1KJKA

Solution structure of the lambda integrase amino-terminal domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
49
Chain Sequence
DLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords integrase
publication title Arm-site binding by lambda -integrase: solution structure and functional characterization of its amino-terminal domain.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 9
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1kjkA00
2EM2A 1NCSA 2ENAA 2EOMA 1TF3A 1JK2A 1DGCA 1KJKA 1ZAAC 2YU8A 2GHFA 4R2DA 2EMLA 3UK3C 2DMIA 2EL6A 3MHSC 2EPCA 2EOIA 1RMDA 4GZNC 2EQ1A 2CSHA 2NABA 2DRPA 2WBUA 4M9VC 2EM5A 2I13A 5KL5A 5KL3A 3EPLA 1X6HA 3M99B 2MKNA 2EMYA 2EOSA 2MKDA 1A1LA 2EM7A 2BB8A 2EJ4A 1Z1BA 2EMIA 2RPCA 5KL7A 3VHTB 2EMWA 2EOHA 2YU5A 2EQ3A 2EOEA 2EMFA 4F6MA 1ZR9A 2EM0A 1TF6A 2MDGA 2EPXA 2EPUA 2EORA 1A1HA 1LLMC 5KL4A 2EN1A 2EMZA 2EN3A 1UBDC 1A1JA 2EN4A 2EOFA 2JP9A 5KL2A 4R2SA 2WBSA 2EP3A 1MEYC 2EMKA 2RSIA 2ELZA 2EM6A 4R2CA 3MHHC 2YTIA 2ENHA 2LV2A 2EOQA 2EPRA 1A1IA 1TN9A 2YTJA 2EMBA 2EMXA 2YTGA 5KL6A 2VRDA 4X9JA 1BB8A 2DGCA 3EPKA 2YRKA 4F2JC 2GLIA 4IS1C 2EMGA 2EOYA 4F6NA 2YTFA 2ENCA 2J7JA 2DLQA 2LCEA 2ADRA 1G2DC 2EPZA 1ZU1A 1F2IG 1X3CA 2ELYA 2M9AA 2EOXA 2YRMA 1A1KA 2EMHA 2EL5A 4R2EA 2HGHA 2EE8A 2CT1A 2EL4A 2LVHA 2EN2A 4IJDA 4R2AA 2LO3A 4R2QA 1AAYA 2YSOA 2EM3A 2YRHA 2WCC3 2EOZA 1B69A 2PRTA 2EPAA 2EM4A 1YSAC 2JPAA 2YSPA 1A1FA 2EN7A 1WJPA 2YTNA 2YTPA 1BBOA 2A25A 1JK1A 2EQ0A 2EM9A 2YTDA 1UN6B 4R2PA 2R1FA 3EPHA 2YTOA 1YUIA 2YTEA 3EPJA 1G2FC 2EPPA 1X6EA 2YTQA 2EN8A 2EOOA 2EN6A 1X6FA 2EMAA 2LT7A 2EMCA 2CTDA 4WSGA 2E72A 2EM8A 1P47A 2WBTA 4FK5C 2EOJA 4R2RA 1A1GA 1YUJA 2DLKA 2D9HA 1X5WA
chains in the Genus database with same CATH superfamily
3MSWA 4YY3E 2E5LE 1HNWE 5A6AA 4DV5E 4J8ZA 1ZAAC 3ECRA 4B3ME 2EMLA 3UK3C 2DMIA 1WHNA 2DMYA 4GZNC 2DSYA 2L2KB 2FV4B 3AV0A 2CSHA 2GPIA 4DUYE 2I13A 3EPLA 1BBGA 1X6HA 2FGGA 3L00A 5LL6R 3M99B 2EMYA 4ZYGA 1EH8A 4R8OA 3VYYA 4LFBE 5A69A 1SFEA 5LMNE 4DV3E 5TSEA 2EQ3A 2EOEA 4LF5E 4WYQB 2MDGA 2EPXA 1FJGE 3ZOQB 1A1HA 5KL4A 2EN1A 4TUIA 2L33A 4X65E 2YPNA 1IBKE 2N3HA 2NA2A 1UILA 4LU9A 2EOFA 1YYOA 1MGTA 5KL2A 3KZZA 2EWLA 5BR8E 2RS6A 4L5NC 3OMLA 2EMKA 2V83A 2ELZA 2N8XA 5F3WA 4DMIA 4YHHE 2YTIA 1PJTA 2ENHA 3VK6A 1YYKA 2LV2A 2EOQA 2JVAA 1FKAE 2YTJA 4Q28A 2N3GA 4X9JA 4NHRA 2HHHE 2YRKA 2L6MA 2EOYA 4F6NA 2RQLA 3AUZA 2L3CA 2V8QB 1I94E 3LLHA 2J7JA 1G2DC 1WHQA 1X3CA 2NUFA 2JOBA 4BMJA 2HGHA 2EMHA 4R2EA 5FLXC 2EL4A 4Q35B 3VYXA 4IJDA 1XNRE 4LFAE 4HTGA 4R2QA 1T38A 3LMLA 4O4KA 2RSMA 2YSPA 2A25A 1T4NA 2DB2A 2JY9A 3J7Yp 5LLQA 4RHBB 1YUIA 2EPPA 2EMCA 4WXDA 2CTDA 4WSGA 2E72A 2JXPA 1X48A 1AH5A 1PJSA 4KZSA 2DLKA 3ADIA 2F8BA 2EZ6A 4OX9E 2EOMA 4LFCE 2YZTA 1YFHA 4WSPA 2UXBE 2YU8A 4R2DA 2MC6A 1ZBQA 4ZYDA 1IBLE 3H09A 4X8WA 2EQ1A 4X64E 2NABA 4M9VC 4M0VA 2V85A 1GZ6A 2MKNA 4LF7E 1RQ0A 2BBGA 4M30A 4HEIA 4NXNE 3F6HA 3FIGA 1Z1BA 2F4VE 1N33E 3ADJA 1SR9A 5A6JA 4DV0E 4DR3E 1IQSA 4F6MA 5AASA 1KYQA 5AE3A 4B3RE 2VQFE 4DR2E 4DV2E 2E1MA 2LUQA 1XMQE 3ADGA 5IWAE 4GKKE 2JP9A 4R2SA 2ODRC 3BIDA 3RMPA 2UUAE 2RSIA 4WXCA 1STUA 4TUGA 2JYAA 1UHZA 1YPNA 5A2QC 5IV8B 4BCAA 2DGCA 3JAMC 4F2JC 2GLIA 1HR0E 2M7QA 2YTFA 2DLQA 2MDRA 2ADRA 5IXMB 2EL5A 4MLVA 4JV5E 5IT9C 1N32E 3BF2A 1IBME 2LO3A 2YSOA 2WCC3 2YRHA 4LTYA 2EOZA 1XMOE 5AE1A 1B69A 4JI3E 2JR1A 2PRTA 2L3JA 1A1FA 2LBSB 2EN7A 5A6BA 1BBOA 4F54A 4B3TE 4O5GA 2ZM6E 2YTOA 2FTXB 4LF6E 2YTEA 2JWOA 4BBYA 4KHPE 1X6EA 2YTQA 2EN6A 1X6FA 3K6QA 1WXRA 4MLQA 2EM8A 1A1GA 1L4SA 4JI2E 2EM2A 1NCSA 1X49A 1DQ3A 4OOGC 3P1XA 1N36E 3MHSC 2LTRA 4JI0E 2EOIA 4ZYEA 1J26A 4BHBA 2UUCE 3JU0A 2EM5A 5A6KA 5KL3A 4NXME 3T1YE 2H36X 2L2NA 4ZYHA 2K4VA 2EM7A 3TQMA 3C6MA 1T4LB 2LUPB 4F9AB 2MC5A 2RPCA 5A6BD 3VHTB 5KL7A 1J5EE 2YU5A 5AC5A 2EMFA 2EPOA 1DI2A 2KHXA 2EM0A 2B7TA 2EPUA 4M2ZA 2EORA 4GKJE 1LLMC 4WX9A 2EMZA 2HJJA 4P78A 1A1JA 4LF4E 5LMUE 4X66E 1X47A 4I8OA 1PDAA 4DV6E 2B9DA 2EP3A 1PJQA 5DNYA 3OTOE 2LTSA 2Q8UA 2VE7C 2L92A 4DR1E 4F9CB 2YT4A 2EM6A 4R2CA 2UU9E 2EPRA 1A1IA 1TN9A 4O24A 2EMBA 2YTGA 4JI5E 4B3SE 2JOXA 5ADZA 1BB8A 4K0KE 3ADLA 3BGHA 4IS1C 2EMGA 2ODRD 4DUZE 2DIXA 3EQ1A 2LCEA 3HXLA 3C4BA 4BS9A 3C4TA 2M9AA 2EOXA 1A1KA 2EE8A 2LVHA 2EPMX 1NEIA 4R2AA 3C6KA 4DKKA 3HPZA 2L8TA 2EPAA 4BC7A 1YSAC 2CPNA 1T39A 1N3GA 4JI7E 2YTNA 2YTPA 3QG5C 2EM9A 2YTDA 4DV1E 4R2PA 2V86A 3THNA 4DR5E 3J80C 1HNZE 1UN6B 4JI6E 1QNTA 1GTKA 3EPJA 1GQEA 3KWRA 2LT7A 4LF8E 2NUEA 2R76A 1P47A 4FK5C 4R2RA 4GEQB 5CFFE 1YUJA 3F6GA 4N4RB 2ENAA 2UXCE 1TF3A 5T6JA 1JK2A 1DGCA 1IMUA 1KJKA 2GHFA 2YWQA 4JI8E 4DR6E 2EL6A 2EPCA 3KZYA 1RMDA 1O0WA 2UUBE 4X62E 2K7IA 2WBUA 2LMZA 2G7HA 2DRPA 5KL5A 3J81C 1N34E 2EOSA 2MKDA 1A1LA 2VQEE 4DR4E 2BB8A 2EJ4A 2EMIA 1T4OA 1EKZA 2EMWA 4L8NA 2EOHA 1ZR9A 4O43A 2B3TB 2V87A 1TF6A 1EH6A 1QU6A 2VF1A 3HTXA 2EN3A 4R03A 2KOUA 1HNXE 2RTXA 1UBDC 2EN4A 3BBGA 2RS7A 4JYAE 4KWYA 4F9BB 3DF6A 2EPNA 2WBSA 1MEYC 1XNQE 3T1HE 4AQYE 1YZ9A 3MHHC 2LE2A 1IQOA 2M4IA 1PKPA 2KONA 2EMXA 5KL6A 2VRDA 2V88A 4BC9A 3J7AG 2LJUA 3EPKA 1YYWA 3THOB 2ENCA 2EPZA 2L2MA 4P7DA 4JI4E 3DJWA 1ZU1A 1F2IG 2ELYA 2YRMA 2WZOA 2CT1A 4BHCA 2EN2A 3HQ1A 5AE2A 2EPLX 1AAYA 2M1SA 2I9IA 2EM3A 5AC4A 4DV7E 4DR7E 3IWBA 1RC7A 2EM4A 4DV4E 2NUGA 2JPAA 2B7VA 1WJPA 4WFTA 1JK1A 2HC5A 4NZVA 2EQ0A 3EPHA 2IHR1 2R1FA 3IWDA 2LJHA 1ZBTA 2LRSA 4LF9E 3IWCA 4WPYA 1G2FC 4JI1E 2EPKX 2UXDE 2EN8A 2EOOA 2EMAA 1WRJA 4RH8A 1EH7A 2V89A 3HPSA 2WBTA 2EOJA 3JTZA 2D9HA 1X5WA
chains in the Genus database with same CATH topology
2EM2A 1NCSA 2ENAA 2EOMA 1TF3A 1JK2A 1DGCA 1KJKA 1ZAAC 2YU8A 2GHFA 4R2DA 2EMLA 3UK3C 2DMIA 2EL6A 3MHSC 2EPCA 2EOIA 1RMDA 4GZNC 2EQ1A 2CSHA 2NABA 2DRPA 2WBUA 4M9VC 2EM5A 2I13A 5KL5A 5KL3A 3EPLA 1X6HA 3M99B 2MKNA 2EMYA 2EOSA 2MKDA 1A1LA 2EM7A 2BB8A 2EJ4A 1Z1BA 2EMIA 2RPCA 5KL7A 3VHTB 2EMWA 2EOHA 2YU5A 2EQ3A 2EOEA 2EMFA 4F6MA 1ZR9A 2EM0A 1TF6A 2MDGA 2EPXA 2EPUA 2EORA 1A1HA 1LLMC 5KL4A 2EN1A 2EMZA 2EN3A 1UBDC 1A1JA 2EN4A 2EOFA 2JP9A 5KL2A 4R2SA 2WBSA 2EP3A 1MEYC 2EMKA 2RSIA 2ELZA 2EM6A 4R2CA 3MHHC 2YTIA 2ENHA 2LV2A 2EOQA 2EPRA 1A1IA 1TN9A 2YTJA 2EMBA 2EMXA 2YTGA 5KL6A 2VRDA 4X9JA 1BB8A 2DGCA 3EPKA 2YRKA 4F2JC 2GLIA 4IS1C 2EMGA 2EOYA 4F6NA 2YTFA 2ENCA 2J7JA 2DLQA 2LCEA 2ADRA 1G2DC 2EPZA 1ZU1A 1F2IG 1X3CA 2ELYA 2M9AA 2EOXA 2YRMA 1A1KA 2EMHA 2EL5A 4R2EA 2HGHA 2EE8A 2CT1A 2EL4A 2LVHA 2EN2A 4IJDA 4R2AA 2LO3A 4R2QA 1AAYA 2YSOA 2EM3A 2YRHA 2WCC3 2EOZA 1B69A 2PRTA 2EPAA 2EM4A 1YSAC 2JPAA 2YSPA 1A1FA 2EN7A 1WJPA 2YTNA 2YTPA 1BBOA 2A25A 1JK1A 2EQ0A 2EM9A 2YTDA 1UN6B 4R2PA 2R1FA 3EPHA 2YTOA 1YUIA 2YTEA 3EPJA 1G2FC 2EPPA 1X6EA 2YTQA 2EN8A 2EOOA 2EN6A 1X6FA 2EMAA 2LT7A 2EMCA 2CTDA 4WSGA 2E72A 2EM8A 1P47A 2WBTA 4FK5C 2EOJA 4R2RA 1A1GA 1YUJA 2DLKA 2D9HA 1X5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM2 A;  1NCS A;  2ENA A;  2EOM A;  1TF3 A;  1JK2 A;  1DGC A;  1KJK A;  1ZAA C;  2YU8 A;  2GHF A;  4R2D A;  2EML A;  3UK3 C;  2DMI A;  2EL6 A;  3MHS C;  2EPC A;  2EOI A;  1RMD A;  4GZN C;  2EQ1 A;  2CSH A;  2NAB A;  2DRP A;  2WBU A;  4M9V C;  2EM5 A;  2I13 A;  5KL5 A;  5KL3 A;  3EPL A;  1X6H A;  3M99 B;  2MKN A;  2EMY A;  2EOS A;  2MKD A;  1A1L A;  2EM7 A;  2BB8 A;  2EJ4 A;  1Z1B A;  2EMI A;  2RPC A;  5KL7 A;  3VHT B;  2EMW A;  2EOH A;  2YU5 A;  2EQ3 A;  2EOE A;  2EMF A;  4F6M A;  1ZR9 A;  2EM0 A;  1TF6 A;  2MDG A;  2EPX A;  2EPU A;  2EOR A;  1A1H A;  1LLM C;  5KL4 A;  2EN1 A;  2EMZ A;  2EN3 A;  1UBD C;  1A1J A;  2EN4 A;  2EOF A;  2JP9 A;  5KL2 A;  4R2S A;  2WBS A;  2EP3 A;  1MEY C;  2EMK A;  2RSI A;  2ELZ A;  2EM6 A;  4R2C A;  3MHH C;  2YTI A;  2ENH A;  2LV2 A;  2EOQ A;  2EPR A;  1A1I A;  1TN9 A;  2YTJ A;  2EMB A;  2EMX A;  2YTG A;  5KL6 A;  2VRD A;  4X9J A;  1BB8 A;  2DGC A;  3EPK A;  2YRK A;  4F2J C;  2GLI A;  4IS1 C;  2EMG A;  2EOY A;  4F6N A;  2YTF A;  2ENC A;  2J7J A;  2DLQ A;  2LCE A;  2ADR A;  1G2D C;  2EPZ A;  1ZU1 A;  1F2I G;  1X3C A;  2ELY A;  2M9A A;  2EOX A;  2YRM A;  1A1K A;  2EMH A;  2EL5 A;  4R2E A;  2HGH A;  2EE8 A;  2CT1 A;  2EL4 A;  2LVH A;  2EN2 A;  4IJD A;  4R2A A;  2LO3 A;  4R2Q A;  1AAY A;  2YSO A;  2EM3 A;  2YRH A;  2WCC 3;  2EOZ A;  1B69 A;  2PRT A;  2EPA A;  2EM4 A;  1YSA C;  2JPA A;  2YSP A;  1A1F A;  2EN7 A;  1WJP A;  2YTN A;  2YTP A;  1BBO A;  2A25 A;  1JK1 A;  2EQ0 A;  2EM9 A;  2YTD A;  1UN6 B;  4R2P A;  2R1F A;  3EPH A;  2YTO A;  1YUI A;  2YTE A;  3EPJ A;  1G2F C;  2EPP A;  1X6E A;  2YTQ A;  2EN8 A;  2EOO A;  2EN6 A;  1X6F A;  2EMA A;  2LT7 A;  2EMC A;  2CTD A;  4WSG A;  2E72 A;  2EM8 A;  1P47 A;  2WBT A;  4FK5 C;  2EOJ A;  4R2R A;  1A1G A;  1YUJ A;  2DLK A;  2D9H A;  1X5W A; 
#chains in the Genus database with same CATH topology
 3MSW A;  4YY3 E;  2E5L E;  1HNW E;  5A6A A;  4DV5 E;  4J8Z A;  1ZAA C;  3ECR A;  4B3M E;  2EML A;  3UK3 C;  2DMI A;  1WHN A;  2DMY A;  4GZN C;  2DSY A;  2L2K B;  2FV4 B;  3AV0 A;  2CSH A;  2GPI A;  4DUY E;  2I13 A;  3EPL A;  1BBG A;  1X6H A;  2FGG A;  3L00 A;  5LL6 R;  3M99 B;  2EMY A;  4ZYG A;  1EH8 A;  4R8O A;  3VYY A;  4LFB E;  5A69 A;  1SFE A;  5LMN E;  4DV3 E;  5TSE A;  2EQ3 A;  2EOE A;  4LF5 E;  4WYQ B;  2MDG A;  2EPX A;  1FJG E;  3ZOQ B;  1A1H A;  5KL4 A;  2EN1 A;  4TUI A;  2L33 A;  4X65 E;  2YPN A;  1IBK E;  2N3H A;  2NA2 A;  1UIL A;  4LU9 A;  2EOF A;  1YYO A;  1MGT A;  5KL2 A;  3KZZ A;  2EWL A;  5BR8 E;  2RS6 A;  4L5N C;  3OML A;  2EMK A;  2V83 A;  2ELZ A;  2N8X A;  5F3W A;  4DMI A;  4YHH E;  2YTI A;  1PJT A;  2ENH A;  3VK6 A;  1YYK A;  2LV2 A;  2EOQ A;  2JVA A;  1FKA E;  2YTJ A;  4Q28 A;  2N3G A;  4X9J A;  4NHR A;  2HHH E;  2YRK A;  2L6M A;  2EOY A;  4F6N A;  2RQL A;  3AUZ A;  2L3C A;  2V8Q B;  1I94 E;  3LLH A;  2J7J A;  1G2D C;  1WHQ A;  1X3C A;  2NUF A;  2JOB A;  4BMJ A;  2HGH A;  2EMH A;  4R2E A;  5FLX C;  2EL4 A;  4Q35 B;  3VYX A;  4IJD A;  1XNR E;  4LFA E;  4HTG A;  4R2Q A;  1T38 A;  3LML A;  4O4K A;  2RSM A;  2YSP A;  2A25 A;  1T4N A;  2DB2 A;  2JY9 A;  3J7Y p;  5LLQ A;  4RHB B;  1YUI A;  2EPP A;  2EMC A;  4WXD A;  2CTD A;  4WSG A;  2E72 A;  2JXP A;  1X48 A;  1AH5 A;  1PJS A;  4KZS A;  2DLK A;  3ADI A;  2F8B A;  2EZ6 A;  4OX9 E;  2EOM A;  4LFC E;  2YZT A;  1YFH A;  4WSP A;  2UXB E;  2YU8 A;  4R2D A;  2MC6 A;  1ZBQ A;  4ZYD A;  1IBL E;  3H09 A;  4X8W A;  2EQ1 A;  4X64 E;  2NAB A;  4M9V C;  4M0V A;  2V85 A;  1GZ6 A;  2MKN A;  4LF7 E;  1RQ0 A;  2BBG A;  4M30 A;  4HEI A;  4NXN E;  3F6H A;  3FIG A;  1Z1B A;  2F4V E;  1N33 E;  3ADJ A;  1SR9 A;  5A6J A;  4DV0 E;  4DR3 E;  1IQS A;  4F6M A;  5AAS A;  1KYQ A;  5AE3 A;  4B3R E;  2VQF E;  4DR2 E;  4DV2 E;  2E1M A;  2LUQ A;  1XMQ E;  3ADG A;  5IWA E;  4GKK E;  2JP9 A;  4R2S A;  2ODR C;  3BID A;  3RMP A;  2UUA E;  2RSI A;  4WXC A;  1STU A;  4TUG A;  2JYA A;  1UHZ A;  1YPN A;  5A2Q C;  5IV8 B;  4BCA A;  2DGC A;  3JAM C;  4F2J C;  2GLI A;  1HR0 E;  2M7Q A;  2YTF A;  2DLQ A;  2MDR A;  2ADR A;  5IXM B;  2EL5 A;  4MLV A;  4JV5 E;  5IT9 C;  1N32 E;  3BF2 A;  1IBM E;  2LO3 A;  2YSO A;  2WCC 3;  2YRH A;  4LTY A;  2EOZ A;  1XMO E;  5AE1 A;  1B69 A;  4JI3 E;  2JR1 A;  2PRT A;  2L3J A;  1A1F A;  2LBS B;  2EN7 A;  5A6B A;  1BBO A;  4F54 A;  4B3T E;  4O5G A;  2ZM6 E;  2YTO A;  2FTX B;  4LF6 E;  2YTE A;  2JWO A;  4BBY A;  4KHP E;  1X6E A;  2YTQ A;  2EN6 A;  1X6F A;  3K6Q A;  1WXR A;  4MLQ A;  2EM8 A;  1A1G A;  1L4S A;  4JI2 E;  2EM2 A;  1NCS A;  1X49 A;  1DQ3 A;  4OOG C;  3P1X A;  1N36 E;  3MHS C;  2LTR A;  4JI0 E;  2EOI A;  4ZYE A;  1J26 A;  4BHB A;  2UUC E;  3JU0 A;  2EM5 A;  5A6K A;  5KL3 A;  4NXM E;  3T1Y E;  2H36 X;  2L2N A;  4ZYH A;  2K4V A;  2EM7 A;  3TQM A;  3C6M A;  1T4L B;  2LUP B;  4F9A B;  2MC5 A;  2RPC A;  5A6B D;  3VHT B;  5KL7 A;  1J5E E;  2YU5 A;  5AC5 A;  2EMF A;  2EPO A;  1DI2 A;  2KHX A;  2EM0 A;  2B7T A;  2EPU A;  4M2Z A;  2EOR A;  4GKJ E;  1LLM C;  4WX9 A;  2EMZ A;  2HJJ A;  4P78 A;  1A1J A;  4LF4 E;  5LMU E;  4X66 E;  1X47 A;  4I8O A;  1PDA A;  4DV6 E;  2B9D A;  2EP3 A;  1PJQ A;  5DNY A;  3OTO E;  2LTS A;  2Q8U A;  2VE7 C;  2L92 A;  4DR1 E;  4F9C B;  2YT4 A;  2EM6 A;  4R2C A;  2UU9 E;  2EPR A;  1A1I A;  1TN9 A;  4O24 A;  2EMB A;  2YTG A;  4JI5 E;  4B3S E;  2JOX A;  5ADZ A;  1BB8 A;  4K0K E;  3ADL A;  3BGH A;  4IS1 C;  2EMG A;  2ODR D;  4DUZ E;  2DIX A;  3EQ1 A;  2LCE A;  3HXL A;  3C4B A;  4BS9 A;  3C4T A;  2M9A A;  2EOX A;  1A1K A;  2EE8 A;  2LVH A;  2EPM X;  1NEI A;  4R2A A;  3C6K A;  4DKK A;  3HPZ A;  2L8T A;  2EPA A;  4BC7 A;  1YSA C;  2CPN A;  1T39 A;  1N3G A;  4JI7 E;  2YTN A;  2YTP A;  3QG5 C;  2EM9 A;  2YTD A;  4DV1 E;  4R2P A;  2V86 A;  3THN A;  4DR5 E;  3J80 C;  1HNZ E;  1UN6 B;  4JI6 E;  1QNT A;  1GTK A;  3EPJ A;  1GQE A;  3KWR A;  2LT7 A;  4LF8 E;  2NUE A;  2R76 A;  1P47 A;  4FK5 C;  4R2R A;  4GEQ B;  5CFF E;  1YUJ A;  3F6G A;  4N4R B;  2ENA A;  2UXC E;  1TF3 A;  5T6J A;  1JK2 A;  1DGC A;  1IMU A;  1KJK A;  2GHF A;  2YWQ A;  4JI8 E;  4DR6 E;  2EL6 A;  2EPC A;  3KZY A;  1RMD A;  1O0W A;  2UUB E;  4X62 E;  2K7I A;  2WBU A;  2LMZ A;  2G7H A;  2DRP A;  5KL5 A;  3J81 C;  1N34 E;  2EOS A;  2MKD A;  1A1L A;  2VQE E;  4DR4 E;  2BB8 A;  2EJ4 A;  2EMI A;  1T4O A;  1EKZ A;  2EMW A;  4L8N A;  2EOH A;  1ZR9 A;  4O43 A;  2B3T B;  2V87 A;  1TF6 A;  1EH6 A;  1QU6 A;  2VF1 A;  3HTX A;  2EN3 A;  4R03 A;  2KOU A;  1HNX E;  2RTX A;  1UBD C;  2EN4 A;  3BBG A;  2RS7 A;  4JYA E;  4KWY A;  4F9B B;  3DF6 A;  2EPN A;  2WBS A;  1MEY C;  1XNQ E;  3T1H E;  4AQY E;  1YZ9 A;  3MHH C;  2LE2 A;  1IQO A;  2M4I A;  1PKP A;  2KON A;  2EMX A;  5KL6 A;  2VRD A;  2V88 A;  4BC9 A;  3J7A G;  2LJU A;  3EPK A;  1YYW A;  3THO B;  2ENC A;  2EPZ A;  2L2M A;  4P7D A;  4JI4 E;  3DJW A;  1ZU1 A;  1F2I G;  2ELY A;  2YRM A;  2WZO A;  2CT1 A;  4BHC A;  2EN2 A;  3HQ1 A;  5AE2 A;  2EPL X;  1AAY A;  2M1S A;  2I9I A;  2EM3 A;  5AC4 A;  4DV7 E;  4DR7 E;  3IWB A;  1RC7 A;  2EM4 A;  4DV4 E;  2NUG A;  2JPA A;  2B7V A;  1WJP A;  4WFT A;  1JK1 A;  2HC5 A;  4NZV A;  2EQ0 A;  3EPH A;  2IHR 1;  2R1F A;  3IWD A;  2LJH A;  1ZBT A;  2LRS A;  4LF9 E;  3IWC A;  4WPY A;  1G2F C;  4JI1 E;  2EPK X;  2UXD E;  2EN8 A;  2EOO A;  2EMA A;  1WRJ A;  4RH8 A;  1EH7 A;  2V89 A;  3HPS A;  2WBT A;  2EOJ A;  3JTZ A;  2D9H A;  1X5W A; 
#chains in the Genus database with same CATH homology
 2EM2 A;  1NCS A;  2ENA A;  2EOM A;  1TF3 A;  1JK2 A;  1DGC A;  1KJK A;  1ZAA C;  2YU8 A;  2GHF A;  4R2D A;  2EML A;  3UK3 C;  2DMI A;  2EL6 A;  3MHS C;  2EPC A;  2EOI A;  1RMD A;  4GZN C;  2EQ1 A;  2CSH A;  2NAB A;  2DRP A;  2WBU A;  4M9V C;  2EM5 A;  2I13 A;  5KL5 A;  5KL3 A;  3EPL A;  1X6H A;  3M99 B;  2MKN A;  2EMY A;  2EOS A;  2MKD A;  1A1L A;  2EM7 A;  2BB8 A;  2EJ4 A;  1Z1B A;  2EMI A;  2RPC A;  5KL7 A;  3VHT B;  2EMW A;  2EOH A;  2YU5 A;  2EQ3 A;  2EOE A;  2EMF A;  4F6M A;  1ZR9 A;  2EM0 A;  1TF6 A;  2MDG A;  2EPX A;  2EPU A;  2EOR A;  1A1H A;  1LLM C;  5KL4 A;  2EN1 A;  2EMZ A;  2EN3 A;  1UBD C;  1A1J A;  2EN4 A;  2EOF A;  2JP9 A;  5KL2 A;  4R2S A;  2WBS A;  2EP3 A;  1MEY C;  2EMK A;  2RSI A;  2ELZ A;  2EM6 A;  4R2C A;  3MHH C;  2YTI A;  2ENH A;  2LV2 A;  2EOQ A;  2EPR A;  1A1I A;  1TN9 A;  2YTJ A;  2EMB A;  2EMX A;  2YTG A;  5KL6 A;  2VRD A;  4X9J A;  1BB8 A;  2DGC A;  3EPK A;  2YRK A;  4F2J C;  2GLI A;  4IS1 C;  2EMG A;  2EOY A;  4F6N A;  2YTF A;  2ENC A;  2J7J A;  2DLQ A;  2LCE A;  2ADR A;  1G2D C;  2EPZ A;  1ZU1 A;  1F2I G;  1X3C A;  2ELY A;  2M9A A;  2EOX A;  2YRM A;  1A1K A;  2EMH A;  2EL5 A;  4R2E A;  2HGH A;  2EE8 A;  2CT1 A;  2EL4 A;  2LVH A;  2EN2 A;  4IJD A;  4R2A A;  2LO3 A;  4R2Q A;  1AAY A;  2YSO A;  2EM3 A;  2YRH A;  2WCC 3;  2EOZ A;  1B69 A;  2PRT A;  2EPA A;  2EM4 A;  1YSA C;  2JPA A;  2YSP A;  1A1F A;  2EN7 A;  1WJP A;  2YTN A;  2YTP A;  1BBO A;  2A25 A;  1JK1 A;  2EQ0 A;  2EM9 A;  2YTD A;  1UN6 B;  4R2P A;  2R1F A;  3EPH A;  2YTO A;  1YUI A;  2YTE A;  3EPJ A;  1G2F C;  2EPP A;  1X6E A;  2YTQ A;  2EN8 A;  2EOO A;  2EN6 A;  1X6F A;  2EMA A;  2LT7 A;  2EMC A;  2CTD A;  4WSG A;  2E72 A;  2EM8 A;  1P47 A;  2WBT A;  4FK5 C;  2EOJ A;  4R2R A;  1A1G A;  1YUJ A;  2DLK A;  2D9H A;  1X5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...