1KJKA

Solution structure of the lambda integrase amino-terminal domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
49
structure length
49
Chain Sequence
DLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords integrase
publication title Arm-site binding by lambda -integrase: solution structure and functional characterization of its amino-terminal domain.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 9
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2001-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1kjkA00
2EN8A 4IS1C 1A1FA 1WJPA 2LCEA 2EN4A 2EPPA 1ZU1A 4F6MA 2LV2A 1YUJA 2EM8A 2YTDA 2EOZA 2LT7A 2EOQA 1RMDA 5KL3A 3EPJA 1F2IG 1BBOA 2EQ0A 2EOIA 2E72A 2EOFA 4R2AA 2EMIA 4R2RA 2RSIA 1A1GA 2DRPA 2EM9A 1JK1A 2YU8A 2EOYA 3EPKA 2CSHA 2R1FA 5KL7A 2YTNA 4IJDA 2YTPA 2EM3A 2EE8A 2YTFA 2YTIA 2GHFA 2EMHA 2LO3A 2EORA 3VHTB 2BB8A 2NABA 2D9HA 2MDGA 2EN6A 4M9VC 1JK2A 1X3CA 3MHHC 2WBUA 3EPLA 2EMLA 1YUIA 1BB8A 1MEYC 1NCSA 2ENAA 1G2DC 4X9JA 2I13A 2JPAA 2DMIA 4R2QA 2EPZA 1X6FA 2DGCA 4R2PA 1LLMC 2EOJA 3M99B 2A25A 2EM0A 2EMYA 2EMWA 2EMFA 2EQ3A 2EMXA 2ENCA 1A1LA 5KL6A 5KL2A 2EN3A 2DLQA 2GLIA 2EPRA 1A1IA 1A1JA 1UBDC 2VRDA 2ELYA 2YTJA 4R2DA 4F6NA 2EOOA 2HGHA 1TF3A 2EQ1A 2EM4A 2YSPA 4GZNC 2ADRA 2EM2A 2CT1A 2EMGA 2YTEA 2EN2A 2EM7A 2EMCA 4WSGA 2M9AA 5KL4A 2PRTA 2WCC3 1X6EA 2YRHA 1UN6B 2DLKA 2J7JA 2WBSA 2EL5A 2EL4A 2YRKA 2WBTA 1YSAC 1X6HA 2EOSA 1B69A 2ELZA 1ZAAC 2JP9A 1TN9A 2EP3A 2YTQA 2EPUA 2RPCA 2EN1A 4FK5C 4F2JC 3EPHA 2EPCA 1X5WA 1TF6A 1A1HA 2EM6A 2EOXA 1P47A 2EN7A 2EMKA 2EPXA 2EPAA 1G2FC 2EMBA 2CTDA 2YTOA 4R2SA 2YRMA 1ZR9A 2EJ4A 2EOHA 1A1KA 2MKNA 2MKDA 2YSOA 2EMAA 3UK3C 5KL5A 2ENHA 2YU5A 1AAYA 2EL6A 2EOEA 2LVHA 3MHSC 1KJKA 4R2CA 2EMZA 1Z1BA 4R2EA 2EOMA 1DGCA 2YTGA 2EM5A
chains in the Genus database with same CATH superfamily
5A6BD 2JOXA 1A1FA 2LCEA 2EPPA 1ZU1A 4O43A 1YUJA 5A6AA 2LMZA 2EOZA 3HXLA 3EPJA 4BBYA 2E72A 2RSIA 2YU8A 2EOYA 2LRSA 5IWAE 3EPKA 2R1FA 2VQFE 3AV0A 2YTPA 2EM3A 2EE8A 3HPSA 2HHHE 3THNA 1YYWA 5A69A 4L8NA 4ZYGA 2EPOA 4BS9A 2MDGA 4L5NC 2EN6A 3T1HE 1XMOE 4LFCE 3MHHC 3EPLA 2H36X 1BB8A 3LMLA 2MC6A 4LFAE 2DMIA 4R2QA 3C4TA 4O4KA 3T1YE 2YPNA 4B3RE 4F54A 2JOBA 1LLMC 2A25A 2EMYA 2EMWA 1WHQA 2EQ3A 2CPNA 1X48A 4YY3E 2E5LE 4LF4E 5KL2A 5IXMB 2L2NA 2ODRD 2DLQA 2V85A 2EPRA 4WFTA 4R2DA 4F6NA 1IQSA 4WPYA 1HNZE 4ZYEA 3HQ1A 4NXME 2ADRA 2F4VE 2NUFA 2EN2A 2EM7A 2EMCA 2JR1A 2FTXB 4JI3E 2V88A 2UUAE 2MC5A 5DNYA 2EL4A 2N3GA 2WBTA 1XNRE 1XNQE 4JV5E 3AUZA 4NHRA 2EP3A 2M7QA 3EQ1A 3IWDA 1X5WA 2JWOA 2YWQA 4DR5E 2WZOA 1WXRA 4NZVA 4J8ZA 3J80C 2EJ4A 1N32E 2MKDA 2YSOA 1N3GA 2EMAA 4JI5E 1EH8A 5IV8B 4I8OA 4DV6E 3MHSC 4X62E 4DV5E 2EMZA 4OOGC 2YZTA 4JYAE 4BHCA 1ZAAC 2EN8A 4KWYA 4YHHE 1I94E 2UXBE 1WJPA 4JI8E 2EN4A 5LLQA 2EM8A 4DMIA 5T6JA 1RMDA 4AQYE 3KWRA 2EOFA 4JI7E 5FLXC 2EMIA 4R2RA 1AH5A 5AE2A 2L6MA 3DF6A 3F6HA 4DKKA 4R8OA 1WRJA 1DQ3A 2B9DA 2E1MA 1YZ9A 1J26A 4MLQA 1SR9A 2NABA 2D9HA 4DV4E 2VF1A 1HNXE 2V87A 4BHBA 4NXNE 2LUQA 1NCSA 2VE7C 3LLHA 4M0VA 4R03A 3J7AG 2B7TA 4X9JA 2UXDE 1KYQA 2RS7A 3VYXA 1X6FA 5A2QC 2N3HA 2EOJA 2LUPB 2EM0A 2RSMA 3VYYA 4B3ME 4DUZE 2EMXA 2ENCA 2DIXA 2UXCE 5AE1A 1A1LA 4O24A 3C6KA 2ZM6E 4X66E 1UBDC 2V83A 2VRDA 2YTJA 4TUGA 2DB2A 1XMQE 1SFEA 1IBLE 4M2ZA 2L8TA 4Q28A 2L33A 3BF2A 2EM4A 1N33E 3P1XA 2R76A 4LF7E 4WSGA 4DV0E 2WCC3 3JU0A 2YRHA 1MGTA 4X8WA 5IT9C 1YSAC 3JAMC 3J7Yp 4ZYDA 1X47A 2NUGA 2EOSA 3ADJA 1HR0E 3FIGA 2JP9A 1TN9A 2YTQA 2EPUA 1QU6A 3H09A 4LU9A 1GZ6A 4M30A 2EMKA 2EPXA 2CTDA 3OTOE 1T4NA 3VK6A 1YFHA 1DI2A 5AE3A 1ZR9A 2EOHA 2MKNA 2EPMX 4X65E 2ENHA 2YU5A 1AAYA 2EL6A 4P7DA 1PDAA 2LVHA 3BGHA 1STUA 2L3CA 4R2EA 4F9AB 4DR4E 1X6EA 2V86A 1YYKA 2N8XA 4IS1C 1NEIA 4JI1E 4DV2E 2LV2A 3QG5C 2F8BA 2VQEE 4DR7E 4LTYA 2LT7A 2EOQA 1F2IG 4WXCA 2LE2A 4R2AA 4DR2E 1A1GA 2DRPA 2LTRA 2CSHA 5KL7A 1PJTA 1YYOA 2GPIA 1EKZA 2EMHA 4KHPE 5CFFE 1UILA 2LO3A 1IQOA 2EORA 1T4LB 2BB8A 2EPNA 2UUBE 1IMUA 1N34E 4M9VC 1JK2A 3OMLA 4RH8A 2WBUA 1ZBQA 3ZOQB 4DR1E 1MEYC 3L00A 3IWCA 2B7VA 2ENAA 5AASA 4JI0E 1ZBTA 3BBGA 2KOUA 2RTXA 2EPZA 1N36E 4B3SE 2MDRA 4HTGA 3IWBA 2DGCA 4JI2E 1PKPA 1WHNA 1UHZA 2EMFA 5AC4A 4O5GA 5KL6A 2EN3A 1GTKA 1A1IA 2IHR1 4B3TE 1QNTA 1J5EE 2L2MA 4BCAA 1HNWE 2YSPA 4GZNC 2EM2A 2EPLX 4JI4E 2CT1A 2EMGA 2YTEA 4DUYE 2M9AA 5KL4A 4LF9E 2JVAA 2PRTA 2EPKX 1UN6B 2DLKA 2J7JA 1X6HA 2V8QB 2ELZA 2FV4B 3HPZA 4HEIA 4DV1E 2LBSB 4LF6E 2EWLA 1RQ0A 1IBME 5A6KA 2NUEA 4F2JC 4FK5C 4DR3E 2EPCA 4OX9E 3RMPA 1TF6A 1FJGE 4WSPA 1A1HA 3HTXA 3KZYA 4BC7A 1T39A 2EM6A 2EOXA 2EN7A 4LFBE 2EPAA 2EMBA 2RQLA 2M1SA 5LL6R 4BMJA 1A1KA 1PJSA 5KL5A 4JI6E 1FKAE 2I9IA 3KZZA 2LJHA 2EOEA 2JY9A 2L3JA 1O0WA 4WXDA 2EOMA 1X49A 1BBGA 1DGCA 3ADLA 3F6GA 4BC9A 1IBKE 4F6MA 2B3TB 2YTDA 5A6BA 5KL3A 1BBOA 2EQ0A 2EOIA 4K0KE 1L4SA 1T38A 2EM9A 1JK1A 4N4RB 4DR6E 1EH7A 3ECRA 4DV7E 2HC5A 2L2KB 4F9CB 2YTNA 4IJDA 2YTFA 4RHBB 2YTIA 2KHXA 2GHFA 2L92A 2Q8UA 3VHTB 2JYAA 3DJWA 4KZSA 5TSEA 4ZYHA 4WX9A 1X3CA 2EMLA 1YUIA 3BIDA 4Q35B 3ADGA 1G2DC 1EH6A 2I13A 5A6JA 2JPAA 2DMYA 1PJQA 4LF8E 5LMNE 4R2PA 2UU9E 4GKJE 3M99B 4DV3E 2HJJA 4F9BB 2K7IA 2G7HA 3C6MA 4GEQB 2ODRC 5F3WA 2GLIA 3MSWA 1A1JA 2ELYA 2KONA 1YPNA 3C4BA 4GKKE 2EOOA 1GQEA 1TF3A 3K6QA 2HGHA 2EQ1A 2YT4A 3THOB 2EZ6A 2M4IA 2UUCE 5AC5A 5LMUE 2LTSA 2WBSA 4LF5E 2EL5A 2YRKA 1RC7A 3J81C 1B69A 1T4OA 2V89A 2FGGA 2RPCA 2EN1A 3EPHA 5BR8E 2NA2A 2K4VA 5ADZA 2RS6A 4MLVA 1P47A 2DSYA 3JTZA 1G2FC 4WYQB 4P78A 2BBGA 2YTOA 4R2SA 2YRMA 2JXPA 3UK3C 2LJUA 1KJKA 4R2CA 4TUIA 1Z1BA 4X64E 2YTGA 3TQMA 2EM5A 3ADIA
chains in the Genus database with same CATH topology
2EN8A 4IS1C 1A1FA 1WJPA 2LCEA 2EN4A 2EPPA 1ZU1A 4F6MA 2LV2A 1YUJA 2EM8A 2YTDA 2EOZA 2LT7A 2EOQA 1RMDA 5KL3A 3EPJA 1F2IG 1BBOA 2EQ0A 2EOIA 2E72A 2EOFA 4R2AA 2EMIA 4R2RA 2RSIA 1A1GA 2DRPA 2EM9A 1JK1A 2YU8A 2EOYA 3EPKA 2CSHA 2R1FA 5KL7A 2YTNA 4IJDA 2YTPA 2EM3A 2EE8A 2YTFA 2YTIA 2GHFA 2EMHA 2LO3A 2EORA 3VHTB 2BB8A 2NABA 2D9HA 2MDGA 2EN6A 4M9VC 1JK2A 1X3CA 3MHHC 2WBUA 3EPLA 2EMLA 1YUIA 1BB8A 1MEYC 1NCSA 2ENAA 1G2DC 4X9JA 2I13A 2JPAA 2DMIA 4R2QA 2EPZA 1X6FA 2DGCA 4R2PA 1LLMC 2EOJA 3M99B 2A25A 2EM0A 2EMYA 2EMWA 2EMFA 2EQ3A 2EMXA 2ENCA 1A1LA 5KL6A 5KL2A 2EN3A 2DLQA 2GLIA 2EPRA 1A1IA 1A1JA 1UBDC 2VRDA 2ELYA 2YTJA 4R2DA 4F6NA 2EOOA 2HGHA 1TF3A 2EQ1A 2EM4A 2YSPA 4GZNC 2ADRA 2EM2A 2CT1A 2EMGA 2YTEA 2EN2A 2EM7A 2EMCA 4WSGA 2M9AA 5KL4A 2PRTA 2WCC3 1X6EA 2YRHA 1UN6B 2DLKA 2J7JA 2WBSA 2EL5A 2EL4A 2YRKA 2WBTA 1YSAC 1X6HA 2EOSA 1B69A 2ELZA 1ZAAC 2JP9A 1TN9A 2EP3A 2YTQA 2EPUA 2RPCA 2EN1A 4FK5C 4F2JC 3EPHA 2EPCA 1X5WA 1TF6A 1A1HA 2EM6A 2EOXA 1P47A 2EN7A 2EMKA 2EPXA 2EPAA 1G2FC 2EMBA 2CTDA 2YTOA 4R2SA 2YRMA 1ZR9A 2EJ4A 2EOHA 1A1KA 2MKNA 2MKDA 2YSOA 2EMAA 3UK3C 5KL5A 2ENHA 2YU5A 1AAYA 2EL6A 2EOEA 2LVHA 3MHSC 1KJKA 4R2CA 2EMZA 1Z1BA 4R2EA 2EOMA 1DGCA 2YTGA 2EM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN8 A;  4IS1 C;  1A1F A;  1WJP A;  2LCE A;  2EN4 A;  2EPP A;  1ZU1 A;  4F6M A;  2LV2 A;  1YUJ A;  2EM8 A;  2YTD A;  2EOZ A;  2LT7 A;  2EOQ A;  1RMD A;  5KL3 A;  3EPJ A;  1F2I G;  1BBO A;  2EQ0 A;  2EOI A;  2E72 A;  2EOF A;  4R2A A;  2EMI A;  4R2R A;  2RSI A;  1A1G A;  2DRP A;  2EM9 A;  1JK1 A;  2YU8 A;  2EOY A;  3EPK A;  2CSH A;  2R1F A;  5KL7 A;  2YTN A;  4IJD A;  2YTP A;  2EM3 A;  2EE8 A;  2YTF A;  2YTI A;  2GHF A;  2EMH A;  2LO3 A;  2EOR A;  3VHT B;  2BB8 A;  2NAB A;  2D9H A;  2MDG A;  2EN6 A;  4M9V C;  1JK2 A;  1X3C A;  3MHH C;  2WBU A;  3EPL A;  2EML A;  1YUI A;  1BB8 A;  1MEY C;  1NCS A;  2ENA A;  1G2D C;  4X9J A;  2I13 A;  2JPA A;  2DMI A;  4R2Q A;  2EPZ A;  1X6F A;  2DGC A;  4R2P A;  1LLM C;  2EOJ A;  3M99 B;  2A25 A;  2EM0 A;  2EMY A;  2EMW A;  2EMF A;  2EQ3 A;  2EMX A;  2ENC A;  1A1L A;  5KL6 A;  5KL2 A;  2EN3 A;  2DLQ A;  2GLI A;  2EPR A;  1A1I A;  1A1J A;  1UBD C;  2VRD A;  2ELY A;  2YTJ A;  4R2D A;  4F6N A;  2EOO A;  2HGH A;  1TF3 A;  2EQ1 A;  2EM4 A;  2YSP A;  4GZN C;  2ADR A;  2EM2 A;  2CT1 A;  2EMG A;  2YTE A;  2EN2 A;  2EM7 A;  2EMC A;  4WSG A;  2M9A A;  5KL4 A;  2PRT A;  2WCC 3;  1X6E A;  2YRH A;  1UN6 B;  2DLK A;  2J7J A;  2WBS A;  2EL5 A;  2EL4 A;  2YRK A;  2WBT A;  1YSA C;  1X6H A;  2EOS A;  1B69 A;  2ELZ A;  1ZAA C;  2JP9 A;  1TN9 A;  2EP3 A;  2YTQ A;  2EPU A;  2RPC A;  2EN1 A;  4FK5 C;  4F2J C;  3EPH A;  2EPC A;  1X5W A;  1TF6 A;  1A1H A;  2EM6 A;  2EOX A;  1P47 A;  2EN7 A;  2EMK A;  2EPX A;  2EPA A;  1G2F C;  2EMB A;  2CTD A;  2YTO A;  4R2S A;  2YRM A;  1ZR9 A;  2EJ4 A;  2EOH A;  1A1K A;  2MKN A;  2MKD A;  2YSO A;  2EMA A;  3UK3 C;  5KL5 A;  2ENH A;  2YU5 A;  1AAY A;  2EL6 A;  2EOE A;  2LVH A;  3MHS C;  1KJK A;  4R2C A;  2EMZ A;  1Z1B A;  4R2E A;  2EOM A;  1DGC A;  2YTG A;  2EM5 A; 
#chains in the Genus database with same CATH topology
 5A6B D;  2JOX A;  1A1F A;  2LCE A;  2EPP A;  1ZU1 A;  4O43 A;  1YUJ A;  5A6A A;  2LMZ A;  2EOZ A;  3HXL A;  3EPJ A;  4BBY A;  2E72 A;  2RSI A;  2YU8 A;  2EOY A;  2LRS A;  5IWA E;  3EPK A;  2R1F A;  2VQF E;  3AV0 A;  2YTP A;  2EM3 A;  2EE8 A;  3HPS A;  2HHH E;  3THN A;  1YYW A;  5A69 A;  4L8N A;  4ZYG A;  2EPO A;  4BS9 A;  2MDG A;  4L5N C;  2EN6 A;  3T1H E;  1XMO E;  4LFC E;  3MHH C;  3EPL A;  2H36 X;  1BB8 A;  3LML A;  2MC6 A;  4LFA E;  2DMI A;  4R2Q A;  3C4T A;  4O4K A;  3T1Y E;  2YPN A;  4B3R E;  4F54 A;  2JOB A;  1LLM C;  2A25 A;  2EMY A;  2EMW A;  1WHQ A;  2EQ3 A;  2CPN A;  1X48 A;  4YY3 E;  2E5L E;  4LF4 E;  5KL2 A;  5IXM B;  2L2N A;  2ODR D;  2DLQ A;  2V85 A;  2EPR A;  4WFT A;  4R2D A;  4F6N A;  1IQS A;  4WPY A;  1HNZ E;  4ZYE A;  3HQ1 A;  4NXM E;  2ADR A;  2F4V E;  2NUF A;  2EN2 A;  2EM7 A;  2EMC A;  2JR1 A;  2FTX B;  4JI3 E;  2V88 A;  2UUA E;  2MC5 A;  5DNY A;  2EL4 A;  2N3G A;  2WBT A;  1XNR E;  1XNQ E;  4JV5 E;  3AUZ A;  4NHR A;  2EP3 A;  2M7Q A;  3EQ1 A;  3IWD A;  1X5W A;  2JWO A;  2YWQ A;  4DR5 E;  2WZO A;  1WXR A;  4NZV A;  4J8Z A;  3J80 C;  2EJ4 A;  1N32 E;  2MKD A;  2YSO A;  1N3G A;  2EMA A;  4JI5 E;  1EH8 A;  5IV8 B;  4I8O A;  4DV6 E;  3MHS C;  4X62 E;  4DV5 E;  2EMZ A;  4OOG C;  2YZT A;  4JYA E;  4BHC A;  1ZAA C;  2EN8 A;  4KWY A;  4YHH E;  1I94 E;  2UXB E;  1WJP A;  4JI8 E;  2EN4 A;  5LLQ A;  2EM8 A;  4DMI A;  5T6J A;  1RMD A;  4AQY E;  3KWR A;  2EOF A;  4JI7 E;  5FLX C;  2EMI A;  4R2R A;  1AH5 A;  5AE2 A;  2L6M A;  3DF6 A;  3F6H A;  4DKK A;  4R8O A;  1WRJ A;  1DQ3 A;  2B9D A;  2E1M A;  1YZ9 A;  1J26 A;  4MLQ A;  1SR9 A;  2NAB A;  2D9H A;  4DV4 E;  2VF1 A;  1HNX E;  2V87 A;  4BHB A;  4NXN E;  2LUQ A;  1NCS A;  2VE7 C;  3LLH A;  4M0V A;  4R03 A;  3J7A G;  2B7T A;  4X9J A;  2UXD E;  1KYQ A;  2RS7 A;  3VYX A;  1X6F A;  5A2Q C;  2N3H A;  2EOJ A;  2LUP B;  2EM0 A;  2RSM A;  3VYY A;  4B3M E;  4DUZ E;  2EMX A;  2ENC A;  2DIX A;  2UXC E;  5AE1 A;  1A1L A;  4O24 A;  3C6K A;  2ZM6 E;  4X66 E;  1UBD C;  2V83 A;  2VRD A;  2YTJ A;  4TUG A;  2DB2 A;  1XMQ E;  1SFE A;  1IBL E;  4M2Z A;  2L8T A;  4Q28 A;  2L33 A;  3BF2 A;  2EM4 A;  1N33 E;  3P1X A;  2R76 A;  4LF7 E;  4WSG A;  4DV0 E;  2WCC 3;  3JU0 A;  2YRH A;  1MGT A;  4X8W A;  5IT9 C;  1YSA C;  3JAM C;  3J7Y p;  4ZYD A;  1X47 A;  2NUG A;  2EOS A;  3ADJ A;  1HR0 E;  3FIG A;  2JP9 A;  1TN9 A;  2YTQ A;  2EPU A;  1QU6 A;  3H09 A;  4LU9 A;  1GZ6 A;  4M30 A;  2EMK A;  2EPX A;  2CTD A;  3OTO E;  1T4N A;  3VK6 A;  1YFH A;  1DI2 A;  5AE3 A;  1ZR9 A;  2EOH A;  2MKN A;  2EPM X;  4X65 E;  2ENH A;  2YU5 A;  1AAY A;  2EL6 A;  4P7D A;  1PDA A;  2LVH A;  3BGH A;  1STU A;  2L3C A;  4R2E A;  4F9A B;  4DR4 E;  1X6E A;  2V86 A;  1YYK A;  2N8X A;  4IS1 C;  1NEI A;  4JI1 E;  4DV2 E;  2LV2 A;  3QG5 C;  2F8B A;  2VQE E;  4DR7 E;  4LTY A;  2LT7 A;  2EOQ A;  1F2I G;  4WXC A;  2LE2 A;  4R2A A;  4DR2 E;  1A1G A;  2DRP A;  2LTR A;  2CSH A;  5KL7 A;  1PJT A;  1YYO A;  2GPI A;  1EKZ A;  2EMH A;  4KHP E;  5CFF E;  1UIL A;  2LO3 A;  1IQO A;  2EOR A;  1T4L B;  2BB8 A;  2EPN A;  2UUB E;  1IMU A;  1N34 E;  4M9V C;  1JK2 A;  3OML A;  4RH8 A;  2WBU A;  1ZBQ A;  3ZOQ B;  4DR1 E;  1MEY C;  3L00 A;  3IWC A;  2B7V A;  2ENA A;  5AAS A;  4JI0 E;  1ZBT A;  3BBG A;  2KOU A;  2RTX A;  2EPZ A;  1N36 E;  4B3S E;  2MDR A;  4HTG A;  3IWB A;  2DGC A;  4JI2 E;  1PKP A;  1WHN A;  1UHZ A;  2EMF A;  5AC4 A;  4O5G A;  5KL6 A;  2EN3 A;  1GTK A;  1A1I A;  2IHR 1;  4B3T E;  1QNT A;  1J5E E;  2L2M A;  4BCA A;  1HNW E;  2YSP A;  4GZN C;  2EM2 A;  2EPL X;  4JI4 E;  2CT1 A;  2EMG A;  2YTE A;  4DUY E;  2M9A A;  5KL4 A;  4LF9 E;  2JVA A;  2PRT A;  2EPK X;  1UN6 B;  2DLK A;  2J7J A;  1X6H A;  2V8Q B;  2ELZ A;  2FV4 B;  3HPZ A;  4HEI A;  4DV1 E;  2LBS B;  4LF6 E;  2EWL A;  1RQ0 A;  1IBM E;  5A6K A;  2NUE A;  4F2J C;  4FK5 C;  4DR3 E;  2EPC A;  4OX9 E;  3RMP A;  1TF6 A;  1FJG E;  4WSP A;  1A1H A;  3HTX A;  3KZY A;  4BC7 A;  1T39 A;  2EM6 A;  2EOX A;  2EN7 A;  4LFB E;  2EPA A;  2EMB A;  2RQL A;  2M1S A;  5LL6 R;  4BMJ A;  1A1K A;  1PJS A;  5KL5 A;  4JI6 E;  1FKA E;  2I9I A;  3KZZ A;  2LJH A;  2EOE A;  2JY9 A;  2L3J A;  1O0W A;  4WXD A;  2EOM A;  1X49 A;  1BBG A;  1DGC A;  3ADL A;  3F6G A;  4BC9 A;  1IBK E;  4F6M A;  2B3T B;  2YTD A;  5A6B A;  5KL3 A;  1BBO A;  2EQ0 A;  2EOI A;  4K0K E;  1L4S A;  1T38 A;  2EM9 A;  1JK1 A;  4N4R B;  4DR6 E;  1EH7 A;  3ECR A;  4DV7 E;  2HC5 A;  2L2K B;  4F9C B;  2YTN A;  4IJD A;  2YTF A;  4RHB B;  2YTI A;  2KHX A;  2GHF A;  2L92 A;  2Q8U A;  3VHT B;  2JYA A;  3DJW A;  4KZS A;  5TSE A;  4ZYH A;  4WX9 A;  1X3C A;  2EML A;  1YUI A;  3BID A;  4Q35 B;  3ADG A;  1G2D C;  1EH6 A;  2I13 A;  5A6J A;  2JPA A;  2DMY A;  1PJQ A;  4LF8 E;  5LMN E;  4R2P A;  2UU9 E;  4GKJ E;  3M99 B;  4DV3 E;  2HJJ A;  4F9B B;  2K7I A;  2G7H A;  3C6M A;  4GEQ B;  2ODR C;  5F3W A;  2GLI A;  3MSW A;  1A1J A;  2ELY A;  2KON A;  1YPN A;  3C4B A;  4GKK E;  2EOO A;  1GQE A;  1TF3 A;  3K6Q A;  2HGH A;  2EQ1 A;  2YT4 A;  3THO B;  2EZ6 A;  2M4I A;  2UUC E;  5AC5 A;  5LMU E;  2LTS A;  2WBS A;  4LF5 E;  2EL5 A;  2YRK A;  1RC7 A;  3J81 C;  1B69 A;  1T4O A;  2V89 A;  2FGG A;  2RPC A;  2EN1 A;  3EPH A;  5BR8 E;  2NA2 A;  2K4V A;  5ADZ A;  2RS6 A;  4MLV A;  1P47 A;  2DSY A;  3JTZ A;  1G2F C;  4WYQ B;  4P78 A;  2BBG A;  2YTO A;  4R2S A;  2YRM A;  2JXP A;  3UK3 C;  2LJU A;  1KJK A;  4R2C A;  4TUI A;  1Z1B A;  4X64 E;  2YTG A;  3TQM A;  2EM5 A;  3ADI A; 
#chains in the Genus database with same CATH homology
 2EN8 A;  4IS1 C;  1A1F A;  1WJP A;  2LCE A;  2EN4 A;  2EPP A;  1ZU1 A;  4F6M A;  2LV2 A;  1YUJ A;  2EM8 A;  2YTD A;  2EOZ A;  2LT7 A;  2EOQ A;  1RMD A;  5KL3 A;  3EPJ A;  1F2I G;  1BBO A;  2EQ0 A;  2EOI A;  2E72 A;  2EOF A;  4R2A A;  2EMI A;  4R2R A;  2RSI A;  1A1G A;  2DRP A;  2EM9 A;  1JK1 A;  2YU8 A;  2EOY A;  3EPK A;  2CSH A;  2R1F A;  5KL7 A;  2YTN A;  4IJD A;  2YTP A;  2EM3 A;  2EE8 A;  2YTF A;  2YTI A;  2GHF A;  2EMH A;  2LO3 A;  2EOR A;  3VHT B;  2BB8 A;  2NAB A;  2D9H A;  2MDG A;  2EN6 A;  4M9V C;  1JK2 A;  1X3C A;  3MHH C;  2WBU A;  3EPL A;  2EML A;  1YUI A;  1BB8 A;  1MEY C;  1NCS A;  2ENA A;  1G2D C;  4X9J A;  2I13 A;  2JPA A;  2DMI A;  4R2Q A;  2EPZ A;  1X6F A;  2DGC A;  4R2P A;  1LLM C;  2EOJ A;  3M99 B;  2A25 A;  2EM0 A;  2EMY A;  2EMW A;  2EMF A;  2EQ3 A;  2EMX A;  2ENC A;  1A1L A;  5KL6 A;  5KL2 A;  2EN3 A;  2DLQ A;  2GLI A;  2EPR A;  1A1I A;  1A1J A;  1UBD C;  2VRD A;  2ELY A;  2YTJ A;  4R2D A;  4F6N A;  2EOO A;  2HGH A;  1TF3 A;  2EQ1 A;  2EM4 A;  2YSP A;  4GZN C;  2ADR A;  2EM2 A;  2CT1 A;  2EMG A;  2YTE A;  2EN2 A;  2EM7 A;  2EMC A;  4WSG A;  2M9A A;  5KL4 A;  2PRT A;  2WCC 3;  1X6E A;  2YRH A;  1UN6 B;  2DLK A;  2J7J A;  2WBS A;  2EL5 A;  2EL4 A;  2YRK A;  2WBT A;  1YSA C;  1X6H A;  2EOS A;  1B69 A;  2ELZ A;  1ZAA C;  2JP9 A;  1TN9 A;  2EP3 A;  2YTQ A;  2EPU A;  2RPC A;  2EN1 A;  4FK5 C;  4F2J C;  3EPH A;  2EPC A;  1X5W A;  1TF6 A;  1A1H A;  2EM6 A;  2EOX A;  1P47 A;  2EN7 A;  2EMK A;  2EPX A;  2EPA A;  1G2F C;  2EMB A;  2CTD A;  2YTO A;  4R2S A;  2YRM A;  1ZR9 A;  2EJ4 A;  2EOH A;  1A1K A;  2MKN A;  2MKD A;  2YSO A;  2EMA A;  3UK3 C;  5KL5 A;  2ENH A;  2YU5 A;  1AAY A;  2EL6 A;  2EOE A;  2LVH A;  3MHS C;  1KJK A;  4R2C A;  2EMZ A;  1Z1B A;  4R2E A;  2EOM A;  1DGC A;  2YTG A;  2EM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...