1YUIA

Solution nmr structure of the gaga factor/dna complex, regularized mean structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*CP*GP*AP*GP*AP*GP*TP*AP*C)-3')
publication title The solution structure of a specific GAGA factor-DNA complex reveals a modular binding mode.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09237 GAGA GAGA factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1yuiA00
2EOSA 2YTDA 2I13A 2EPAA 2YRHA 1MEYC 2EL4A 4M9VC 1JK2A 2YSOA 2WBUA 3M99B 4R2QA 4R2AA 1F2IG 4R2CA 2EN3A 1LLMC 2LO3A 2ENHA 2EMWA 2EN8A 2EPZA 2LV2A 1YUIA 4R2PA 1X6FA 2EPCA 4F6MA 2EJ4A 3EPHA 2EOXA 3VHTB 1RMDA 2LVHA 4R2RA 2EM0A 2EOFA 1DGCA 2EN4A 2EMCA 2EOJA 2YTOA 2CTDA 2YTEA 2DMIA 2YSPA 4IS1C 1KJKA 2EOMA 2HGHA 2EP3A 2WBSA 2EQ3A 1A1LA 1JK1A 5KL3A 2YTFA 1B69A 2CT1A 2RSIA 5KL6A 2EM7A 2VRDA 2EN1A 1A1HA 2EMIA 2BB8A 4F2JC 2EMAA 1A1GA 2YU5A 2EPRA 1WJPA 2ELYA 2ENAA 1X5WA 3MHSC 2M9AA 1ZAAC 2EQ1A 4FK5C 4F6NA 1A1JA 2YU8A 2YRMA 1BBOA 1UN6B 4R2DA 4GZNC 2DGCA 1X6EA 2EMZA 2MKNA 2EMKA 1A1IA 2EPXA 2EE8A 3EPKA 1A1FA 2ELZA 1X3CA 2R1FA 1Z1BA 2EMHA 1YSAC 2YTGA 2PRTA 1YUJA 2YTIA 5KL4A 2D9HA 2YTPA 4R2SA 2GLIA 3MHHC 2LCEA 2DLQA 2EOQA 2EM2A 2EOHA 2EMLA 2EM6A 2EL6A 2EMXA 2EM5A 2EM3A 2EL5A 2NABA 5KL2A 2LT7A 2EPUA 1TF6A 1G2DC 2DRPA 2J7JA 1ZR9A 2YTJA 4WSGA 3UK3C 2EMGA 2EOYA 2MDGA 2EMBA 2EOZA 2EOEA 2EOOA 1BB8A 2RPCA 5KL5A 2JP9A 2E72A 4X9JA 2ENCA 2EMYA 1P47A 2WBTA 2MKDA 2JPAA 5KL7A 1TF3A 2EN7A 4IJDA 2CSHA 2EOIA 2EQ0A 1UBDC 3EPJA 1G2FC 2YRKA 2YTNA 2ADRA 2EM8A 1TN9A 2EM4A 2DLKA 2EMFA 2EORA 1ZU1A 2EM9A 2EPPA 2EN2A 4R2EA 1NCSA 1AAYA 2A25A 3EPLA 2YTQA 2GHFA 1A1KA 1X6HA 2EN6A 2WCC3
chains in the Genus database with same CATH superfamily
4X62E 1FKAE 2YTDA 2KOUA 4F9CB 5LLQA 1MEYC 4WXCA 2YSOA 4Q35B 4WX9A 3M99B 4R2QA 4B3ME 4KHPE 2ODRC 3EQ1A 1KYQA 4NXNE 2ENHA 2EN8A 5ADZA 3K6QA 2V83A 2EPCA 4F6MA 3THOB 3DJWA 4R8OA 2EOXA 3VHTB 1RMDA 2LVHA 2EOJA 3J80C 2CTDA 1N3GA 1YPNA 1WHNA 2EPOA 1KJKA 4LFCE 1PJSA 2HGHA 4LU9A 1IQOA 4MLVA 2HHHE 1N36E 2EM7A 2VRDA 2EN1A 3TQMA 1X48A 4B3RE 1X47A 2NUEA 3MSWA 2M9AA 3C4TA 4F6NA 2YU8A 3J7AG 1NEIA 1EH6A 5LMUE 4R2DA 4L5NC 2EMZA 1IBME 1J5EE 2KHXA 4BBYA 5A6BA 1AH5A 5A6JA 5A2QC 4OOGC 1A1IA 2EWLA 2EE8A 3EPKA 4JI1E 2ELZA 1X3CA 4LF8E 1RQ0A 4LF4E 3ZOQB 4DR3E 3ADGA 4R2SA 2DLQA 2EOQA 4JV5E 5AC4A 2UUCE 2LT7A 3IWCA 2EL6A 2EM5A 2EL5A 2UU9E 2B3TB 4R03A 2H36X 2YWQA 3ECRA 1QNTA 4DR2E 1YFHA 2EMBA 4O5GA 4I8OA 2EOOA 1BB8A 5IXMB 5IWAE 4BS9A 2E72A 1WRJA 4X9JA 5LL6R 2MKDA 2NA2A 2CSHA 1N34E 1UILA 2ADRA 1T39A 2EMFA 4F54A 1ZU1A 2EM9A 2UXBE 2RTXA 4JI2E 2YZTA 1WHQA 4R2EA 5IV8B 4O43A 2GHFA 4F9AB 2L33A 2K7IA 5CFFE 2UXCE 1JK1A 2GPIA 2M7QA 2EPAA 4DV7E 2V8QB 4ZYDA 1F2IG 3ADJA 4BMJA 2MC5A 2EPZA 2L92A 2N3HA 2ODRD 3BBGA 1RC7A 1T4LB 4NZVA 3EPHA 2EM0A 4LFBE 4DV5E 1DGCA 2F8BA 2EN4A 1EH7A 5TSEA 1SR9A 2YSPA 1HR0E 2BBGA 5A6AA 3ADIA 2LUQA 2CT1A 2RSIA 2B7TA 2DSYA 1N32E 1YYOA 2EMAA 2LJHA 2M4IA 2Q8UA 1XMOE 1SFEA 4Q28A 4WXDA 4DV0E 5T6JA 1X5WA 4YY3E 3MHSC 1IBLE 3OTOE 4DR5E 4GZNC 4DR7E 2L2KB 2EMKA 2EPXA 1BBGA 3KZYA 1T4NA 4O24A 3KWRA 5BR8E 1YUJA 2I9IA 2YTIA 5KL4A 2D9HA 2L8TA 1STUA 1T4OA 1QU6A 2EM2A 2EOHA 2L2NA 5KL2A 2EMXA 2EM3A 4DUYE 2RSMA 1G2DC 2DRPA 2J7JA 3AUZA 4P78A 1XNQE 5LMNE 2YTJA 3UK3C 4LFAE 5A6KA 3FIGA 4X65E 2LTSA 3C6MA 2ENCA 2EMYA 3F6HA 4X8WA 1ZBQA 4M0VA 3EPJA 2YTNA 4GEQB 2LBSB 1TN9A 2DLKA 1GZ6A 2L6MA 2LRSA 3JAMC 2CPNA 4ZYGA 1L4SA 2EN2A 1NCSA 4BC7A 3F6GA 2YT4A 2YTQA 3P1XA 1A1KA 1GQEA 2EN6A 4X66E 2LMZA 3BIDA 2VQEE 3C6KA 4LF7E 4LF6E 2FV4B 2DMYA 2N8XA 4TUIA 2YRHA 2EL4A 2NUFA 4R2CA 2LJUA 1LLMC 2LO3A 3RMPA 5AE2A 3LLHA 3BGHA 3ADLA 4R2PA 2LE2A 2EJ4A 4JI5E 4R2RA 2JY9A 2EOFA 2YTOA 4DV6E 4IS1C 5A6BD 2N3GA 1HNXE 3T1HE 4RHBB 4TUGA 1B69A 2JWOA 5KL6A 2DIXA 1HNZE 1A1HA 2BB8A 2MDRA 1YYWA 4F2JC 2NUGA 5DNYA 2YU5A 2EPRA 4DR1E 2ENAA 3H09A 1ZAAC 1WXRA 5IT9C 4KWYA 1YZ9A 2V85A 1UN6B 3HQ1A 2V88A 2LUPB 1X6EA 1EKZA 4BC9A 4BHBA 1A1FA 3VYYA 1ZBTA 2EMHA 1YSAC 3C4BA 4LTYA 1N33E 2MC6A 3BF2A 1O0WA 5AE1A 4GKKE 2LCEA 4JI6E 4M30A 4ZYEA 4BCAA 2EM6A 2NABA 2E1MA 1TF6A 2RS7A 1ZR9A 2L3JA 4JI0E 2EMGA 2MDGA 4LF9E 4NHRA 3IWDA 1UHZA 4DV2E 4JI4E 4RH8A 5AC5A 2R76A 5AASA 4NXME 4JI7E 2JOXA 2EZ6A 2V89A 3THNA 4M2ZA 2RQLA 5KL7A 2IHR1 1X49A 4IJDA 2JR1A 2EOIA 2EQ0A 2FTXB 3LMLA 1DI2A 2YRKA 2RS6A 4JI3E 4X64E 4O4KA 4K0KE 4WSPA 1FJGE 3HPZA 4KZSA 2K4VA 4LF5E 4JYAE 2VQFE 2EPPA 4YHHE 2I13A 1X6HA 2WCC3 2EOSA 4F9BB 2EPNA 1IMUA 4M9VC 1JK2A 2WBUA 4HTGA 2B7VA 4R2AA 2L3CA 4B3TE 4DV1E 4DMIA 2EN3A 3JU0A 4WYQB 1EH8A 2EMWA 2LV2A 4J8ZA 4AQYE 2EPKX 1YUIA 1X6FA 2EPMX 2WZOA 2M1SA 1YYKA 4DUZE 2G7HA 1PJQA 2JXPA 2EMCA 2YTEA 5FLXC 2DMIA 3HPSA 2EOMA 2EP3A 2LTRA 2WBSA 2ZM6E 2UXDE 2EQ3A 1A1LA 5KL3A 2YTFA 2L2MA 1J26A 4DV4E 3OMLA 4WFTA 3J7Yp 1IBKE 2EMIA 4L8NA 3HXLA 2YPNA 1A1GA 1WJPA 2ELYA 3L00A 2JOBA 3T1YE 2FGGA 1GTKA 1T38A 4N4RB 2UUBE 2EQ1A 4FK5C 1A1JA 1XMQE 3KZZA 2YRMA 3DF6A 2DGCA 1HNWE 2MKNA 2V87A 2B9DA 2UUAE 1PJTA 4DV3E 2R1FA 1Z1BA 2HC5A 2YTGA 2HJJA 2PRTA 3AV0A 2YTPA 2GLIA 3MHHC 1DQ3A 4JI8E 2EMLA 3IWBA 1P47A 1BBOA 2JYAA 2EPUA 2VF1A 2KONA 4WSGA 4HEIA 2EOYA 4B3SE 4MLQA 3QG5C 5F3WA 2EOZA 2EOEA 4ZYHA 2V86A 1PDAA 2RPCA 3J81C 5AE3A 5KL5A 2F4VE 2JP9A 1MGTA 2JVAA 2E5LE 1IQSA 1PKPA 2EPLX 2WBTA 2JPAA 1I94E 3VYXA 1TF3A 2EN7A 4DR4E 4GKJE 1UBDC 4BHCA 3JTZA 1G2FC 5A69A 2EM8A 2EM4A 4OX9E 3HTXA 1XNRE 2EORA 2VE7C 4P7DA 4DKKA 2DB2A 3VK6A 4WPYA 2A25A 3EPLA 1AAYA 4DR6E
chains in the Genus database with same CATH topology
2EOSA 2YTDA 2I13A 2EPAA 2YRHA 1MEYC 2EL4A 4M9VC 1JK2A 2YSOA 2WBUA 3M99B 4R2QA 4R2AA 1F2IG 4R2CA 2EN3A 1LLMC 2LO3A 2ENHA 2EMWA 2EN8A 2EPZA 2LV2A 1YUIA 4R2PA 1X6FA 2EPCA 4F6MA 2EJ4A 3EPHA 2EOXA 3VHTB 1RMDA 2LVHA 4R2RA 2EM0A 2EOFA 1DGCA 2EN4A 2EMCA 2EOJA 2YTOA 2CTDA 2YTEA 2DMIA 2YSPA 4IS1C 1KJKA 2EOMA 2HGHA 2EP3A 2WBSA 2EQ3A 1A1LA 1JK1A 5KL3A 2YTFA 1B69A 2CT1A 2RSIA 5KL6A 2EM7A 2VRDA 2EN1A 1A1HA 2EMIA 2BB8A 4F2JC 2EMAA 1A1GA 2YU5A 2EPRA 1WJPA 2ELYA 2ENAA 1X5WA 3MHSC 2M9AA 1ZAAC 2EQ1A 4FK5C 4F6NA 1A1JA 2YU8A 2YRMA 1BBOA 1UN6B 4R2DA 4GZNC 2DGCA 1X6EA 2EMZA 2MKNA 2EMKA 1A1IA 2EPXA 2EE8A 3EPKA 1A1FA 2ELZA 1X3CA 2R1FA 1Z1BA 2EMHA 1YSAC 2YTGA 2PRTA 1YUJA 2YTIA 5KL4A 2D9HA 2YTPA 4R2SA 2GLIA 3MHHC 2LCEA 2DLQA 2EOQA 2EM2A 2EOHA 2EMLA 2EM6A 2EL6A 2EMXA 2EM5A 2EM3A 2EL5A 2NABA 5KL2A 2LT7A 2EPUA 1TF6A 1G2DC 2DRPA 2J7JA 1ZR9A 2YTJA 4WSGA 3UK3C 2EMGA 2EOYA 2MDGA 2EMBA 2EOZA 2EOEA 2EOOA 1BB8A 2RPCA 5KL5A 2JP9A 2E72A 4X9JA 2ENCA 2EMYA 1P47A 2WBTA 2MKDA 2JPAA 5KL7A 1TF3A 2EN7A 4IJDA 2CSHA 2EOIA 2EQ0A 1UBDC 3EPJA 1G2FC 2YRKA 2YTNA 2ADRA 2EM8A 1TN9A 2EM4A 2DLKA 2EMFA 2EORA 1ZU1A 2EM9A 2EPPA 2EN2A 4R2EA 1NCSA 1AAYA 2A25A 3EPLA 2YTQA 2GHFA 1A1KA 1X6HA 2EN6A 2WCC3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOS A;  2YTD A;  2I13 A;  2EPA A;  2YRH A;  1MEY C;  2EL4 A;  4M9V C;  1JK2 A;  2YSO A;  2WBU A;  3M99 B;  4R2Q A;  4R2A A;  1F2I G;  4R2C A;  2EN3 A;  1LLM C;  2LO3 A;  2ENH A;  2EMW A;  2EN8 A;  2EPZ A;  2LV2 A;  1YUI A;  4R2P A;  1X6F A;  2EPC A;  4F6M A;  2EJ4 A;  3EPH A;  2EOX A;  3VHT B;  1RMD A;  2LVH A;  4R2R A;  2EM0 A;  2EOF A;  1DGC A;  2EN4 A;  2EMC A;  2EOJ A;  2YTO A;  2CTD A;  2YTE A;  2DMI A;  2YSP A;  4IS1 C;  1KJK A;  2EOM A;  2HGH A;  2EP3 A;  2WBS A;  2EQ3 A;  1A1L A;  1JK1 A;  5KL3 A;  2YTF A;  1B69 A;  2CT1 A;  2RSI A;  5KL6 A;  2EM7 A;  2VRD A;  2EN1 A;  1A1H A;  2EMI A;  2BB8 A;  4F2J C;  2EMA A;  1A1G A;  2YU5 A;  2EPR A;  1WJP A;  2ELY A;  2ENA A;  1X5W A;  3MHS C;  2M9A A;  1ZAA C;  2EQ1 A;  4FK5 C;  4F6N A;  1A1J A;  2YU8 A;  2YRM A;  1BBO A;  1UN6 B;  4R2D A;  4GZN C;  2DGC A;  1X6E A;  2EMZ A;  2MKN A;  2EMK A;  1A1I A;  2EPX A;  2EE8 A;  3EPK A;  1A1F A;  2ELZ A;  1X3C A;  2R1F A;  1Z1B A;  2EMH A;  1YSA C;  2YTG A;  2PRT A;  1YUJ A;  2YTI A;  5KL4 A;  2D9H A;  2YTP A;  4R2S A;  2GLI A;  3MHH C;  2LCE A;  2DLQ A;  2EOQ A;  2EM2 A;  2EOH A;  2EML A;  2EM6 A;  2EL6 A;  2EMX A;  2EM5 A;  2EM3 A;  2EL5 A;  2NAB A;  5KL2 A;  2LT7 A;  2EPU A;  1TF6 A;  1G2D C;  2DRP A;  2J7J A;  1ZR9 A;  2YTJ A;  4WSG A;  3UK3 C;  2EMG A;  2EOY A;  2MDG A;  2EMB A;  2EOZ A;  2EOE A;  2EOO A;  1BB8 A;  2RPC A;  5KL5 A;  2JP9 A;  2E72 A;  4X9J A;  2ENC A;  2EMY A;  1P47 A;  2WBT A;  2MKD A;  2JPA A;  5KL7 A;  1TF3 A;  2EN7 A;  4IJD A;  2CSH A;  2EOI A;  2EQ0 A;  1UBD C;  3EPJ A;  1G2F C;  2YRK A;  2YTN A;  2ADR A;  2EM8 A;  1TN9 A;  2EM4 A;  2DLK A;  2EMF A;  2EOR A;  1ZU1 A;  2EM9 A;  2EPP A;  2EN2 A;  4R2E A;  1NCS A;  1AAY A;  2A25 A;  3EPL A;  2YTQ A;  2GHF A;  1A1K A;  1X6H A;  2EN6 A;  2WCC 3; 
#chains in the Genus database with same CATH topology
 4X62 E;  1FKA E;  2YTD A;  2KOU A;  4F9C B;  5LLQ A;  1MEY C;  4WXC A;  2YSO A;  4Q35 B;  4WX9 A;  3M99 B;  4R2Q A;  4B3M E;  4KHP E;  2ODR C;  3EQ1 A;  1KYQ A;  4NXN E;  2ENH A;  2EN8 A;  5ADZ A;  3K6Q A;  2V83 A;  2EPC A;  4F6M A;  3THO B;  3DJW A;  4R8O A;  2EOX A;  3VHT B;  1RMD A;  2LVH A;  2EOJ A;  3J80 C;  2CTD A;  1N3G A;  1YPN A;  1WHN A;  2EPO A;  1KJK A;  4LFC E;  1PJS A;  2HGH A;  4LU9 A;  1IQO A;  4MLV A;  2HHH E;  1N36 E;  2EM7 A;  2VRD A;  2EN1 A;  3TQM A;  1X48 A;  4B3R E;  1X47 A;  2NUE A;  3MSW A;  2M9A A;  3C4T A;  4F6N A;  2YU8 A;  3J7A G;  1NEI A;  1EH6 A;  5LMU E;  4R2D A;  4L5N C;  2EMZ A;  1IBM E;  1J5E E;  2KHX A;  4BBY A;  5A6B A;  1AH5 A;  5A6J A;  5A2Q C;  4OOG C;  1A1I A;  2EWL A;  2EE8 A;  3EPK A;  4JI1 E;  2ELZ A;  1X3C A;  4LF8 E;  1RQ0 A;  4LF4 E;  3ZOQ B;  4DR3 E;  3ADG A;  4R2S A;  2DLQ A;  2EOQ A;  4JV5 E;  5AC4 A;  2UUC E;  2LT7 A;  3IWC A;  2EL6 A;  2EM5 A;  2EL5 A;  2UU9 E;  2B3T B;  4R03 A;  2H36 X;  2YWQ A;  3ECR A;  1QNT A;  4DR2 E;  1YFH A;  2EMB A;  4O5G A;  4I8O A;  2EOO A;  1BB8 A;  5IXM B;  5IWA E;  4BS9 A;  2E72 A;  1WRJ A;  4X9J A;  5LL6 R;  2MKD A;  2NA2 A;  2CSH A;  1N34 E;  1UIL A;  2ADR A;  1T39 A;  2EMF A;  4F54 A;  1ZU1 A;  2EM9 A;  2UXB E;  2RTX A;  4JI2 E;  2YZT A;  1WHQ A;  4R2E A;  5IV8 B;  4O43 A;  2GHF A;  4F9A B;  2L33 A;  2K7I A;  5CFF E;  2UXC E;  1JK1 A;  2GPI A;  2M7Q A;  2EPA A;  4DV7 E;  2V8Q B;  4ZYD A;  1F2I G;  3ADJ A;  4BMJ A;  2MC5 A;  2EPZ A;  2L92 A;  2N3H A;  2ODR D;  3BBG A;  1RC7 A;  1T4L B;  4NZV A;  3EPH A;  2EM0 A;  4LFB E;  4DV5 E;  1DGC A;  2F8B A;  2EN4 A;  1EH7 A;  5TSE A;  1SR9 A;  2YSP A;  1HR0 E;  2BBG A;  5A6A A;  3ADI A;  2LUQ A;  2CT1 A;  2RSI A;  2B7T A;  2DSY A;  1N32 E;  1YYO A;  2EMA A;  2LJH A;  2M4I A;  2Q8U A;  1XMO E;  1SFE A;  4Q28 A;  4WXD A;  4DV0 E;  5T6J A;  1X5W A;  4YY3 E;  3MHS C;  1IBL E;  3OTO E;  4DR5 E;  4GZN C;  4DR7 E;  2L2K B;  2EMK A;  2EPX A;  1BBG A;  3KZY A;  1T4N A;  4O24 A;  3KWR A;  5BR8 E;  1YUJ A;  2I9I A;  2YTI A;  5KL4 A;  2D9H A;  2L8T A;  1STU A;  1T4O A;  1QU6 A;  2EM2 A;  2EOH A;  2L2N A;  5KL2 A;  2EMX A;  2EM3 A;  4DUY E;  2RSM A;  1G2D C;  2DRP A;  2J7J A;  3AUZ A;  4P78 A;  1XNQ E;  5LMN E;  2YTJ A;  3UK3 C;  4LFA E;  5A6K A;  3FIG A;  4X65 E;  2LTS A;  3C6M A;  2ENC A;  2EMY A;  3F6H A;  4X8W A;  1ZBQ A;  4M0V A;  3EPJ A;  2YTN A;  4GEQ B;  2LBS B;  1TN9 A;  2DLK A;  1GZ6 A;  2L6M A;  2LRS A;  3JAM C;  2CPN A;  4ZYG A;  1L4S A;  2EN2 A;  1NCS A;  4BC7 A;  3F6G A;  2YT4 A;  2YTQ A;  3P1X A;  1A1K A;  1GQE A;  2EN6 A;  4X66 E;  2LMZ A;  3BID A;  2VQE E;  3C6K A;  4LF7 E;  4LF6 E;  2FV4 B;  2DMY A;  2N8X A;  4TUI A;  2YRH A;  2EL4 A;  2NUF A;  4R2C A;  2LJU A;  1LLM C;  2LO3 A;  3RMP A;  5AE2 A;  3LLH A;  3BGH A;  3ADL A;  4R2P A;  2LE2 A;  2EJ4 A;  4JI5 E;  4R2R A;  2JY9 A;  2EOF A;  2YTO A;  4DV6 E;  4IS1 C;  5A6B D;  2N3G A;  1HNX E;  3T1H E;  4RHB B;  4TUG A;  1B69 A;  2JWO A;  5KL6 A;  2DIX A;  1HNZ E;  1A1H A;  2BB8 A;  2MDR A;  1YYW A;  4F2J C;  2NUG A;  5DNY A;  2YU5 A;  2EPR A;  4DR1 E;  2ENA A;  3H09 A;  1ZAA C;  1WXR A;  5IT9 C;  4KWY A;  1YZ9 A;  2V85 A;  1UN6 B;  3HQ1 A;  2V88 A;  2LUP B;  1X6E A;  1EKZ A;  4BC9 A;  4BHB A;  1A1F A;  3VYY A;  1ZBT A;  2EMH A;  1YSA C;  3C4B A;  4LTY A;  1N33 E;  2MC6 A;  3BF2 A;  1O0W A;  5AE1 A;  4GKK E;  2LCE A;  4JI6 E;  4M30 A;  4ZYE A;  4BCA A;  2EM6 A;  2NAB A;  2E1M A;  1TF6 A;  2RS7 A;  1ZR9 A;  2L3J A;  4JI0 E;  2EMG A;  2MDG A;  4LF9 E;  4NHR A;  3IWD A;  1UHZ A;  4DV2 E;  4JI4 E;  4RH8 A;  5AC5 A;  2R76 A;  5AAS A;  4NXM E;  4JI7 E;  2JOX A;  2EZ6 A;  2V89 A;  3THN A;  4M2Z A;  2RQL A;  5KL7 A;  2IHR 1;  1X49 A;  4IJD A;  2JR1 A;  2EOI A;  2EQ0 A;  2FTX B;  3LML A;  1DI2 A;  2YRK A;  2RS6 A;  4JI3 E;  4X64 E;  4O4K A;  4K0K E;  4WSP A;  1FJG E;  3HPZ A;  4KZS A;  2K4V A;  4LF5 E;  4JYA E;  2VQF E;  2EPP A;  4YHH E;  2I13 A;  1X6H A;  2WCC 3;  2EOS A;  4F9B B;  2EPN A;  1IMU A;  4M9V C;  1JK2 A;  2WBU A;  4HTG A;  2B7V A;  4R2A A;  2L3C A;  4B3T E;  4DV1 E;  4DMI A;  2EN3 A;  3JU0 A;  4WYQ B;  1EH8 A;  2EMW A;  2LV2 A;  4J8Z A;  4AQY E;  2EPK X;  1YUI A;  1X6F A;  2EPM X;  2WZO A;  2M1S A;  1YYK A;  4DUZ E;  2G7H A;  1PJQ A;  2JXP A;  2EMC A;  2YTE A;  5FLX C;  2DMI A;  3HPS A;  2EOM A;  2EP3 A;  2LTR A;  2WBS A;  2ZM6 E;  2UXD E;  2EQ3 A;  1A1L A;  5KL3 A;  2YTF A;  2L2M A;  1J26 A;  4DV4 E;  3OML A;  4WFT A;  3J7Y p;  1IBK E;  2EMI A;  4L8N A;  3HXL A;  2YPN A;  1A1G A;  1WJP A;  2ELY A;  3L00 A;  2JOB A;  3T1Y E;  2FGG A;  1GTK A;  1T38 A;  4N4R B;  2UUB E;  2EQ1 A;  4FK5 C;  1A1J A;  1XMQ E;  3KZZ A;  2YRM A;  3DF6 A;  2DGC A;  1HNW E;  2MKN A;  2V87 A;  2B9D A;  2UUA E;  1PJT A;  4DV3 E;  2R1F A;  1Z1B A;  2HC5 A;  2YTG A;  2HJJ A;  2PRT A;  3AV0 A;  2YTP A;  2GLI A;  3MHH C;  1DQ3 A;  4JI8 E;  2EML A;  3IWB A;  1P47 A;  1BBO A;  2JYA A;  2EPU A;  2VF1 A;  2KON A;  4WSG A;  4HEI A;  2EOY A;  4B3S E;  4MLQ A;  3QG5 C;  5F3W A;  2EOZ A;  2EOE A;  4ZYH A;  2V86 A;  1PDA A;  2RPC A;  3J81 C;  5AE3 A;  5KL5 A;  2F4V E;  2JP9 A;  1MGT A;  2JVA A;  2E5L E;  1IQS A;  1PKP A;  2EPL X;  2WBT A;  2JPA A;  1I94 E;  3VYX A;  1TF3 A;  2EN7 A;  4DR4 E;  4GKJ E;  1UBD C;  4BHC A;  3JTZ A;  1G2F C;  5A69 A;  2EM8 A;  2EM4 A;  4OX9 E;  3HTX A;  1XNR E;  2EOR A;  2VE7 C;  4P7D A;  4DKK A;  2DB2 A;  3VK6 A;  4WPY A;  2A25 A;  3EPL A;  1AAY A;  4DR6 E; 
#chains in the Genus database with same CATH homology
 2EOS A;  2YTD A;  2I13 A;  2EPA A;  2YRH A;  1MEY C;  2EL4 A;  4M9V C;  1JK2 A;  2YSO A;  2WBU A;  3M99 B;  4R2Q A;  4R2A A;  1F2I G;  4R2C A;  2EN3 A;  1LLM C;  2LO3 A;  2ENH A;  2EMW A;  2EN8 A;  2EPZ A;  2LV2 A;  1YUI A;  4R2P A;  1X6F A;  2EPC A;  4F6M A;  2EJ4 A;  3EPH A;  2EOX A;  3VHT B;  1RMD A;  2LVH A;  4R2R A;  2EM0 A;  2EOF A;  1DGC A;  2EN4 A;  2EMC A;  2EOJ A;  2YTO A;  2CTD A;  2YTE A;  2DMI A;  2YSP A;  4IS1 C;  1KJK A;  2EOM A;  2HGH A;  2EP3 A;  2WBS A;  2EQ3 A;  1A1L A;  1JK1 A;  5KL3 A;  2YTF A;  1B69 A;  2CT1 A;  2RSI A;  5KL6 A;  2EM7 A;  2VRD A;  2EN1 A;  1A1H A;  2EMI A;  2BB8 A;  4F2J C;  2EMA A;  1A1G A;  2YU5 A;  2EPR A;  1WJP A;  2ELY A;  2ENA A;  1X5W A;  3MHS C;  2M9A A;  1ZAA C;  2EQ1 A;  4FK5 C;  4F6N A;  1A1J A;  2YU8 A;  2YRM A;  1BBO A;  1UN6 B;  4R2D A;  4GZN C;  2DGC A;  1X6E A;  2EMZ A;  2MKN A;  2EMK A;  1A1I A;  2EPX A;  2EE8 A;  3EPK A;  1A1F A;  2ELZ A;  1X3C A;  2R1F A;  1Z1B A;  2EMH A;  1YSA C;  2YTG A;  2PRT A;  1YUJ A;  2YTI A;  5KL4 A;  2D9H A;  2YTP A;  4R2S A;  2GLI A;  3MHH C;  2LCE A;  2DLQ A;  2EOQ A;  2EM2 A;  2EOH A;  2EML A;  2EM6 A;  2EL6 A;  2EMX A;  2EM5 A;  2EM3 A;  2EL5 A;  2NAB A;  5KL2 A;  2LT7 A;  2EPU A;  1TF6 A;  1G2D C;  2DRP A;  2J7J A;  1ZR9 A;  2YTJ A;  4WSG A;  3UK3 C;  2EMG A;  2EOY A;  2MDG A;  2EMB A;  2EOZ A;  2EOE A;  2EOO A;  1BB8 A;  2RPC A;  5KL5 A;  2JP9 A;  2E72 A;  4X9J A;  2ENC A;  2EMY A;  1P47 A;  2WBT A;  2MKD A;  2JPA A;  5KL7 A;  1TF3 A;  2EN7 A;  4IJD A;  2CSH A;  2EOI A;  2EQ0 A;  1UBD C;  3EPJ A;  1G2F C;  2YRK A;  2YTN A;  2ADR A;  2EM8 A;  1TN9 A;  2EM4 A;  2DLK A;  2EMF A;  2EOR A;  1ZU1 A;  2EM9 A;  2EPP A;  2EN2 A;  4R2E A;  1NCS A;  1AAY A;  2A25 A;  3EPL A;  2YTQ A;  2GHF A;  1A1K A;  1X6H A;  2EN6 A;  2WCC 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...