4P7DA

Antitoxin hicb3 crystal structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDPAKYESKAVKFNLTMSQNLLTAIDKFIATNRGYKNRSQFLAELAREKIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Antitoxin HicB3
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
total genus 30
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4p7dA01
4P78A 2YZTA 2DSYA 4P7DA 3KWRA
chains in the Genus database with same CATH superfamily
2MC6A 4OOGC 4J8ZA 1YSAC 2JVAA 2YTDA 2EM9A 5KL5A 4I8OA 4X9JA 2EN7A 2UUCE 2EPLX 2R1FA 4O43A 3J81C 2EPZA 1A1JA 5F3WA 2EM7A 1AH5A 2UXCE 1BBGA 2LUPB 2EM8A 2EM6A 4O5GA 4IS1C 2DLKA 2EN1A 1YFHA 2JP9A 5A6KA 4X66E 4GKJE 4LFBE 2YTOA 2I13A 4F9BB 3AUZA 2L3CA 1UILA 2HC5A 2YU5A 2YTQA 4HEIA 2RSIA 2JPAA 2ODRD 3HXLA 1ZBTA 4R2DA 2EPXA 1T4OA 4JI0E 4KWYA 2WBSA 2CSHA 2GPIA 2EPPA 2YRMA 5A6BD 2EOYA 1HNZE 4RH8A 2E1MA 1KJKA 1G2DC 5CFFE 4L5NC 1J5EE 2VE7C 3THNA 2LJUA 5A6JA 1AAYA 4F54A 4LF9E 2CTDA 2KOUA 2VQFE 5A2QC 2RTXA 3EPKA 2PRTA 3JAMC 2EOMA 2RSMA 3QG5C 2A25A 2BB8A 4DV0E 3BF2A 4NXNE 4B3RE 2N3HA 2YTIA 2RQLA 2EP3A 1NCSA 2EMFA 2EL4A 2LTRA 2RS7A 1T38A 2FV4B 2DIXA 2LT7A 1HR0E 5AC4A 2EQ3A 5KL3A 4K0KE 1IBME 2MDGA 3VYYA 4DR4E 2MKDA 2RS6A 3KWRA 2EPOA 1X6FA 3C6KA 4R2RA 4R03A 2NUEA 3LMLA 2EE8A 1I94E 2HHHE 1N34E 4R2AA 2YTGA 2EMIA 5T6JA 2NA2A 1A1LA 1J26A 2WBUA 4DUZE 2EN8A 2LMZA 4ZYDA 3HPZA 4X65E 1BBOA 4P78A 4YY3E 4LF5E 2EM5A 2WCC3 4BS9A 2NUGA 3HTXA 2EZ6A 2B9DA 4O24A 1T4NA 1YPNA 2UU9E 3ECRA 2ENAA 1MGTA 1RQ0A 4BBYA 2EJ4A 1F2IG 2EMLA 2DB2A 4M0VA 2M1SA 2EMXA 4WSPA 5KL4A 2UUAE 1HNXE 2V89A 1GTKA 2MKNA 4JI5E 5AE1A 4O4KA 4FK5C 2JOBA 2LJHA 2EMZA 2EM0A 1WHNA 2R76A 4MLQA 4GKKE 3J7Yp 2EOIA 5IXMB 2EM2A 1P47A 2EOHA 2E72A 2M4IA 2KHXA 1DI2A 1UN6B 2JOXA 2FGGA 3IWCA 2MDRA 1O0WA 1RMDA 2L8TA 2HGHA 4WYQB 2EOSA 1FKAE 4ZYEA 2JWOA 1SFEA 1ZU1A 5AE3A 3ZOQB 1XNRE 2L2KB 1JK2A 4DR7E 2F8BA 4HTGA 1DQ3A 2EMHA 1ZR9A 2EL6A 3M99B 3VK6A 2HJJA 2EN3A 4BHBA 4X64E 2JR1A 2K7IA 3BGHA 2LRSA 2EN6A 4N4RB 2EOFA 2ADRA 2EMYA 2M9AA 4JI7E 2JXPA 4DV2E 1IQOA 2ELYA 4F6MA 5KL6A 3VHTB 2JYAA 4GZNC 1IBKE 2LCEA 3MHHC 4DV6E 2EPUA 4JI8E 2EPAA 1T4LB 1BB8A 2WZOA 3C6MA 2EPNA 3VYXA 5TSEA 3DF6A 1HNWE 5IWAE 1YZ9A 1NEIA 2EN2A 2NABA 4JI2E 3THOB 5KL7A 2MC5A 4DR5E 2ODRC 1N33E 4LF7E 4WSGA 5AE2A 2WBTA 4DV7E 2V86A 2K4VA 5KL2A 5LMUE 2EOQA 1MEYC 1A1IA 2EORA 2YSPA 1A1FA 3TQMA 2ZM6E 2H36X 2EOXA 4KHPE 3FIGA 3OTOE 4DV3E 1X6HA 2LUQA 1QU6A 4BMJA 5LL6R 1GZ6A 2EL5A 3KZZA 2EOOA 5AC5A 2UUBE 1A1KA 1N32E 4GEQB 2DMYA 4DV4E 1B69A 2EM4A 1WRJA 5FLXC 3EPJA 4F9AB 3P1XA 4JI4E 5ADZA 4NZVA 3ADIA 1WHQA 4L8NA 2YRHA 3AV0A 4X8WA 1QNTA 4B3ME 4LFAE 2N8XA 4NXME 2L33A 2EMKA 4AQYE 4KZSA 1EH8A 2YTNA 3OMLA 4X62E 5DNYA 3ADLA 4JYAE 3F6HA 4F9CB 2VRDA 4BC7A 4BHCA 4DR1E 2LBSB 2EM3A 2BBGA 2EMWA 4LF6E 2DMIA 2IHR1 1N36E 2D9HA 2EMAA 1L4SA 2YT4A 3IWDA 1YUIA 2RPCA 2EMGA 2V83A 4B3TE 4P7DA 4DMIA 4DR2E 2EPCA 3L00A 4BCAA 1ZBQA 1JK1A 4DR6E 2EWLA 3MSWA 4JI3E 1X5WA 2I9IA 1YYWA 3BBGA 4JV5E 1X6EA 3ADGA 4R8OA 2FTXB 4DV1E 5A69A 2DSYA 2F4VE 2YTFA 3J7AG 4R2QA 2Q8UA 5IV8B 4LU9A 2V87A 1FJGE 1YYKA 2CPNA 2N3GA 1LLMC 3C4BA 3DJWA 4DR3E 1WXRA 2L2MA 2G7HA 4BC9A 3RMPA 2EMCA 1UBDC 3K6QA 1XMOE 4Q35B 4WPYA 4WXCA 1STUA 3C4TA 4WFTA 4ZYGA 5AASA 1TN9A 2EPMX 1PKPA 1PJTA 3MHSC 4M2ZA 2GLIA 4R2SA 1SR9A 1X49A 2LV2A 4LFCE 1IBLE 1UHZA 4LF8E 2YTEA 2ENHA 2B3TB 2YWQA 4JI1E 5LMNE 2EMBA 1PDAA 2YSOA 4TUGA 4LTYA 2DRPA 2L92A 2DGCA 2LVHA 3LLHA 4NHRA 3EPLA 2E5LE 4F6NA 3UK3C 2ELZA 2VF1A 2GHFA 3HPSA 1YYOA 2B7TA 2M7QA 2EQ1A 3BIDA 4M30A 2YPNA 4WX9A 1EH7A 1X3CA 2V88A 3HQ1A 1G2FC 2EPRA 1N3GA 2CT1A 1X47A 3F6GA 1IMUA 2LTSA 2YU8A 2V85A 5A6AA 5BR8E 4OX9E 1GQEA 3H09A 1TF6A 2EPKX 2VQEE 4B3SE 2YTPA 4JI6E 1PJQA 2J7JA 2EOZA 5A6BA 1WJPA 4ZYHA 1Z1BA 2EN4A 4IJDA 1T39A 2KONA 2EOEA 4MLVA 1KYQA 4TUIA 5IT9C 2B7VA 5LLQA 2L3JA 3ADJA 1EH6A 3JU0A 1ZAAC 2L6MA 2YZTA 3JTZA 2V8QB 4DV5E 1A1GA 4LF4E 1XNQE 3KZYA 4R2PA 2DLQA 1TF3A 4RHBB 1XMQE 3T1YE 1A1HA 3EPHA 1PJSA 4DUYE 1DGCA 2ENCA 2L2NA 3EQ1A 1IQSA 2YTJA 3IWBA 2EQ0A 2UXDE 4YHHE 1EKZA 2NUFA 4R2CA 3T1HE 4Q28A 2YRKA 3J80C 2JY9A 2EOJA 1RC7A 4WXDA 4M9VC 2LO3A 1X48A 4DKKA 4R2EA 2LE2A 4F2JC 1YUJA 2UXBE
chains in the Genus database with same CATH topology
2MC6A 3K6QA 4WPYA 4J8ZA 4OOGC 4DV6E 1XMOE 1STUA 2JVAA 3C4TA 4WFTA 4R03A 4JI8E 5AASA 2WZOA 3LMLA 1T4LB 2NUEA 1PKPA 3VYXA 1I94E 3DF6A 4M2ZA 4I8OA 5IWAE 1YZ9A 1HNWE 2HHHE 1SR9A 1X49A 1N34E 2UUCE 4JI2E 4LFCE 5T6JA 1UHZA 3J81C 1IBLE 4LF8E 2MC5A 2NA2A 2B3TB 2ODRC 4DR5E 5F3WA 4JI1E 1N33E 4LF7E 5AE2A 1J26A 5LMNE 4DV7E 2UXCE 2V86A 4DUZE 4TUGA 2K4VA 2LUPB 4LTYA 5LMUE 2LMZA 2L92A 3HPZA 4X65E 3LLHA 2E5LE 4P78A 4YY3E 4X66E 2ZM6E 2H36X 4LF5E 2NUGA 3FIGA 4KHPE 4GKJE 4LFBE 3OTOE 2VF1A 4BS9A 4DV3E 3HPSA 2LUQA 3AUZA 4F9BB 2L3CA 1YYOA 2EZ6A 1QU6A 1UILA 2B7TA 2M7QA 4BMJA 2B9DA 4M30A 5LL6R 1GZ6A 1T4NA 2ODRD 2V88A 3HQ1A 2UUBE 3HXLA 1N32E 1ZBTA 4GEQB 2DMYA 4DV4E 2UU9E 5FLXC 1RQ0A 4BBYA 4F9AB 1T4OA 3P1XA 4JI4E 5ADZA 4JI0E 3ADIA 1WHQA 1X47A 3F6GA 4L8NA 2DB2A 3AV0A 2LTSA 2M1SA 4M0VA 4WSPA 2V85A 4X8WA 2UUAE 4B3ME 4LFAE 1HNXE 2V89A 5BR8E 4OX9E 1GQEA 5AE1A 4JI5E 2L33A 3H09A 4NXME 2JOBA 2VQEE 4B3SE 4AQYE 2LJHA 4KZSA 1HNZE 2E1MA 4JI6E 1WHNA 5CFFE 4L5NC 3OMLA 4X62E 1J5EE 5DNYA 2VE7C 3J7Yp 4GKKE 3ADLA 4F54A 3F6HA 4JYAE 4F9CB 2KONA 4BC7A 4DR1E 2LBSB 4LF9E 4TUIA 2KOUA 2B7VA 2M4IA 5IT9C 2L3JA 2VQFE 2KHXA 3ADJA 5A2QC 2IHR1 4LF6E 1DI2A 3JU0A 2L6MA 2RTXA 2JOXA 2FGGA 2YZTA 3JTZA 2V8QB 4DV5E 1N36E 3IWCA 3JAMC 2YT4A 2MDRA 3IWDA 4LF4E 1O0WA 2L8TA 1XNQE 2RSMA 4WYQB 1FKAE 2V83A 2JWOA 5AE3A 4P7DA 3ZOQB 3T1YE 4DMIA 4DV0E 4DR2E 1XMQE 4B3TE 4NXNE 1XNRE 4B3RE 2L2KB 4DUYE 4BCAA 1ZBQA 2L2NA 4DR7E 4DR6E 2EWLA 2N3HA 2F8BA 3MSWA 4JI3E 1YYWA 1DQ3A 4JV5E 3ADGA 4R8OA 2FTXB 3VK6A 2LTRA 4DV1E 2RS7A 3IWBA 2UXDE 2DSYA 4YHHE 1EKZA 2F4VE 4X64E 3J7AG 2FV4B 2NUFA 2DIXA 2JR1A 4LU9A 2V87A 1HR0E 3T1HE 4Q28A 1FJGE 2LRSA 3J80C 2CPNA 2JY9A 2N3GA 1YYKA 3HTXA 3C4BA 3DJWA 1RC7A 4DR3E 1IBME 1X48A 4K0KE 1WXRA 3VYYA 4DKKA 4JI7E 4DR4E 2L2MA 4DV2E 2G7HA 2LE2A 2RS6A 4BC9A 3RMPA 3KWRA 1IBKE 2UXBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P78 A;  2YZT A;  2DSY A;  4P7D A;  3KWR A; 
#chains in the Genus database with same CATH topology
 2MC6 A;  4OOG C;  4J8Z A;  1YSA C;  2JVA A;  2YTD A;  2EM9 A;  5KL5 A;  4I8O A;  4X9J A;  2EN7 A;  2UUC E;  2EPL X;  2R1F A;  4O43 A;  3J81 C;  2EPZ A;  1A1J A;  5F3W A;  2EM7 A;  1AH5 A;  2UXC E;  1BBG A;  2LUP B;  2EM8 A;  2EM6 A;  4O5G A;  4IS1 C;  2DLK A;  2EN1 A;  1YFH A;  2JP9 A;  5A6K A;  4X66 E;  4GKJ E;  4LFB E;  2YTO A;  2I13 A;  4F9B B;  3AUZ A;  2L3C A;  1UIL A;  2HC5 A;  2YU5 A;  2YTQ A;  4HEI A;  2RSI A;  2JPA A;  2ODR D;  3HXL A;  1ZBT A;  4R2D A;  2EPX A;  1T4O A;  4JI0 E;  4KWY A;  2WBS A;  2CSH A;  2GPI A;  2EPP A;  2YRM A;  5A6B D;  2EOY A;  1HNZ E;  4RH8 A;  2E1M A;  1KJK A;  1G2D C;  5CFF E;  4L5N C;  1J5E E;  2VE7 C;  3THN A;  2LJU A;  5A6J A;  1AAY A;  4F54 A;  4LF9 E;  2CTD A;  2KOU A;  2VQF E;  5A2Q C;  2RTX A;  3EPK A;  2PRT A;  3JAM C;  2EOM A;  2RSM A;  3QG5 C;  2A25 A;  2BB8 A;  4DV0 E;  3BF2 A;  4NXN E;  4B3R E;  2N3H A;  2YTI A;  2RQL A;  2EP3 A;  1NCS A;  2EMF A;  2EL4 A;  2LTR A;  2RS7 A;  1T38 A;  2FV4 B;  2DIX A;  2LT7 A;  1HR0 E;  5AC4 A;  2EQ3 A;  5KL3 A;  4K0K E;  1IBM E;  2MDG A;  3VYY A;  4DR4 E;  2MKD A;  2RS6 A;  3KWR A;  2EPO A;  1X6F A;  3C6K A;  4R2R A;  4R03 A;  2NUE A;  3LML A;  2EE8 A;  1I94 E;  2HHH E;  1N34 E;  4R2A A;  2YTG A;  2EMI A;  5T6J A;  2NA2 A;  1A1L A;  1J26 A;  2WBU A;  4DUZ E;  2EN8 A;  2LMZ A;  4ZYD A;  3HPZ A;  4X65 E;  1BBO A;  4P78 A;  4YY3 E;  4LF5 E;  2EM5 A;  2WCC 3;  4BS9 A;  2NUG A;  3HTX A;  2EZ6 A;  2B9D A;  4O24 A;  1T4N A;  1YPN A;  2UU9 E;  3ECR A;  2ENA A;  1MGT A;  1RQ0 A;  4BBY A;  2EJ4 A;  1F2I G;  2EML A;  2DB2 A;  4M0V A;  2M1S A;  2EMX A;  4WSP A;  5KL4 A;  2UUA E;  1HNX E;  2V89 A;  1GTK A;  2MKN A;  4JI5 E;  5AE1 A;  4O4K A;  4FK5 C;  2JOB A;  2LJH A;  2EMZ A;  2EM0 A;  1WHN A;  2R76 A;  4MLQ A;  4GKK E;  3J7Y p;  2EOI A;  5IXM B;  2EM2 A;  1P47 A;  2EOH A;  2E72 A;  2M4I A;  2KHX A;  1DI2 A;  1UN6 B;  2JOX A;  2FGG A;  3IWC A;  2MDR A;  1O0W A;  1RMD A;  2L8T A;  2HGH A;  4WYQ B;  2EOS A;  1FKA E;  4ZYE A;  2JWO A;  1SFE A;  1ZU1 A;  5AE3 A;  3ZOQ B;  1XNR E;  2L2K B;  1JK2 A;  4DR7 E;  2F8B A;  4HTG A;  1DQ3 A;  2EMH A;  1ZR9 A;  2EL6 A;  3M99 B;  3VK6 A;  2HJJ A;  2EN3 A;  4BHB A;  4X64 E;  2JR1 A;  2K7I A;  3BGH A;  2LRS A;  2EN6 A;  4N4R B;  2EOF A;  2ADR A;  2EMY A;  2M9A A;  4JI7 E;  2JXP A;  4DV2 E;  1IQO A;  2ELY A;  4F6M A;  5KL6 A;  3VHT B;  2JYA A;  4GZN C;  1IBK E;  2LCE A;  3MHH C;  4DV6 E;  2EPU A;  4JI8 E;  2EPA A;  1T4L B;  1BB8 A;  2WZO A;  3C6M A;  2EPN A;  3VYX A;  5TSE A;  3DF6 A;  1HNW E;  5IWA E;  1YZ9 A;  1NEI A;  2EN2 A;  2NAB A;  4JI2 E;  3THO B;  5KL7 A;  2MC5 A;  4DR5 E;  2ODR C;  1N33 E;  4LF7 E;  4WSG A;  5AE2 A;  2WBT A;  4DV7 E;  2V86 A;  2K4V A;  5KL2 A;  5LMU E;  2EOQ A;  1MEY C;  1A1I A;  2EOR A;  2YSP A;  1A1F A;  3TQM A;  2ZM6 E;  2H36 X;  2EOX A;  4KHP E;  3FIG A;  3OTO E;  4DV3 E;  1X6H A;  2LUQ A;  1QU6 A;  4BMJ A;  5LL6 R;  1GZ6 A;  2EL5 A;  3KZZ A;  2EOO A;  5AC5 A;  2UUB E;  1A1K A;  1N32 E;  4GEQ B;  2DMY A;  4DV4 E;  1B69 A;  2EM4 A;  1WRJ A;  5FLX C;  3EPJ A;  4F9A B;  3P1X A;  4JI4 E;  5ADZ A;  4NZV A;  3ADI A;  1WHQ A;  4L8N A;  2YRH A;  3AV0 A;  4X8W A;  1QNT A;  4B3M E;  4LFA E;  2N8X A;  4NXM E;  2L33 A;  2EMK A;  4AQY E;  4KZS A;  1EH8 A;  2YTN A;  3OML A;  4X62 E;  5DNY A;  3ADL A;  4JYA E;  3F6H A;  4F9C B;  2VRD A;  4BC7 A;  4BHC A;  4DR1 E;  2LBS B;  2EM3 A;  2BBG A;  2EMW A;  4LF6 E;  2DMI A;  2IHR 1;  1N36 E;  2D9H A;  2EMA A;  1L4S A;  2YT4 A;  3IWD A;  1YUI A;  2RPC A;  2EMG A;  2V83 A;  4B3T E;  4P7D A;  4DMI A;  4DR2 E;  2EPC A;  3L00 A;  4BCA A;  1ZBQ A;  1JK1 A;  4DR6 E;  2EWL A;  3MSW A;  4JI3 E;  1X5W A;  2I9I A;  1YYW A;  3BBG A;  4JV5 E;  1X6E A;  3ADG A;  4R8O A;  2FTX B;  4DV1 E;  5A69 A;  2DSY A;  2F4V E;  2YTF A;  3J7A G;  4R2Q A;  2Q8U A;  5IV8 B;  4LU9 A;  2V87 A;  1FJG E;  1YYK A;  2CPN A;  2N3G A;  1LLM C;  3C4B A;  3DJW A;  4DR3 E;  1WXR A;  2L2M A;  2G7H A;  4BC9 A;  3RMP A;  2EMC A;  1UBD C;  3K6Q A;  1XMO E;  4Q35 B;  4WPY A;  4WXC A;  1STU A;  3C4T A;  4WFT A;  4ZYG A;  5AAS A;  1TN9 A;  2EPM X;  1PKP A;  1PJT A;  3MHS C;  4M2Z A;  2GLI A;  4R2S A;  1SR9 A;  1X49 A;  2LV2 A;  4LFC E;  1IBL E;  1UHZ A;  4LF8 E;  2YTE A;  2ENH A;  2B3T B;  2YWQ A;  4JI1 E;  5LMN E;  2EMB A;  1PDA A;  2YSO A;  4TUG A;  4LTY A;  2DRP A;  2L92 A;  2DGC A;  2LVH A;  3LLH A;  4NHR A;  3EPL A;  2E5L E;  4F6N A;  3UK3 C;  2ELZ A;  2VF1 A;  2GHF A;  3HPS A;  1YYO A;  2B7T A;  2M7Q A;  2EQ1 A;  3BID A;  4M30 A;  2YPN A;  4WX9 A;  1EH7 A;  1X3C A;  2V88 A;  3HQ1 A;  1G2F C;  2EPR A;  1N3G A;  2CT1 A;  1X47 A;  3F6G A;  1IMU A;  2LTS A;  2YU8 A;  2V85 A;  5A6A A;  5BR8 E;  4OX9 E;  1GQE A;  3H09 A;  1TF6 A;  2EPK X;  2VQE E;  4B3S E;  2YTP A;  4JI6 E;  1PJQ A;  2J7J A;  2EOZ A;  5A6B A;  1WJP A;  4ZYH A;  1Z1B A;  2EN4 A;  4IJD A;  1T39 A;  2KON A;  2EOE A;  4MLV A;  1KYQ A;  4TUI A;  5IT9 C;  2B7V A;  5LLQ A;  2L3J A;  3ADJ A;  1EH6 A;  3JU0 A;  1ZAA C;  2L6M A;  2YZT A;  3JTZ A;  2V8Q B;  4DV5 E;  1A1G A;  4LF4 E;  1XNQ E;  3KZY A;  4R2P A;  2DLQ A;  1TF3 A;  4RHB B;  1XMQ E;  3T1Y E;  1A1H A;  3EPH A;  1PJS A;  4DUY E;  1DGC A;  2ENC A;  2L2N A;  3EQ1 A;  1IQS A;  2YTJ A;  3IWB A;  2EQ0 A;  2UXD E;  4YHH E;  1EKZ A;  2NUF A;  4R2C A;  3T1H E;  4Q28 A;  2YRK A;  3J80 C;  2JY9 A;  2EOJ A;  1RC7 A;  4WXD A;  4M9V C;  2LO3 A;  1X48 A;  4DKK A;  4R2E A;  2LE2 A;  4F2J C;  1YUJ A;  2UXB E; 
#chains in the Genus database with same CATH homology
 2MC6 A;  3K6Q A;  4WPY A;  4J8Z A;  4OOG C;  4DV6 E;  1XMO E;  1STU A;  2JVA A;  3C4T A;  4WFT A;  4R03 A;  4JI8 E;  5AAS A;  2WZO A;  3LML A;  1T4L B;  2NUE A;  1PKP A;  3VYX A;  1I94 E;  3DF6 A;  4M2Z A;  4I8O A;  5IWA E;  1YZ9 A;  1HNW E;  2HHH E;  1SR9 A;  1X49 A;  1N34 E;  2UUC E;  4JI2 E;  4LFC E;  5T6J A;  1UHZ A;  3J81 C;  1IBL E;  4LF8 E;  2MC5 A;  2NA2 A;  2B3T B;  2ODR C;  4DR5 E;  5F3W A;  4JI1 E;  1N33 E;  4LF7 E;  5AE2 A;  1J26 A;  5LMN E;  4DV7 E;  2UXC E;  2V86 A;  4DUZ E;  4TUG A;  2K4V A;  2LUP B;  4LTY A;  5LMU E;  2LMZ A;  2L92 A;  3HPZ A;  4X65 E;  3LLH A;  2E5L E;  4P78 A;  4YY3 E;  4X66 E;  2ZM6 E;  2H36 X;  4LF5 E;  2NUG A;  3FIG A;  4KHP E;  4GKJ E;  4LFB E;  3OTO E;  2VF1 A;  4BS9 A;  4DV3 E;  3HPS A;  2LUQ A;  3AUZ A;  4F9B B;  2L3C A;  1YYO A;  2EZ6 A;  1QU6 A;  1UIL A;  2B7T A;  2M7Q A;  4BMJ A;  2B9D A;  4M30 A;  5LL6 R;  1GZ6 A;  1T4N A;  2ODR D;  2V88 A;  3HQ1 A;  2UUB E;  3HXL A;  1N32 E;  1ZBT A;  4GEQ B;  2DMY A;  4DV4 E;  2UU9 E;  5FLX C;  1RQ0 A;  4BBY A;  4F9A B;  1T4O A;  3P1X A;  4JI4 E;  5ADZ A;  4JI0 E;  3ADI A;  1WHQ A;  1X47 A;  3F6G A;  4L8N A;  2DB2 A;  3AV0 A;  2LTS A;  2M1S A;  4M0V A;  4WSP A;  2V85 A;  4X8W A;  2UUA E;  4B3M E;  4LFA E;  1HNX E;  2V89 A;  5BR8 E;  4OX9 E;  1GQE A;  5AE1 A;  4JI5 E;  2L33 A;  3H09 A;  4NXM E;  2JOB A;  2VQE E;  4B3S E;  4AQY E;  2LJH A;  4KZS A;  1HNZ E;  2E1M A;  4JI6 E;  1WHN A;  5CFF E;  4L5N C;  3OML A;  4X62 E;  1J5E E;  5DNY A;  2VE7 C;  3J7Y p;  4GKK E;  3ADL A;  4F54 A;  3F6H A;  4JYA E;  4F9C B;  2KON A;  4BC7 A;  4DR1 E;  2LBS B;  4LF9 E;  4TUI A;  2KOU A;  2B7V A;  2M4I A;  5IT9 C;  2L3J A;  2VQF E;  2KHX A;  3ADJ A;  5A2Q C;  2IHR 1;  4LF6 E;  1DI2 A;  3JU0 A;  2L6M A;  2RTX A;  2JOX A;  2FGG A;  2YZT A;  3JTZ A;  2V8Q B;  4DV5 E;  1N36 E;  3IWC A;  3JAM C;  2YT4 A;  2MDR A;  3IWD A;  4LF4 E;  1O0W A;  2L8T A;  1XNQ E;  2RSM A;  4WYQ B;  1FKA E;  2V83 A;  2JWO A;  5AE3 A;  4P7D A;  3ZOQ B;  3T1Y E;  4DMI A;  4DV0 E;  4DR2 E;  1XMQ E;  4B3T E;  4NXN E;  1XNR E;  4B3R E;  2L2K B;  4DUY E;  4BCA A;  1ZBQ A;  2L2N A;  4DR7 E;  4DR6 E;  2EWL A;  2N3H A;  2F8B A;  3MSW A;  4JI3 E;  1YYW A;  1DQ3 A;  4JV5 E;  3ADG A;  4R8O A;  2FTX B;  3VK6 A;  2LTR A;  4DV1 E;  2RS7 A;  3IWB A;  2UXD E;  2DSY A;  4YHH E;  1EKZ A;  2F4V E;  4X64 E;  3J7A G;  2FV4 B;  2NUF A;  2DIX A;  2JR1 A;  4LU9 A;  2V87 A;  1HR0 E;  3T1H E;  4Q28 A;  1FJG E;  2LRS A;  3J80 C;  2CPN A;  2JY9 A;  2N3G A;  1YYK A;  3HTX A;  3C4B A;  3DJW A;  1RC7 A;  4DR3 E;  1IBM E;  1X48 A;  4K0K E;  1WXR A;  3VYY A;  4DKK A;  4JI7 E;  4DR4 E;  2L2M A;  4DV2 E;  2G7H A;  2LE2 A;  2RS6 A;  4BC9 A;  3RMP A;  3KWR A;  1IBK E;  2UXB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...