1KJKA

Solution structure of the lambda integrase amino-terminal domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
49
Chain Sequence
DLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords integrase
publication title Arm-site binding by lambda -integrase: solution structure and functional characterization of its amino-terminal domain.
pubmed doi rcsb
source organism Enterobacteria phage lambda
total genus 9
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1kjkA00
2EOJA 2EOHA 2R1FA 1MEYC 2D9HA 4R2CA 2EM9A 1AAYA 2CT1A 1BBOA 3VHTB 1P47A 2BB8A 2YTGA 2EQ0A 2MKDA 4X9JA 1A1IA 4R2DA 2YRMA 2ADRA 1A1FA 2DGCA 4GZNC 1UBDC 2EOMA 1B69A 1A1GA 2CSHA 2EM7A 2M9AA 2E72A 2EMZA 2JPAA 4M9VC 4R2AA 3MHHC 2I13A 2EMIA 2EOOA 2YRHA 2EMCA 2WBTA 2WBSA 2EOYA 1F2IG 3MHSC 5KL4A 4FK5C 2NABA 2YTEA 1A1KA 3EPKA 2EM6A 2YTDA 5KL2A 4F6MA 5KL7A 3UK3C 1G2FC 2A25A 1ZR9A 1ZAAC 2EP3A 2J7JA 2YTJA 1X3CA 2YTQA 2EJ4A 1X5WA 2RSIA 2MKNA 1TF6A 1WJPA 2GHFA 2EN8A 1TF3A 1YSAC 1A1HA 2EL5A 1BB8A 2ENHA 2LO3A 1DGCA 4IS1C 2EMXA 2ENAA 2RPCA 2MDGA 2PRTA 5KL3A 2EN1A 1X6FA 1G2DC 2YTOA 1YUIA 2YSOA 4F2JC 3M99B 5KL5A 4R2SA 2WBUA 2EPPA 1JK1A 2EE8A 2DRPA 3EPHA 1ZU1A 2ELYA 2EMBA 2EOSA 2YTPA 4R2PA 2EN4A 1RMDA 2EMWA 2EOIA 2EOQA 2YSPA 2EM2A 2YTNA 2YTFA 2EM5A 2LT7A 2GLIA 2EMFA 2DMIA 2EM8A 2EORA 2EM3A 2EN6A 2DLQA 2EMHA 2EPCA 1Z1BA 1TN9A 2LVHA 2EL6A 2ENCA 2CTDA 2YTIA 2EOFA 2EOZA 3EPJA 2ELZA 2EM4A 2EPRA 2EMKA 2JP9A 2EPAA 4F6NA 2EQ1A 2EMGA 2EOEA 1UN6B 4R2QA 2EMLA 4R2EA 1YUJA 1X6EA 2EQ3A 2YRKA 2EN2A 2EPUA 4IJDA 5KL6A 1A1JA 2LV2A 2EMYA 2EMAA 2YU8A 1A1LA 2EN3A 2HGHA 2EM0A 2EL4A 1X6HA 2EPZA 2WCC3 2DLKA 2EN7A 4WSGA 4R2RA 1JK2A 1NCSA 1LLMC 2EOXA 2LCEA 2YU5A 2EPXA 1KJKA 2VRDA 3EPLA
chains in the Genus database with same CATH superfamily
1X47A 3J7Yp 2EOJA 4ZYHA 2B7VA 2D9HA 2EM9A 4R8OA 1PJTA 1HNXE 2CT1A 2B3TB 1BBOA 2BB8A 4DV7E 2EQ0A 2MKDA 4X9JA 2FTXB 4B3RE 4X8WA 4DMIA 5T6JA 3ECRA 1UBDC 5AE1A 4K0KE 2V87A 2B9DA 4DR3E 1ZBTA 2L3JA 2GPIA 2JR1A 2K7IA 2N8XA 2NA2A 1T38A 4BBYA 2EMCA 2LE2A 2NUEA 2RTXA 2HJJA 2L8TA 4JI6E 4LFAE 1FJGE 2MDRA 2EM6A 3F6GA 1EH8A 2EP3A 2J7JA 4LFBE 4DR4E 1X3CA 4M2ZA 1PKPA 2EJ4A 2RSIA 1WJPA 2BBGA 4KZSA 4NHRA 1X48A 4M0VA 4JI3E 2N3HA 5IT9C 2JYAA 2DIXA 5F3WA 4Q28A 3KWRA 3OMLA 4F54A 4OOGC 4R03A 4O5GA 2DRPA 2RQLA 5A6AA 2ELYA 3KZZA 2YTPA 4RHBB 2EN4A 1RMDA 2L33A 5CFFE 2EMFA 2EN6A 2EMHA 3VYYA 2LVHA 2WZOA 4NXNE 4LF6E 2CTDA 2EM4A 2EMKA 4F6NA 1PJSA 2EOEA 4DUZE 4LFCE 4P78A 2MC6A 3TQMA 3VYXA 1N33E 4R2EA 5IWAE 1X6EA 4YY3E 1GZ6A 5KL6A 3J80C 2Q8UA 2EN3A 2L2MA 2WCC3 1X6HA 1JK2A 1LLMC 2EOXA 2LCEA 1GQEA 1DI2A 4DR6E 3HQ1A 4WXCA 3VHTB 2I9IA 3T1HE 1A1IA 2YRMA 1A1FA 4X64E 1A1GA 2CSHA 2EM7A 2JY9A 2E72A 3C4BA 2JPAA 2RS7A 2LJHA 4NXME 4M9VC 4OX9E 4L5NC 2YRHA 4DR1E 3J7AG 3L00A 4LTYA 4FK5C 2NABA 2KONA 3EPKA 1J26A 1J5EE 4WPYA 1QNTA 5KL7A 1XMQE 1ZAAC 4F9AB 3BBGA 3DF6A 2E5LE 1X5WA 2DB2A 2RSMA 1IQOA 4JI1E 4M30A 1EKZA 4JV5E 4HTGA 3FIGA 2EL5A 5AASA 4WXDA 2ENHA 2H36X 2V83A 1DGCA 4IS1C 2ENAA 2RPCA 2MDGA 1RQ0A 1YUIA 2YSOA 3M99B 5KL5A 4GEQB 2L3CA 1UILA 2M4IA 2M1SA 5A6BD 4BS9A 2EOSA 2JOXA 5A6JA 2EMWA 2EOIA 2EOQA 4X62E 1WXRA 1I94E 2YTNA 2EM5A 2VF1A 3IWCA 2EM8A 2EORA 2DLQA 2EPCA 3HPSA 2B7TA 2L92A 4WYQB 1AH5A 2HHHE 3P1XA 4NZVA 2EPRA 4JI2E 4O43A 2JP9A 2V89A 2K4VA 4BC9A 3THOB 2YWQA 4ZYDA 1GTKA 2EZ6A 3QG5C 4IJDA 1A1JA 2LRSA 2EMAA 4F9BB 5FLXC 2F8BA 2HGHA 2EPZA 2UXBE 2LBSB 2NUFA 4LF4E 2EN7A 4DV3E 1NCSA 4I8OA 4DV5E 2LTRA 1KJKA 4ZYEA 3IWDA 1MEYC 4R2CA 1AAYA 2MC5A 1YZ9A 4X66E 2FGGA 2V85A 4MLVA 4R2DA 2ADRA 2DGCA 4GZNC 3C4TA 3VK6A 1B69A 2LUPB 2CPNA 2LMZA 2EMZA 4R2AA 1BBGA 2VE7C 1IBLE 2EMIA 3T1YE 2JOBA 2EOOA 4BHBA 1EH7A 2DMYA 4JI8E 4DR5E 2EPNA 2WBSA 2EOYA 4BCAA 1F2IG 4LF5E 3MHSC 2IHR1 4Q35B 2EPMX 5KL2A 4O4KA 3UK3C 1UHZA 1ZR9A 4LU9A 1X49A 2YTQA 1TF6A 4X65E 2EN8A 4L8NA 5AE2A 1YSAC 1HNZE 1NEIA 1BB8A 3ZOQB 2LO3A 2N3GA 1N32E 2EMXA 4RH8A 4TUGA 2KOUA 5KL3A 1X6FA 4ZYGA 1G2DC 1XMOE 2UXCE 2YZTA 1WHQA 4BHCA 4B3SE 3KZYA 4P7DA 2WBUA 2EPPA 3LMLA 1JK1A 2EPKX 2EE8A 2EWLA 3AV0A 3H09A 4R2PA 4JYAE 3HTXA 2YSPA 2EM2A 1PJQA 2LT7A 3K6QA 2GLIA 2DMIA 4LF8E 1O0WA 5AC4A 2EM3A 1Z1BA 2EPLX 1YPNA 4J8ZA 2M7QA 2DSYA 3JTZA 5LMUE 1N36E 2YTIA 3OTOE 3ADJA 4JI0E 2ELZA 5LMNE 5LL6R 2EQ1A 1UN6B 5AE3A 4JI7E 2VQEE 3THNA 4WFTA 5TSEA 2EN2A 4BC7A 2R76A 1HNWE 2YU8A 4B3ME 1A1LA 2EM0A 2EL4A 3C6MA 2DLKA 4WSGA 1XNRE 4DV2E 4DV6E 2EPOA 2HC5A 1SR9A 1FKAE 2EOHA 2R1FA 3BIDA 4AQYE 2V8QB 3HXLA 4HEIA 3RMPA 1P47A 2YTGA 4KWYA 5A2QC 1PDAA 3EQ1A 1YFHA 2EOMA 2M9AA 5ADZA 2KHXA 5A6BA 3MHHC 2ODRD 4DUYE 2I13A 1XNQE 2YPNA 2JXPA 5A6KA 2WBTA 1IMUA 4LF9E 1N3GA 2G7HA 5KL4A 1A1KA 2YTEA 1QU6A 1WHNA 1IBME 4DR7E 2YTDA 4F6MA 1N34E 1T4NA 1G2FC 2A25A 2FV4B 1YYKA 2YTJA 2UUCE 3DJWA 4F9CB 2MKNA 3F6HA 2GHFA 4YHHE 1DQ3A 1TF3A 1A1HA 1T4OA 2ZM6E 1MGTA 2UUAE 3BF2A 4WX9A 4LF7E 4DV0E 2LJUA 2PRTA 2F4VE 2EN1A 4MLQA 2YTOA 5LLQA 4F2JC 5DNYA 4GKJE 1WRJA 4R2SA 4JI4E 3MSWA 4DR2E 4O24A 3EPHA 2UU9E 1ZU1A 2EMBA 2ODRC 2RS6A 3ADLA 3AUZA 3ADIA 5A69A 3BGHA 1L4SA 2UUBE 1IBKE 4JI5E 2YTFA 3HPZA 5IV8B 1KYQA 3ADGA 3LLHA 4DKKA 5BR8E 1TN9A 1T39A 1HR0E 2E1MA 3J81C 2EL6A 1EH6A 2ENCA 5AC5A 3JAMC 4BMJA 2EOFA 2EOZA 1RC7A 3EPJA 2L2KB 2LTSA 2UXDE 1YYOA 1ZBQA 2EPAA 3IWBA 2EMGA 4N4RB 2V86A 2JVAA 3JU0A 4R2QA 1T4LB 2EMLA 1YUJA 4WSPA 2EQ3A 4KHPE 2YRKA 4B3TE 2EPUA 2L6MA 4GKKE 1IQSA 2LV2A 2EMYA 2LUQA 1STUA 1SFEA 2NUGA 1YYWA 4DV1E 4DV4E 5IXMB 2V88A 4R2RA 2L2NA 2VQFE 4TUIA 3C6KA 2JWOA 2YT4A 2YU5A 2EPXA 2VRDA 3EPLA
chains in the Genus database with same CATH topology
2EOJA 2EOHA 2R1FA 1MEYC 2D9HA 4R2CA 2EM9A 1AAYA 2CT1A 1BBOA 3VHTB 1P47A 2BB8A 2YTGA 2EQ0A 2MKDA 4X9JA 1A1IA 4R2DA 2YRMA 2ADRA 1A1FA 2DGCA 4GZNC 1UBDC 2EOMA 1B69A 1A1GA 2CSHA 2EM7A 2M9AA 2E72A 2EMZA 2JPAA 4M9VC 4R2AA 3MHHC 2I13A 2EMIA 2EOOA 2YRHA 2EMCA 2WBTA 2WBSA 2EOYA 1F2IG 3MHSC 5KL4A 4FK5C 2NABA 2YTEA 1A1KA 3EPKA 2EM6A 2YTDA 5KL2A 4F6MA 5KL7A 3UK3C 1G2FC 2A25A 1ZR9A 1ZAAC 2EP3A 2J7JA 2YTJA 1X3CA 2YTQA 2EJ4A 1X5WA 2RSIA 2MKNA 1TF6A 1WJPA 2GHFA 2EN8A 1TF3A 1YSAC 1A1HA 2EL5A 1BB8A 2ENHA 2LO3A 1DGCA 4IS1C 2EMXA 2ENAA 2RPCA 2MDGA 2PRTA 5KL3A 2EN1A 1X6FA 1G2DC 2YTOA 1YUIA 2YSOA 4F2JC 3M99B 5KL5A 4R2SA 2WBUA 2EPPA 1JK1A 2EE8A 2DRPA 3EPHA 1ZU1A 2ELYA 2EMBA 2EOSA 2YTPA 4R2PA 2EN4A 1RMDA 2EMWA 2EOIA 2EOQA 2YSPA 2EM2A 2YTNA 2YTFA 2EM5A 2LT7A 2GLIA 2EMFA 2DMIA 2EM8A 2EORA 2EM3A 2EN6A 2DLQA 2EMHA 2EPCA 1Z1BA 1TN9A 2LVHA 2EL6A 2ENCA 2CTDA 2YTIA 2EOFA 2EOZA 3EPJA 2ELZA 2EM4A 2EPRA 2EMKA 2JP9A 2EPAA 4F6NA 2EQ1A 2EMGA 2EOEA 1UN6B 4R2QA 2EMLA 4R2EA 1YUJA 1X6EA 2EQ3A 2YRKA 2EN2A 2EPUA 4IJDA 5KL6A 1A1JA 2LV2A 2EMYA 2EMAA 2YU8A 1A1LA 2EN3A 2HGHA 2EM0A 2EL4A 1X6HA 2EPZA 2WCC3 2DLKA 2EN7A 4WSGA 4R2RA 1JK2A 1NCSA 1LLMC 2EOXA 2LCEA 2YU5A 2EPXA 1KJKA 2VRDA 3EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOJ A;  2EOH A;  2R1F A;  1MEY C;  2D9H A;  4R2C A;  2EM9 A;  1AAY A;  2CT1 A;  1BBO A;  3VHT B;  1P47 A;  2BB8 A;  2YTG A;  2EQ0 A;  2MKD A;  4X9J A;  1A1I A;  4R2D A;  2YRM A;  2ADR A;  1A1F A;  2DGC A;  4GZN C;  1UBD C;  2EOM A;  1B69 A;  1A1G A;  2CSH A;  2EM7 A;  2M9A A;  2E72 A;  2EMZ A;  2JPA A;  4M9V C;  4R2A A;  3MHH C;  2I13 A;  2EMI A;  2EOO A;  2YRH A;  2EMC A;  2WBT A;  2WBS A;  2EOY A;  1F2I G;  3MHS C;  5KL4 A;  4FK5 C;  2NAB A;  2YTE A;  1A1K A;  3EPK A;  2EM6 A;  2YTD A;  5KL2 A;  4F6M A;  5KL7 A;  3UK3 C;  1G2F C;  2A25 A;  1ZR9 A;  1ZAA C;  2EP3 A;  2J7J A;  2YTJ A;  1X3C A;  2YTQ A;  2EJ4 A;  1X5W A;  2RSI A;  2MKN A;  1TF6 A;  1WJP A;  2GHF A;  2EN8 A;  1TF3 A;  1YSA C;  1A1H A;  2EL5 A;  1BB8 A;  2ENH A;  2LO3 A;  1DGC A;  4IS1 C;  2EMX A;  2ENA A;  2RPC A;  2MDG A;  2PRT A;  5KL3 A;  2EN1 A;  1X6F A;  1G2D C;  2YTO A;  1YUI A;  2YSO A;  4F2J C;  3M99 B;  5KL5 A;  4R2S A;  2WBU A;  2EPP A;  1JK1 A;  2EE8 A;  2DRP A;  3EPH A;  1ZU1 A;  2ELY A;  2EMB A;  2EOS A;  2YTP A;  4R2P A;  2EN4 A;  1RMD A;  2EMW A;  2EOI A;  2EOQ A;  2YSP A;  2EM2 A;  2YTN A;  2YTF A;  2EM5 A;  2LT7 A;  2GLI A;  2EMF A;  2DMI A;  2EM8 A;  2EOR A;  2EM3 A;  2EN6 A;  2DLQ A;  2EMH A;  2EPC A;  1Z1B A;  1TN9 A;  2LVH A;  2EL6 A;  2ENC A;  2CTD A;  2YTI A;  2EOF A;  2EOZ A;  3EPJ A;  2ELZ A;  2EM4 A;  2EPR A;  2EMK A;  2JP9 A;  2EPA A;  4F6N A;  2EQ1 A;  2EMG A;  2EOE A;  1UN6 B;  4R2Q A;  2EML A;  4R2E A;  1YUJ A;  1X6E A;  2EQ3 A;  2YRK A;  2EN2 A;  2EPU A;  4IJD A;  5KL6 A;  1A1J A;  2LV2 A;  2EMY A;  2EMA A;  2YU8 A;  1A1L A;  2EN3 A;  2HGH A;  2EM0 A;  2EL4 A;  1X6H A;  2EPZ A;  2WCC 3;  2DLK A;  2EN7 A;  4WSG A;  4R2R A;  1JK2 A;  1NCS A;  1LLM C;  2EOX A;  2LCE A;  2YU5 A;  2EPX A;  1KJK A;  2VRD A;  3EPL A; 
#chains in the Genus database with same CATH topology
 1X47 A;  3J7Y p;  2EOJ A;  4ZYH A;  2B7V A;  2D9H A;  2EM9 A;  4R8O A;  1PJT A;  1HNX E;  2CT1 A;  2B3T B;  1BBO A;  2BB8 A;  4DV7 E;  2EQ0 A;  2MKD A;  4X9J A;  2FTX B;  4B3R E;  4X8W A;  4DMI A;  5T6J A;  3ECR A;  1UBD C;  5AE1 A;  4K0K E;  2V87 A;  2B9D A;  4DR3 E;  1ZBT A;  2L3J A;  2GPI A;  2JR1 A;  2K7I A;  2N8X A;  2NA2 A;  1T38 A;  4BBY A;  2EMC A;  2LE2 A;  2NUE A;  2RTX A;  2HJJ A;  2L8T A;  4JI6 E;  4LFA E;  1FJG E;  2MDR A;  2EM6 A;  3F6G A;  1EH8 A;  2EP3 A;  2J7J A;  4LFB E;  4DR4 E;  1X3C A;  4M2Z A;  1PKP A;  2EJ4 A;  2RSI A;  1WJP A;  2BBG A;  4KZS A;  4NHR A;  1X48 A;  4M0V A;  4JI3 E;  2N3H A;  5IT9 C;  2JYA A;  2DIX A;  5F3W A;  4Q28 A;  3KWR A;  3OML A;  4F54 A;  4OOG C;  4R03 A;  4O5G A;  2DRP A;  2RQL A;  5A6A A;  2ELY A;  3KZZ A;  2YTP A;  4RHB B;  2EN4 A;  1RMD A;  2L33 A;  5CFF E;  2EMF A;  2EN6 A;  2EMH A;  3VYY A;  2LVH A;  2WZO A;  4NXN E;  4LF6 E;  2CTD A;  2EM4 A;  2EMK A;  4F6N A;  1PJS A;  2EOE A;  4DUZ E;  4LFC E;  4P78 A;  2MC6 A;  3TQM A;  3VYX A;  1N33 E;  4R2E A;  5IWA E;  1X6E A;  4YY3 E;  1GZ6 A;  5KL6 A;  3J80 C;  2Q8U A;  2EN3 A;  2L2M A;  2WCC 3;  1X6H A;  1JK2 A;  1LLM C;  2EOX A;  2LCE A;  1GQE A;  1DI2 A;  4DR6 E;  3HQ1 A;  4WXC A;  3VHT B;  2I9I A;  3T1H E;  1A1I A;  2YRM A;  1A1F A;  4X64 E;  1A1G A;  2CSH A;  2EM7 A;  2JY9 A;  2E72 A;  3C4B A;  2JPA A;  2RS7 A;  2LJH A;  4NXM E;  4M9V C;  4OX9 E;  4L5N C;  2YRH A;  4DR1 E;  3J7A G;  3L00 A;  4LTY A;  4FK5 C;  2NAB A;  2KON A;  3EPK A;  1J26 A;  1J5E E;  4WPY A;  1QNT A;  5KL7 A;  1XMQ E;  1ZAA C;  4F9A B;  3BBG A;  3DF6 A;  2E5L E;  1X5W A;  2DB2 A;  2RSM A;  1IQO A;  4JI1 E;  4M30 A;  1EKZ A;  4JV5 E;  4HTG A;  3FIG A;  2EL5 A;  5AAS A;  4WXD A;  2ENH A;  2H36 X;  2V83 A;  1DGC A;  4IS1 C;  2ENA A;  2RPC A;  2MDG A;  1RQ0 A;  1YUI A;  2YSO A;  3M99 B;  5KL5 A;  4GEQ B;  2L3C A;  1UIL A;  2M4I A;  2M1S A;  5A6B D;  4BS9 A;  2EOS A;  2JOX A;  5A6J A;  2EMW A;  2EOI A;  2EOQ A;  4X62 E;  1WXR A;  1I94 E;  2YTN A;  2EM5 A;  2VF1 A;  3IWC A;  2EM8 A;  2EOR A;  2DLQ A;  2EPC A;  3HPS A;  2B7T A;  2L92 A;  4WYQ B;  1AH5 A;  2HHH E;  3P1X A;  4NZV A;  2EPR A;  4JI2 E;  4O43 A;  2JP9 A;  2V89 A;  2K4V A;  4BC9 A;  3THO B;  2YWQ A;  4ZYD A;  1GTK A;  2EZ6 A;  3QG5 C;  4IJD A;  1A1J A;  2LRS A;  2EMA A;  4F9B B;  5FLX C;  2F8B A;  2HGH A;  2EPZ A;  2UXB E;  2LBS B;  2NUF A;  4LF4 E;  2EN7 A;  4DV3 E;  1NCS A;  4I8O A;  4DV5 E;  2LTR A;  1KJK A;  4ZYE A;  3IWD A;  1MEY C;  4R2C A;  1AAY A;  2MC5 A;  1YZ9 A;  4X66 E;  2FGG A;  2V85 A;  4MLV A;  4R2D A;  2ADR A;  2DGC A;  4GZN C;  3C4T A;  3VK6 A;  1B69 A;  2LUP B;  2CPN A;  2LMZ A;  2EMZ A;  4R2A A;  1BBG A;  2VE7 C;  1IBL E;  2EMI A;  3T1Y E;  2JOB A;  2EOO A;  4BHB A;  1EH7 A;  2DMY A;  4JI8 E;  4DR5 E;  2EPN A;  2WBS A;  2EOY A;  4BCA A;  1F2I G;  4LF5 E;  3MHS C;  2IHR 1;  4Q35 B;  2EPM X;  5KL2 A;  4O4K A;  3UK3 C;  1UHZ A;  1ZR9 A;  4LU9 A;  1X49 A;  2YTQ A;  1TF6 A;  4X65 E;  2EN8 A;  4L8N A;  5AE2 A;  1YSA C;  1HNZ E;  1NEI A;  1BB8 A;  3ZOQ B;  2LO3 A;  2N3G A;  1N32 E;  2EMX A;  4RH8 A;  4TUG A;  2KOU A;  5KL3 A;  1X6F A;  4ZYG A;  1G2D C;  1XMO E;  2UXC E;  2YZT A;  1WHQ A;  4BHC A;  4B3S E;  3KZY A;  4P7D A;  2WBU A;  2EPP A;  3LML A;  1JK1 A;  2EPK X;  2EE8 A;  2EWL A;  3AV0 A;  3H09 A;  4R2P A;  4JYA E;  3HTX A;  2YSP A;  2EM2 A;  1PJQ A;  2LT7 A;  3K6Q A;  2GLI A;  2DMI A;  4LF8 E;  1O0W A;  5AC4 A;  2EM3 A;  1Z1B A;  2EPL X;  1YPN A;  4J8Z A;  2M7Q A;  2DSY A;  3JTZ A;  5LMU E;  1N36 E;  2YTI A;  3OTO E;  3ADJ A;  4JI0 E;  2ELZ A;  5LMN E;  5LL6 R;  2EQ1 A;  1UN6 B;  5AE3 A;  4JI7 E;  2VQE E;  3THN A;  4WFT A;  5TSE A;  2EN2 A;  4BC7 A;  2R76 A;  1HNW E;  2YU8 A;  4B3M E;  1A1L A;  2EM0 A;  2EL4 A;  3C6M A;  2DLK A;  4WSG A;  1XNR E;  4DV2 E;  4DV6 E;  2EPO A;  2HC5 A;  1SR9 A;  1FKA E;  2EOH A;  2R1F A;  3BID A;  4AQY E;  2V8Q B;  3HXL A;  4HEI A;  3RMP A;  1P47 A;  2YTG A;  4KWY A;  5A2Q C;  1PDA A;  3EQ1 A;  1YFH A;  2EOM A;  2M9A A;  5ADZ A;  2KHX A;  5A6B A;  3MHH C;  2ODR D;  4DUY E;  2I13 A;  1XNQ E;  2YPN A;  2JXP A;  5A6K A;  2WBT A;  1IMU A;  4LF9 E;  1N3G A;  2G7H A;  5KL4 A;  1A1K A;  2YTE A;  1QU6 A;  1WHN A;  1IBM E;  4DR7 E;  2YTD A;  4F6M A;  1N34 E;  1T4N A;  1G2F C;  2A25 A;  2FV4 B;  1YYK A;  2YTJ A;  2UUC E;  3DJW A;  4F9C B;  2MKN A;  3F6H A;  2GHF A;  4YHH E;  1DQ3 A;  1TF3 A;  1A1H A;  1T4O A;  2ZM6 E;  1MGT A;  2UUA E;  3BF2 A;  4WX9 A;  4LF7 E;  4DV0 E;  2LJU A;  2PRT A;  2F4V E;  2EN1 A;  4MLQ A;  2YTO A;  5LLQ A;  4F2J C;  5DNY A;  4GKJ E;  1WRJ A;  4R2S A;  4JI4 E;  3MSW A;  4DR2 E;  4O24 A;  3EPH A;  2UU9 E;  1ZU1 A;  2EMB A;  2ODR C;  2RS6 A;  3ADL A;  3AUZ A;  3ADI A;  5A69 A;  3BGH A;  1L4S A;  2UUB E;  1IBK E;  4JI5 E;  2YTF A;  3HPZ A;  5IV8 B;  1KYQ A;  3ADG A;  3LLH A;  4DKK A;  5BR8 E;  1TN9 A;  1T39 A;  1HR0 E;  2E1M A;  3J81 C;  2EL6 A;  1EH6 A;  2ENC A;  5AC5 A;  3JAM C;  4BMJ A;  2EOF A;  2EOZ A;  1RC7 A;  3EPJ A;  2L2K B;  2LTS A;  2UXD E;  1YYO A;  1ZBQ A;  2EPA A;  3IWB A;  2EMG A;  4N4R B;  2V86 A;  2JVA A;  3JU0 A;  4R2Q A;  1T4L B;  2EML A;  1YUJ A;  4WSP A;  2EQ3 A;  4KHP E;  2YRK A;  4B3T E;  2EPU A;  2L6M A;  4GKK E;  1IQS A;  2LV2 A;  2EMY A;  2LUQ A;  1STU A;  1SFE A;  2NUG A;  1YYW A;  4DV1 E;  4DV4 E;  5IXM B;  2V88 A;  4R2R A;  2L2N A;  2VQF E;  4TUI A;  3C6K A;  2JWO A;  2YT4 A;  2YU5 A;  2EPX A;  2VRD A;  3EPL A; 
#chains in the Genus database with same CATH homology
 2EOJ A;  2EOH A;  2R1F A;  1MEY C;  2D9H A;  4R2C A;  2EM9 A;  1AAY A;  2CT1 A;  1BBO A;  3VHT B;  1P47 A;  2BB8 A;  2YTG A;  2EQ0 A;  2MKD A;  4X9J A;  1A1I A;  4R2D A;  2YRM A;  2ADR A;  1A1F A;  2DGC A;  4GZN C;  1UBD C;  2EOM A;  1B69 A;  1A1G A;  2CSH A;  2EM7 A;  2M9A A;  2E72 A;  2EMZ A;  2JPA A;  4M9V C;  4R2A A;  3MHH C;  2I13 A;  2EMI A;  2EOO A;  2YRH A;  2EMC A;  2WBT A;  2WBS A;  2EOY A;  1F2I G;  3MHS C;  5KL4 A;  4FK5 C;  2NAB A;  2YTE A;  1A1K A;  3EPK A;  2EM6 A;  2YTD A;  5KL2 A;  4F6M A;  5KL7 A;  3UK3 C;  1G2F C;  2A25 A;  1ZR9 A;  1ZAA C;  2EP3 A;  2J7J A;  2YTJ A;  1X3C A;  2YTQ A;  2EJ4 A;  1X5W A;  2RSI A;  2MKN A;  1TF6 A;  1WJP A;  2GHF A;  2EN8 A;  1TF3 A;  1YSA C;  1A1H A;  2EL5 A;  1BB8 A;  2ENH A;  2LO3 A;  1DGC A;  4IS1 C;  2EMX A;  2ENA A;  2RPC A;  2MDG A;  2PRT A;  5KL3 A;  2EN1 A;  1X6F A;  1G2D C;  2YTO A;  1YUI A;  2YSO A;  4F2J C;  3M99 B;  5KL5 A;  4R2S A;  2WBU A;  2EPP A;  1JK1 A;  2EE8 A;  2DRP A;  3EPH A;  1ZU1 A;  2ELY A;  2EMB A;  2EOS A;  2YTP A;  4R2P A;  2EN4 A;  1RMD A;  2EMW A;  2EOI A;  2EOQ A;  2YSP A;  2EM2 A;  2YTN A;  2YTF A;  2EM5 A;  2LT7 A;  2GLI A;  2EMF A;  2DMI A;  2EM8 A;  2EOR A;  2EM3 A;  2EN6 A;  2DLQ A;  2EMH A;  2EPC A;  1Z1B A;  1TN9 A;  2LVH A;  2EL6 A;  2ENC A;  2CTD A;  2YTI A;  2EOF A;  2EOZ A;  3EPJ A;  2ELZ A;  2EM4 A;  2EPR A;  2EMK A;  2JP9 A;  2EPA A;  4F6N A;  2EQ1 A;  2EMG A;  2EOE A;  1UN6 B;  4R2Q A;  2EML A;  4R2E A;  1YUJ A;  1X6E A;  2EQ3 A;  2YRK A;  2EN2 A;  2EPU A;  4IJD A;  5KL6 A;  1A1J A;  2LV2 A;  2EMY A;  2EMA A;  2YU8 A;  1A1L A;  2EN3 A;  2HGH A;  2EM0 A;  2EL4 A;  1X6H A;  2EPZ A;  2WCC 3;  2DLK A;  2EN7 A;  4WSG A;  4R2R A;  1JK2 A;  1NCS A;  1LLM C;  2EOX A;  2LCE A;  2YU5 A;  2EPX A;  1KJK A;  2VRD A;  3EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...