 1UBDC 2EN6A 1X3CA 4R2SA 2YTDA 2EN3A 2DLKA 2EL5A 2EPAA 4F6NA 3EPKA 2EM9A 2MKNA 2EOSA 3MHHC 2EMXA 1UN6B 2LO3A 1JK1A 5KL6A 4R2EA 2DMIA 1G2DC 1G2FC 2EOJA 5KL2A 4F6MA 3EPHA 2YTNA 4R2CA 4FK5C 2EOHA 2YTEA 2EOFA 2EM8A 2EMAA 2EOMA 1X6EA 2BB8A 1YSAC 1X6FA 1JK2A 2ENHA 2GHFA 1A1IA 3EPJA 2EM0A 2EOQA 2EPZA 2EMLA 2EN2A 2EORA 4IJDA 1TF3A 2NABA 1X5WA 1Z1BA 2EM4A 2EOYA 2EMWA 5KL7A 2PRTA 1DGCA 1KJKA 2EOOA 1AAYA 2EE8A 2EPRA 2DLQA 2WBTA 2LCEA 2D9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL4 A;  2CTD A;  4M9V C;  2YTJ A;  2LT7 A;  1ZU1 A;  2JP9 A;  2CT1 A;  2EMI A;  2WBS A;  2EN1 A;  4R2R A;  2EOX A;  2VRD A;  2YRM A;  4R2Q A;  2R1F A;  4WSG A;  2EN8 A;  2EN4 A;  3EPL A;  2EMG A;  2WBU A;  2YTP A;  1P47 A;  5KL4 A;  2YRK A;  2EM7 A;  2YSO A;  2EL6 A;  2EPX A;  2MKD A;  2MDG A;  1WJP A;  1X6H A;  2YTI A;  1A1H A;  2A25 A;  1ZAA C;  2EMF A;  2YTQ A;  1B69 A;  2DGC A;  2ENC A;  1ZR9 A;  1YUJ A;  4X9J A;  1A1G A;  1LLM C;  2EPU A;  2I13 A;  2RSI A;  1NCS A;  2EN7 A;  2ADR A;  2EM2 A;  2YU5 A;  2EJ4 A;  5KL3 A;  4R2D A;  2EMH A;  2ENA A;  4F2J C;  2ELY A;  2JPA A;  2EQ1 A;  2EM5 A;  2EMY A;  2EM3 A;  2EQ3 A;  2RPC A;  2YRH A;  2YSP A;  1A1K A;  2EPC A;  2M9A A;  1A1L A;  2EMC A;  2EOZ A;  3M99 B;  2YTF A;  2DRP A;  3UK3 C;  1RMD A;  2GLI A;  3VHT B;  2YTO A;  1TN9 A;  1BB8 A;  2CSH A;  4R2P A;  3MHS C;  4GZN C;  2LVH A;  2LV2 A;  1F2I G;  2EMB A;  1TF6 A;  2E72 A;  2YTG A;  4IS1 C;  2HGH A;  2EOI A;  1MEY C;  2EOE A;  2WCC 3;  2EQ0 A;  1BBO A;  2EMZ A;  2EPP A;  1A1J A;  2EM6 A;  2EMK A;  2J7J A;  2ELZ A;  1A1F A;  1YUI A;  2YU8 A;  4R2A A;  2EP3 A;  5KL5 A;  1UBD C;  2EN6 A;  1X3C A;  4R2S A;  2YTD A;  2EN3 A;  2DLK A;  2EL5 A;  2EPA A;  4F6N A;  3EPK A;  2EM9 A;  2MKN A;  2EOS A;  3MHH C;  2EMX A;  1UN6 B;  2LO3 A;  1JK1 A;  5KL6 A;  4R2E A;  2DMI A;  1G2D C;  1G2F C;  2EOJ A;  5KL2 A;  4F6M A;  3EPH A;  2YTN A;  4R2C A;  4FK5 C;  2EOH A;  2YTE A;  2EOF A;  2EM8 A;  2EMA A;  2EOM A;  1X6E A;  2BB8 A;  1YSA C;  1X6F A;  1JK2 A;  2ENH A;  2GHF A;  1A1I A;  3EPJ A;  2EM0 A;  2EOQ A;  2EPZ A;  2EML A;  2EN2 A;  2EOR A;  4IJD A;  1TF3 A;  2NAB A;  1X5W A;  1Z1B A;  2EM4 A;  2EOY A;  2EMW A;  5KL7 A;  2PRT A;  1DGC A;  1KJK A;  2EOO A;  1AAY A;  2EE8 A;  2EPR A;  2DLQ A;  2WBT A;  2LCE A;  2D9H A; 
#chains in the Genus database with same CATH topology
 2WZO A;  3HPZ A;  2EL4 A;  1N3G A;  2EMI A;  1X49 A;  4R2R A;  3HXL A;  2VRD A;  2G7H A;  2YRM A;  2R1F A;  4WSG A;  3EPL A;  2EMG A;  2JOX A;  2DIX A;  2MKD A;  3JAM C;  2GPI A;  2HHH E;  2YZT A;  2DGC A;  2ENC A;  1A1G A;  2DMY A;  1IQO A;  4X65 E;  3ADI A;  4BMJ A;  1X48 A;  1NCS A;  2EM2 A;  2YU5 A;  4DV2 E;  2LTR A;  3BF2 A;  2EMH A;  3J7Y p;  2FV4 B;  4BHB A;  2EZ6 A;  2JPA A;  2EMY A;  1T38 A;  5ADZ A;  3DJW A;  2RPC A;  2YSP A;  2EMC A;  3OML A;  2YTF A;  4BS9 A;  2DRP A;  2IHR 1;  2YWQ A;  2GLI A;  2UXC E;  1IBK E;  1PJQ A;  1N33 E;  1F2I G;  2HC5 A;  2EOI A;  1J26 A;  2EOE A;  2EQ0 A;  1BBO A;  4DUZ E;  2EMK A;  1BBG A;  2J7J A;  3J80 C;  4DR5 E;  2CPN A;  4R2S A;  2UUC E;  2K7I A;  1T4O A;  2EN3 A;  1PDA A;  1XNQ E;  1UHZ A;  1PJT A;  1GZ6 A;  2EPA A;  3C4T A;  2B7T A;  5FLX C;  4RH8 A;  4BC9 A;  1JK1 A;  1SR9 A;  2V87 A;  4DV4 E;  4JI7 E;  1ZBQ A;  4JYA E;  3VYY A;  2NUE A;  1STU A;  1WXR A;  4LF5 E;  3AUZ A;  4R2C A;  4DR2 E;  2EMA A;  1X6E A;  2M4I A;  1X6F A;  1IBM E;  2EOQ A;  4ZYE A;  2EML A;  2EOR A;  4IJD A;  3DF6 A;  2JVA A;  1EH6 A;  1Z1B A;  2EPL X;  2EOY A;  5KL7 A;  1DGC A;  2N3G A;  5BR8 E;  4F9B B;  5A6B D;  4P78 A;  1EH7 A;  4M30 A;  2YTJ A;  1ZU1 A;  4GEQ B;  4JI3 E;  2EN1 A;  1T4N A;  4X66 E;  4I8O A;  2EN4 A;  2WBU A;  2YTP A;  4KWY A;  5KL4 A;  2UXD E;  2EL6 A;  4WFT A;  4R8O A;  2MDG A;  4M0V A;  4KHP E;  2A25 A;  5AC4 A;  1ZAA C;  1FJG E;  2YTQ A;  2EWL A;  2RTX A;  4RHB B;  4LFB E;  4GKJ E;  3L00 A;  3J81 C;  3JU0 A;  1QNT A;  4OOG C;  5IV8 B;  2VF1 A;  2EJ4 A;  4R2D A;  4BCA A;  4K0K E;  3RMP A;  2EQ3 A;  2YRH A;  1A1K A;  1A1L A;  2DB2 A;  4JI6 E;  2EOZ A;  4LF4 E;  3MSW A;  2YPN A;  5A6B A;  3IWD A;  3HQ1 A;  2FGG A;  3VHT B;  4DUY E;  4BHC A;  2E5L E;  2ODR D;  2YTO A;  4HTG A;  4R2P A;  3MHS C;  4Q35 B;  2HGH A;  2LV2 A;  3ADG A;  2LTS A;  1TF6 A;  4IS1 C;  2MC5 A;  2KOU A;  2WCC 3;  1WHQ A;  1A1J A;  2EM6 A;  5IT9 C;  4JI1 E;  4LTY A;  2ELZ A;  1WRJ A;  4LF8 E;  3BGH A;  4JI5 E;  1UBD C;  2L33 A;  3P1X A;  1T4L B;  4TUI A;  5A6A A;  3C6K A;  3ZOQ B;  5A6J A;  3THN A;  5DNY A;  2EM9 A;  2L2K B;  1L4S A;  3MHH C;  2EMX A;  1UN6 B;  2LO3 A;  3VK6 A;  1HNZ E;  4R2E A;  1RC7 A;  4JI4 E;  2EOJ A;  2YT4 A;  2V85 A;  5KL2 A;  4WYQ B;  5CFF E;  4LFA E;  2EPM X;  4R03 A;  3EPH A;  4DR6 E;  4MLV A;  2H36 X;  4WXD A;  4YHH E;  4FK5 C;  2EOH A;  2EOF A;  1FKA E;  2JY9 A;  1JK2 A;  2V83 A;  2MDR A;  3EPJ A;  4GKK E;  3JTZ A;  2JWO A;  2LRS A;  2NAB A;  3LLH A;  3TQM A;  2M7Q A;  2EMW A;  2RS7 A;  4TUG A;  2PRT A;  1GTK A;  2DSY A;  1XNR E;  4NXN E;  1KJK A;  4DV0 E;  4AQY E;  1EH8 A;  2DLQ A;  2F8B A;  4X8W A;  3VYX A;  3QG5 C;  4L8N A;  4JI0 E;  2CTD A;  3IWC A;  2LT7 A;  2CT1 A;  4MLQ A;  4DR3 E;  4R2Q A;  2N8X A;  4B3S E;  2EN8 A;  2UUA E;  5F3W A;  2YRK A;  1YFH A;  1RQ0 A;  4JI2 E;  5LLQ A;  1NEI A;  1X6H A;  4X62 E;  5LMN E;  2LMZ A;  4ZYH A;  2EMF A;  3ADL A;  1ZBT A;  1SFE A;  2JOB A;  2F4V E;  1LLM C;  2L3J A;  4Q28 A;  5AE2 A;  2EN7 A;  2ADR A;  4DR4 E;  4KZS A;  1KYQ A;  5KL3 A;  2ENA A;  2VE7 C;  3C4B A;  2ELY A;  4P7D A;  2EM5 A;  2ODR C;  3F6H A;  1IQS A;  2EM3 A;  1YYO A;  1WHN A;  2L6M A;  1DQ3 A;  2EPC A;  2V88 A;  3UK3 C;  3LML A;  5TSE A;  2N3H A;  2UUB E;  3HPS A;  2BBG A;  1TN9 A;  1BB8 A;  2CSH A;  5A69 A;  2LVH A;  1HNX E;  2E72 A;  2YTG A;  1I94 E;  1MEY C;  5AAS A;  2JYA A;  1X47 A;  5LL6 R;  2UU9 E;  2YU8 A;  4WXC A;  2EP3 A;  4O24 A;  2EN6 A;  1X3C A;  2YTD A;  2DLK A;  2RSM A;  2EL5 A;  4DKK A;  4F6N A;  3C6M A;  2L2N A;  3FIG A;  2EOS A;  4DV3 E;  5A6K A;  3KZY A;  2DMI A;  4NZV A;  1YYW A;  3IWB A;  1AH5 A;  2L8T A;  2V89 A;  2YTN A;  1T39 A;  3T1H E;  1YPN A;  2ENH A;  2GHF A;  2EM0 A;  2EN2 A;  4O4K A;  2RS6 A;  4JV5 E;  1YZ9 A;  3HTX A;  4LF9 E;  3BBG A;  2EOO A;  2L2M A;  2EE8 A;  4DV5 E;  1YYK A;  2K4V A;  2M1S A;  2WBT A;  2LCE A;  2D9H A;  4M9V C;  2JP9 A;  2WBS A;  2JR1 A;  2EOX A;  5A2Q C;  4NXM E;  1P47 A;  2YSO A;  2EM7 A;  2EPX A;  2E1M A;  1EKZ A;  1WJP A;  4LF6 E;  2LBS B;  2YTI A;  1A1H A;  2B7V A;  1B69 A;  4NHR A;  5AE1 A;  1IBL E;  2MC6 A;  1ZR9 A;  1YUJ A;  3J7A G;  2LUP B;  4X9J A;  4J8Z A;  5IWA E;  4B3M E;  2EPU A;  2I13 A;  2HJJ A;  2RSI A;  4O5G A;  1O0W A;  3ADJ A;  1HR0 E;  2UXB E;  2LJU A;  4B3T E;  3BID A;  4F2J C;  2EQ1 A;  2LE2 A;  3OTO E;  2Q8U A;  2M9A A;  4DV6 E;  1GQE A;  3M99 B;  1MGT A;  4N4R B;  5IXM B;  1RMD A;  4DR7 E;  2NUG A;  2KHX A;  3F6G A;  4WX9 A;  4GZN C;  2ZM6 E;  2EMB A;  2JXP A;  4LFC E;  3THO B;  4ZYG A;  4L5N C;  1HNW E;  2VQF E;  2EMZ A;  4X64 E;  2EPP A;  1N32 E;  4F54 A;  3AV0 A;  4F9A B;  3KWR A;  1A1F A;  1YUI A;  4R2A A;  5KL5 A;  4ZYD A;  2L3C A;  2NA2 A;  2B3T B;  2R76 A;  1IMU A;  1J5E E;  3EQ1 A;  2EPK X;  4F9C B;  4O43 A;  2RQL A;  2NUF A;  2FTX B;  3EPK A;  3K6Q A;  4JI8 E;  4OX9 E;  2MKN A;  5T6J A;  2I9I A;  3H09 A;  5KL6 A;  1G2D C;  5AC5 A;  4DR1 E;  1UIL A;  4DMI A;  1G2F C;  4DV7 E;  2V8Q B;  1DI2 A;  5AE3 A;  4F6M A;  4HEI A;  2EPO A;  2B9D A;  2YTE A;  2EM8 A;  3T1Y E;  1XMO E;  4B3R E;  2EOM A;  2BB8 A;  1YSA C;  4LU9 A;  4YY3 E;  1A1I A;  1N34 E;  4M2Z A;  2EPZ A;  1QU6 A;  1XMQ E;  1TF3 A;  2LJH A;  1X5W A;  4DV1 E;  2EM4 A;  2KON A;  1N36 E;  2EPN A;  4BBY A;  1PJS A;  2L92 A;  4WPY A;  4LF7 E;  2LUQ A;  4BC7 A;  1PKP A;  2VQE E;  1AAY A;  2EPR A;  2V86 A;  4WSP A;  5LMU E;  3KZZ A;  3ECR A; 
#chains in the Genus database with same CATH homology
 2EL4 A;  2CTD A;  4M9V C;  2YTJ A;  2LT7 A;  1ZU1 A;  2JP9 A;  2CT1 A;  2EMI A;  2WBS A;  2EN1 A;  4R2R A;  2EOX A;  2VRD A;  2YRM A;  4R2Q A;  2R1F A;  4WSG A;  2EN8 A;  2EN4 A;  3EPL A;  2EMG A;  2WBU A;  2YTP A;  1P47 A;  5KL4 A;  2YRK A;  2EM7 A;  2YSO A;  2EL6 A;  2EPX A;  2MKD A;  2MDG A;  1WJP A;  1X6H A;  2YTI A;  1A1H A;  2A25 A;  1ZAA C;  2EMF A;  2YTQ A;  1B69 A;  2DGC A;  2ENC A;  1ZR9 A;  1YUJ A;  4X9J A;  1A1G A;  1LLM C;  2EPU A;  2I13 A;  2RSI A;  1NCS A;  2EN7 A;  2ADR A;  2EM2 A;  2YU5 A;  2EJ4 A;  5KL3 A;  4R2D A;  2EMH A;  2ENA A;  4F2J C;  2ELY A;  2JPA A;  2EQ1 A;  2EM5 A;  2EMY A;  2EM3 A;  2EQ3 A;  2RPC A;  2YRH A;  2YSP A;  1A1K A;  2EPC A;  2M9A A;  1A1L A;  2EMC A;  2EOZ A;  3M99 B;  2YTF A;  2DRP A;  3UK3 C;  1RMD A;  2GLI A;  3VHT B;  2YTO A;  1TN9 A;  1BB8 A;  2CSH A;  4R2P A;  3MHS C;  4GZN C;  2LVH A;  2LV2 A;  1F2I G;  2EMB A;  1TF6 A;  2E72 A;  2YTG A;  4IS1 C;  2HGH A;  2EOI A;  1MEY C;  2EOE A;  2WCC 3;  2EQ0 A;  1BBO A;  2EMZ A;  2EPP A;  1A1J A;  2EM6 A;  2EMK A;  2J7J A;  2ELZ A;  1A1F A;  1YUI A;  2YU8 A;  4R2A A;  2EP3 A;  5KL5 A;  1UBD C;  2EN6 A;  1X3C A;  4R2S A;  2YTD A;  2EN3 A;  2DLK A;  2EL5 A;  2EPA A;  4F6N A;  3EPK A;  2EM9 A;  2MKN A;  2EOS A;  3MHH C;  2EMX A;  1UN6 B;  2LO3 A;  1JK1 A;  5KL6 A;  4R2E A;  2DMI A;  1G2D C;  1G2F C;  2EOJ A;  5KL2 A;  4F6M A;  3EPH A;  2YTN A;  4R2C A;  4FK5 C;  2EOH A;  2YTE A;  2EOF A;  2EM8 A;  2EMA A;  2EOM A;  1X6E A;  2BB8 A;  1YSA C;  1X6F A;  1JK2 A;  2ENH A;  2GHF A;  1A1I A;  3EPJ A;  2EM0 A;  2EOQ A;  2EPZ A;  2EML A;  2EN2 A;  2EOR A;  4IJD A;  1TF3 A;  2NAB A;  1X5W A;  1Z1B A;  2EM4 A;  2EOY A;  2EMW A;  5KL7 A;  2PRT A;  1DGC A;  1KJK A;  2EOO A;  1AAY A;  2EE8 A;  2EPR A;  2DLQ A;  2WBT A;  2LCE A;  2D9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...