4P7DA

Antitoxin hicb3 crystal structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
b'MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDPAKYESKAVKFNLTMSQNLLTAIDKFIATNRGYKNRSQFLAELAREKIIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antitoxin HicB3
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
total genus 30
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4p7dA01
4P7DA 4P78A 2DSYA 2YZTA 3KWRA
chains in the Genus database with same CATH superfamily
1FJGE 1SFEA 4HTGA 2CTDA 2V87A 3AV0A 5TSEA 3VK6A 5A6JA 4DV3E 1EH6A 2YZTA 3F6GA 4ZYHA 3ECRA 2UUBE 2FTXB 1EH7A 4X64E 1HNZE 2DMIA 4OX9E 2EL4A 2DB2A 2WBUA 4O24A 1YZ9A 2E5LE 2LRSA 1N34E 4TUGA 2EPZA 2JYAA 2GHFA 5KL5A 2MDGA 1GTKA 4DKKA 2LVHA 1UN6B 4R2AA 2EMXA 1DGCA 5KL4A 4WYQB 2KONA 3JU0A 2EPXA 2YTJA 2YWQA 2ELZA 2LJHA 5CFFE 2ENHA 5IWAE 2KHXA 4B3RE 1NEIA 2M9AA 4GKJE 1J26A 2DIXA 3THOB 2ELYA 5A69A 2JOXA 2EE8A 2EPOA 1BB8A 5AC5A 4LF7E 4X62E 2EPUA 3L00A 2WCC3 2DMYA 2EMWA 2YRMA 1WXRA 2YTGA 4R2DA 2EOOA 2DLQA 2YPNA 4DMIA 3EPLA 2EL5A 1EKZA 3T1YE 1YFHA 4LFAE 2JY9A 2EOHA 3BBGA 1A1KA 2J7JA 4TUIA 4JI3E 3EQ1A 1WRJA 4WX9A 4F6NA 5A2QC 2ADRA 2IHR1 1GZ6A 1X6FA 3UK3C 2NUFA 3F6HA 4MLVA 2A25A 2B7TA 2LMZA 4F9CB 1IMUA 1ZR9A 2LUQA 2EN7A 4JI7E 2EPCA 2MKNA 3J7AG 2VQEE 3HTXA 4R2EA 1X3CA 4B3TE 4JV5E 3RMPA 1T38A 2YTFA 4WSPA 4X65E 2JPAA 2CPNA 1YYOA 1WHNA 4DR6E 1DQ3A 2RTXA 2EN3A 1LLMC 2L2MA 1XNQE 1A1LA 3ADJA 4DR5E 3BGHA 2NUEA 3ADIA 4DR3E 2NUGA 1Z1BA 2YTIA 4X9JA 4DR4E 4BBYA 4ZYDA 1RMDA 4F9BB 1X47A 4DV5E 2FGGA 2L8TA 3JTZA 1YPNA 2EOIA 2EPPA 2L3CA 2LUPB 1IBKE 1KJKA 1PJSA 5IV8B 2EMFA 4B3SE 3LMLA 3IWDA 2EOYA 3LLHA 2JOBA 5FLXC 2I9IA 2B7VA 1X48A 2JR1A 3KZZA 5KL6A 5IT9C 1MGTA 2I13A 2CSHA 4DR1E 2EOQA 2EN1A 4ZYGA 4JI0E 2L6MA 2V83A 4MLQA 3VYYA 4P7DA 2K4VA 2VE7C 1IQSA 2BB8A 3QG5C 4Q35B 1AAYA 2N8XA 2EP3A 2EOFA 2EOJA 5IXMB 2EMLA 2MC5A 2EL6A 4X8WA 2UUCE 4OOGC 1N36E 4BCAA 2LJUA 1NCSA 2B9DA 2VF1A 2E72A 1YUJA 2EN2A 2MDRA 2YU5A 5A6BD 1XMQE 1EH8A 1A1GA 4LTYA 2M1SA 1N32E 1ZBTA 2N3GA 3M99B 1JK2A 4DR7E 1IBLE 5A6BA 4O5GA 4F2JC 4ZYEA 2V85A 2GPIA 3ADLA 5AASA 4JI8E 4WFTA 4O43A 1ZBQA 2G7HA 1KYQA 3VHTB 4B3ME 4NZVA 4JI1E 1PKPA 2YTEA 1HNWE 2RS7A 3ZOQB 3OMLA 5KL2A 1A1JA 4LF8E 2YTDA 4Q28A 5LL6R 4DUZE 2RS6A 1ZAAC 5KL3A 1JK1A 4KHPE 1MEYC 2EMZA 3THNA 2DRPA 2ZM6E 2LV2A 4JYAE 2EM9A 3J81C 4WSGA 3JAMC 5AE1A 1X49A 1AH5A 3DF6A 4R2QA 2EOEA 1PDAA 2EPAA 5AC4A 2EMYA 4LFCE 2NA2A 4K0KE 4I8OA 2EM6A 1TN9A 2EWLA 4M9VC 1UBDC 4JI5E 4JI2E 1I94E 2D9HA 2R1FA 2YRHA 1F2IG 2LO3A 2LTRA 2WBTA 3C6KA 4DV1E 2M4IA 2EPNA 4F54A 4WXCA 2N3HA 2VQFE 2PRTA 2HJJA 2EMGA 4LF9E 2L92A 4DR2E 4L8NA 1O0WA 2UU9E 2YU8A 1IBME 5AE3A 1ZU1A 2EM7A 4DV7E 2LT7A 3HPSA 4LU9A 4R2RA 2LCEA 5F3WA 2CT1A 2EQ0A 1T4LB 1FKAE 1QU6A 3KWRA 2HHHE 2EOMA 1T39A 5LMNE 1XNRE 4NXNE 4BS9A 2JXPA 1PJQA 4AQYE 4R2PA 2YT4A 4L5NC 4DV0E 2F8BA 2NABA 2YTPA 4DV6E 2LBSB 2MC6A 2EM4A 2YTNA 3HPZA 4JI4E 4DV2E 1UILA 4P78A 2EM8A 4GZNC 2UUAE 2EPRA 2R76A 4FK5C 3FIGA 3T1HE 2EQ3A 2L2NA 4BC7A 2JWOA 1T4OA 4RHBB 3VYXA 4WPYA 4LFBE 2L3JA 2ODRD 4NHRA 4GEQB 2EMIA 2HC5A 3MSWA 4IJDA 3EPKA 1BBOA 2GLIA 1N3GA 4LF4E 2RQLA 1X5WA 5BR8E 4RH8A 2EOZA 2YTQA 1J5EE 4N4RB 2EPMX 2EN4A 2V88A 1IQOA 2DLKA 2MKDA 1WHQA 2EPKX 5LLQA 4M0VA 2EM0A 2UXCE 2EMCA 4F6MA 4R2CA 3ADGA 2B3TB 4IS1C 4NXME 4GKKE 4BC9A 1BBGA 3EPJA 1G2DC 3KZYA 1TF3A 4JI6E 1RQ0A 3HXLA 2V89A 1A1FA 2EOXA 5A6AA 2EM3A 3IWBA 1UHZA 2V8QB 3OTOE 4YHHE 4DV4E 2ENAA 1PJTA 2DSYA 1YSAC 4KZSA 2LE2A 2VRDA 5DNYA 4J8ZA 1HNXE 1N33E 2UXBE 3EPHA 2FV4B 3MHHC 2KOUA 5AE2A 3H09A 4O4KA 3C4TA 2JVAA 4LF6E 2YSPA 2YSOA 5LMUE 4R2SA 2EZ6A 2YTOA 3J7Yp 1HR0E 2EMKA 1X6EA 2EMBA 3P1XA 4YY3E 4R8OA 1WJPA 3MHSC 2YRKA 2Q8UA 1B69A 2HGHA 1TF6A 2EQ1A 4BMJA 3J80C 3BIDA 1DI2A 2EM5A 5ADZA 4WXDA 2WBSA 2EPLX 1X6HA 2L33A 2EMHA 4LF5E 2V86A 3AUZA 3C6MA 2BBGA 2RSMA 1YYWA 1YUIA 2RPCA 2UXDE 3BF2A 5KL7A 4KWYA 4M30A 1SR9A 1XMOE 2JP9A 1RC7A 1A1HA 4R03A 1QNTA 2WZOA 2ODRC 3DJWA 5A6KA 2M7QA 2RSIA 2EN6A 2EORA 3K6QA 4DUYE 2L2KB 1STUA 3C4BA 2DGCA 2EN8A 5T6JA 2E1MA 2EMAA 3IWCA 4BHCA 3HQ1A 1GQEA 4X66E 2ENCA 2EJ4A 4BHBA 1L4SA 2EOSA 2LTSA 2EM2A 1T4NA 3TQMA 2F4VE 1G2FC 1P47A 1A1IA 2K7IA 2H36X 4M2ZA 4F9AB 1YYKA 4HEIA
chains in the Genus database with same CATH topology
1FJGE 3ADJA 3JAMC 4DR5E 2V88A 5AE1A 1X49A 2V87A 3AV0A 3VK6A 4DV3E 2NUEA 3ADIA 1WHQA 3DF6A 2YZTA 4M0VA 4DR3E 3F6GA 2UXCE 2UUBE 2NUGA 2FTXB 3ADGA 2B3TB 4X64E 4NXME 4GKKE 4BC9A 1HNZE 4JI6E 4LFCE 4DR4E 4BBYA 1RQ0A 3HXLA 4OX9E 1XNQE 2NA2A 4K0KE 2V89A 2DB2A 4I8OA 1YZ9A 2EWLA 2E5LE 4F9BB 2LRSA 4JI5E 3IWBA 4JI2E 1I94E 1N34E 4TUGA 1UHZA 1X47A 2V8QB 2FGGA 2L8TA 4YHHE 3JTZA 3OTOE 4DV4E 4DV5E 2DSYA 2L3CA 4KZSA 2LE2A 2LUPB 2LTRA 1IBKE 4DV1E 2M4IA 4F54A 5DNYA 4J8ZA 1HNXE 1N33E 4B3SE 2UXBE 4DKKA 3LMLA 3IWDA 2N3HA 2VQFE 2FV4B 3LLHA 2JOBA 2KOUA 5FLXC 4LF9E 2L92A 5AE2A 3H09A 4DR2E 2B7VA 1X48A 2JR1A 3C4TA 5IT9C 4L8NA 2JVAA 4WYQB 1O0WA 2KONA 4DR1E 4JI0E 3JU0A 2UU9E 4LF6E 5LMUE 2L6MA 5AE3A 1IBME 2V83A 2EZ6A 3VYYA 3J7Yp 4P7DA 2K4VA 2LJHA 4DV7E 2VE7C 5CFFE 1HR0E 3P1XA 4YY3E 3HPSA 4LU9A 5IWAE 4R8OA 2KHXA 5F3WA 4B3RE 4GKJE 1T4LB 1FKAE 1QU6A 1J26A 2MC5A 3KWRA 4BMJA 3J80C 2HHHE 2DIXA 4X8WA 1DI2A 5LMNE 2UUCE 4OOGC 1XNRE 2JOXA 4NXNE 1N36E 5ADZA 4BCAA 4BS9A 1N32E 4LF7E 4X62E 2B9DA 2VF1A 4AQYE 2L33A 4LF5E 2DMYA 2YT4A 2V86A 3AUZA 4L5NC 4DV0E 2F8BA 2RSMA 1YYWA 2MDRA 1WXRA 1XMQE 4DMIA 4DV6E 2LBSB 2MC6A 2UXDE 4M30A 1SR9A 1XMOE 1EKZA 4LTYA 1RC7A 3T1YE 4LFAE 2M1SA 3HPZA 2JY9A 1ZBTA 2N3GA 4DV2E 4R03A 2WZOA 4JI4E 2ODRC 3DJWA 1UILA 4P78A 4TUIA 2UUAE 2M7QA 4DR7E 1IBLE 4JI3E 3FIGA 3K6QA 4BC7A 2L2NA 2V85A 5A2QC 4DUYE 2JWOA 2IHR1 3T1HE 5AASA 1T4OA 4JI8E 1GZ6A 1STUA 3C4BA 2L2KB 3ADLA 4WFTA 5T6JA 2NUFA 1ZBQA 2E1MA 2G7HA 2B7TA 2LMZA 3F6HA 4WPYA 4F9CB 3VYXA 4B3ME 2LUQA 3IWCA 3HQ1A 4JI1E 1PKPA 4JI7E 4LFBE 1GQEA 1HNWE 2RS7A 3ZOQB 4X66E 3J7AG 2L3JA 3OMLA 2ODRD 2VQEE 3HTXA 4GEQB 4LF8E 4Q28A 5LL6R 3MSWA 4DUZE 2LTSA 2RS6A 4B3TE 3RMPA 4JV5E 1T4NA 4LF4E 2F4VE 4WSPA 4X65E 4KHPE 2CPNA 2H36X 1YYOA 1WHNA 4DR6E 5BR8E 2ZM6E 1DQ3A 4F9AB 4M2ZA 2RTXA 1YYKA 4JYAE 3J81C 2L2MA 1J5EE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7D A;  4P78 A;  2DSY A;  2YZT A;  3KWR A; 
#chains in the Genus database with same CATH topology
 1FJG E;  1SFE A;  4HTG A;  2CTD A;  2V87 A;  3AV0 A;  5TSE A;  3VK6 A;  5A6J A;  4DV3 E;  1EH6 A;  2YZT A;  3F6G A;  4ZYH A;  3ECR A;  2UUB E;  2FTX B;  1EH7 A;  4X64 E;  1HNZ E;  2DMI A;  4OX9 E;  2EL4 A;  2DB2 A;  2WBU A;  4O24 A;  1YZ9 A;  2E5L E;  2LRS A;  1N34 E;  4TUG A;  2EPZ A;  2JYA A;  2GHF A;  5KL5 A;  2MDG A;  1GTK A;  4DKK A;  2LVH A;  1UN6 B;  4R2A A;  2EMX A;  1DGC A;  5KL4 A;  4WYQ B;  2KON A;  3JU0 A;  2EPX A;  2YTJ A;  2YWQ A;  2ELZ A;  2LJH A;  5CFF E;  2ENH A;  5IWA E;  2KHX A;  4B3R E;  1NEI A;  2M9A A;  4GKJ E;  1J26 A;  2DIX A;  3THO B;  2ELY A;  5A69 A;  2JOX A;  2EE8 A;  2EPO A;  1BB8 A;  5AC5 A;  4LF7 E;  4X62 E;  2EPU A;  3L00 A;  2WCC 3;  2DMY A;  2EMW A;  2YRM A;  1WXR A;  2YTG A;  4R2D A;  2EOO A;  2DLQ A;  2YPN A;  4DMI A;  3EPL A;  2EL5 A;  1EKZ A;  3T1Y E;  1YFH A;  4LFA E;  2JY9 A;  2EOH A;  3BBG A;  1A1K A;  2J7J A;  4TUI A;  4JI3 E;  3EQ1 A;  1WRJ A;  4WX9 A;  4F6N A;  5A2Q C;  2ADR A;  2IHR 1;  1GZ6 A;  1X6F A;  3UK3 C;  2NUF A;  3F6H A;  4MLV A;  2A25 A;  2B7T A;  2LMZ A;  4F9C B;  1IMU A;  1ZR9 A;  2LUQ A;  2EN7 A;  4JI7 E;  2EPC A;  2MKN A;  3J7A G;  2VQE E;  3HTX A;  4R2E A;  1X3C A;  4B3T E;  4JV5 E;  3RMP A;  1T38 A;  2YTF A;  4WSP A;  4X65 E;  2JPA A;  2CPN A;  1YYO A;  1WHN A;  4DR6 E;  1DQ3 A;  2RTX A;  2EN3 A;  1LLM C;  2L2M A;  1XNQ E;  1A1L A;  3ADJ A;  4DR5 E;  3BGH A;  2NUE A;  3ADI A;  4DR3 E;  2NUG A;  1Z1B A;  2YTI A;  4X9J A;  4DR4 E;  4BBY A;  4ZYD A;  1RMD A;  4F9B B;  1X47 A;  4DV5 E;  2FGG A;  2L8T A;  3JTZ A;  1YPN A;  2EOI A;  2EPP A;  2L3C A;  2LUP B;  1IBK E;  1KJK A;  1PJS A;  5IV8 B;  2EMF A;  4B3S E;  3LML A;  3IWD A;  2EOY A;  3LLH A;  2JOB A;  5FLX C;  2I9I A;  2B7V A;  1X48 A;  2JR1 A;  3KZZ A;  5KL6 A;  5IT9 C;  1MGT A;  2I13 A;  2CSH A;  4DR1 E;  2EOQ A;  2EN1 A;  4ZYG A;  4JI0 E;  2L6M A;  2V83 A;  4MLQ A;  3VYY A;  4P7D A;  2K4V A;  2VE7 C;  1IQS A;  2BB8 A;  3QG5 C;  4Q35 B;  1AAY A;  2N8X A;  2EP3 A;  2EOF A;  2EOJ A;  5IXM B;  2EML A;  2MC5 A;  2EL6 A;  4X8W A;  2UUC E;  4OOG C;  1N36 E;  4BCA A;  2LJU A;  1NCS A;  2B9D A;  2VF1 A;  2E72 A;  1YUJ A;  2EN2 A;  2MDR A;  2YU5 A;  5A6B D;  1XMQ E;  1EH8 A;  1A1G A;  4LTY A;  2M1S A;  1N32 E;  1ZBT A;  2N3G A;  3M99 B;  1JK2 A;  4DR7 E;  1IBL E;  5A6B A;  4O5G A;  4F2J C;  4ZYE A;  2V85 A;  2GPI A;  3ADL A;  5AAS A;  4JI8 E;  4WFT A;  4O43 A;  1ZBQ A;  2G7H A;  1KYQ A;  3VHT B;  4B3M E;  4NZV A;  4JI1 E;  1PKP A;  2YTE A;  1HNW E;  2RS7 A;  3ZOQ B;  3OML A;  5KL2 A;  1A1J A;  4LF8 E;  2YTD A;  4Q28 A;  5LL6 R;  4DUZ E;  2RS6 A;  1ZAA C;  5KL3 A;  1JK1 A;  4KHP E;  1MEY C;  2EMZ A;  3THN A;  2DRP A;  2ZM6 E;  2LV2 A;  4JYA E;  2EM9 A;  3J81 C;  4WSG A;  3JAM C;  5AE1 A;  1X49 A;  1AH5 A;  3DF6 A;  4R2Q A;  2EOE A;  1PDA A;  2EPA A;  5AC4 A;  2EMY A;  4LFC E;  2NA2 A;  4K0K E;  4I8O A;  2EM6 A;  1TN9 A;  2EWL A;  4M9V C;  1UBD C;  4JI5 E;  4JI2 E;  1I94 E;  2D9H A;  2R1F A;  2YRH A;  1F2I G;  2LO3 A;  2LTR A;  2WBT A;  3C6K A;  4DV1 E;  2M4I A;  2EPN A;  4F54 A;  4WXC A;  2N3H A;  2VQF E;  2PRT A;  2HJJ A;  2EMG A;  4LF9 E;  2L92 A;  4DR2 E;  4L8N A;  1O0W A;  2UU9 E;  2YU8 A;  1IBM E;  5AE3 A;  1ZU1 A;  2EM7 A;  4DV7 E;  2LT7 A;  3HPS A;  4LU9 A;  4R2R A;  2LCE A;  5F3W A;  2CT1 A;  2EQ0 A;  1T4L B;  1FKA E;  1QU6 A;  3KWR A;  2HHH E;  2EOM A;  1T39 A;  5LMN E;  1XNR E;  4NXN E;  4BS9 A;  2JXP A;  1PJQ A;  4AQY E;  4R2P A;  2YT4 A;  4L5N C;  4DV0 E;  2F8B A;  2NAB A;  2YTP A;  4DV6 E;  2LBS B;  2MC6 A;  2EM4 A;  2YTN A;  3HPZ A;  4JI4 E;  4DV2 E;  1UIL A;  4P78 A;  2EM8 A;  4GZN C;  2UUA E;  2EPR A;  2R76 A;  4FK5 C;  3FIG A;  3T1H E;  2EQ3 A;  2L2N A;  4BC7 A;  2JWO A;  1T4O A;  4RHB B;  3VYX A;  4WPY A;  4LFB E;  2L3J A;  2ODR D;  4NHR A;  4GEQ B;  2EMI A;  2HC5 A;  3MSW A;  4IJD A;  3EPK A;  1BBO A;  2GLI A;  1N3G A;  4LF4 E;  2RQL A;  1X5W A;  5BR8 E;  4RH8 A;  2EOZ A;  2YTQ A;  1J5E E;  4N4R B;  2EPM X;  2EN4 A;  2V88 A;  1IQO A;  2DLK A;  2MKD A;  1WHQ A;  2EPK X;  5LLQ A;  4M0V A;  2EM0 A;  2UXC E;  2EMC A;  4F6M A;  4R2C A;  3ADG A;  2B3T B;  4IS1 C;  4NXM E;  4GKK E;  4BC9 A;  1BBG A;  3EPJ A;  1G2D C;  3KZY A;  1TF3 A;  4JI6 E;  1RQ0 A;  3HXL A;  2V89 A;  1A1F A;  2EOX A;  5A6A A;  2EM3 A;  3IWB A;  1UHZ A;  2V8Q B;  3OTO E;  4YHH E;  4DV4 E;  2ENA A;  1PJT A;  2DSY A;  1YSA C;  4KZS A;  2LE2 A;  2VRD A;  5DNY A;  4J8Z A;  1HNX E;  1N33 E;  2UXB E;  3EPH A;  2FV4 B;  3MHH C;  2KOU A;  5AE2 A;  3H09 A;  4O4K A;  3C4T A;  2JVA A;  4LF6 E;  2YSP A;  2YSO A;  5LMU E;  4R2S A;  2EZ6 A;  2YTO A;  3J7Y p;  1HR0 E;  2EMK A;  1X6E A;  2EMB A;  3P1X A;  4YY3 E;  4R8O A;  1WJP A;  3MHS C;  2YRK A;  2Q8U A;  1B69 A;  2HGH A;  1TF6 A;  2EQ1 A;  4BMJ A;  3J80 C;  3BID A;  1DI2 A;  2EM5 A;  5ADZ A;  4WXD A;  2WBS A;  2EPL X;  1X6H A;  2L33 A;  2EMH A;  4LF5 E;  2V86 A;  3AUZ A;  3C6M A;  2BBG A;  2RSM A;  1YYW A;  1YUI A;  2RPC A;  2UXD E;  3BF2 A;  5KL7 A;  4KWY A;  4M30 A;  1SR9 A;  1XMO E;  2JP9 A;  1RC7 A;  1A1H A;  4R03 A;  1QNT A;  2WZO A;  2ODR C;  3DJW A;  5A6K A;  2M7Q A;  2RSI A;  2EN6 A;  2EOR A;  3K6Q A;  4DUY E;  2L2K B;  1STU A;  3C4B A;  2DGC A;  2EN8 A;  5T6J A;  2E1M A;  2EMA A;  3IWC A;  4BHC A;  3HQ1 A;  1GQE A;  4X66 E;  2ENC A;  2EJ4 A;  4BHB A;  1L4S A;  2EOS A;  2LTS A;  2EM2 A;  1T4N A;  3TQM A;  2F4V E;  1G2F C;  1P47 A;  1A1I A;  2K7I A;  2H36 X;  4M2Z A;  4F9A B;  1YYK A;  4HEI A; 
#chains in the Genus database with same CATH homology
 1FJG E;  3ADJ A;  3JAM C;  4DR5 E;  2V88 A;  5AE1 A;  1X49 A;  2V87 A;  3AV0 A;  3VK6 A;  4DV3 E;  2NUE A;  3ADI A;  1WHQ A;  3DF6 A;  2YZT A;  4M0V A;  4DR3 E;  3F6G A;  2UXC E;  2UUB E;  2NUG A;  2FTX B;  3ADG A;  2B3T B;  4X64 E;  4NXM E;  4GKK E;  4BC9 A;  1HNZ E;  4JI6 E;  4LFC E;  4DR4 E;  4BBY A;  1RQ0 A;  3HXL A;  4OX9 E;  1XNQ E;  2NA2 A;  4K0K E;  2V89 A;  2DB2 A;  4I8O A;  1YZ9 A;  2EWL A;  2E5L E;  4F9B B;  2LRS A;  4JI5 E;  3IWB A;  4JI2 E;  1I94 E;  1N34 E;  4TUG A;  1UHZ A;  1X47 A;  2V8Q B;  2FGG A;  2L8T A;  4YHH E;  3JTZ A;  3OTO E;  4DV4 E;  4DV5 E;  2DSY A;  2L3C A;  4KZS A;  2LE2 A;  2LUP B;  2LTR A;  1IBK E;  4DV1 E;  2M4I A;  4F54 A;  5DNY A;  4J8Z A;  1HNX E;  1N33 E;  4B3S E;  2UXB E;  4DKK A;  3LML A;  3IWD A;  2N3H A;  2VQF E;  2FV4 B;  3LLH A;  2JOB A;  2KOU A;  5FLX C;  4LF9 E;  2L92 A;  5AE2 A;  3H09 A;  4DR2 E;  2B7V A;  1X48 A;  2JR1 A;  3C4T A;  5IT9 C;  4L8N A;  2JVA A;  4WYQ B;  1O0W A;  2KON A;  4DR1 E;  4JI0 E;  3JU0 A;  2UU9 E;  4LF6 E;  5LMU E;  2L6M A;  5AE3 A;  1IBM E;  2V83 A;  2EZ6 A;  3VYY A;  3J7Y p;  4P7D A;  2K4V A;  2LJH A;  4DV7 E;  2VE7 C;  5CFF E;  1HR0 E;  3P1X A;  4YY3 E;  3HPS A;  4LU9 A;  5IWA E;  4R8O A;  2KHX A;  5F3W A;  4B3R E;  4GKJ E;  1T4L B;  1FKA E;  1QU6 A;  1J26 A;  2MC5 A;  3KWR A;  4BMJ A;  3J80 C;  2HHH E;  2DIX A;  4X8W A;  1DI2 A;  5LMN E;  2UUC E;  4OOG C;  1XNR E;  2JOX A;  4NXN E;  1N36 E;  5ADZ A;  4BCA A;  4BS9 A;  1N32 E;  4LF7 E;  4X62 E;  2B9D A;  2VF1 A;  4AQY E;  2L33 A;  4LF5 E;  2DMY A;  2YT4 A;  2V86 A;  3AUZ A;  4L5N C;  4DV0 E;  2F8B A;  2RSM A;  1YYW A;  2MDR A;  1WXR A;  1XMQ E;  4DMI A;  4DV6 E;  2LBS B;  2MC6 A;  2UXD E;  4M30 A;  1SR9 A;  1XMO E;  1EKZ A;  4LTY A;  1RC7 A;  3T1Y E;  4LFA E;  2M1S A;  3HPZ A;  2JY9 A;  1ZBT A;  2N3G A;  4DV2 E;  4R03 A;  2WZO A;  4JI4 E;  2ODR C;  3DJW A;  1UIL A;  4P78 A;  4TUI A;  2UUA E;  2M7Q A;  4DR7 E;  1IBL E;  4JI3 E;  3FIG A;  3K6Q A;  4BC7 A;  2L2N A;  2V85 A;  5A2Q C;  4DUY E;  2JWO A;  2IHR 1;  3T1H E;  5AAS A;  1T4O A;  4JI8 E;  1GZ6 A;  1STU A;  3C4B A;  2L2K B;  3ADL A;  4WFT A;  5T6J A;  2NUF A;  1ZBQ A;  2E1M A;  2G7H A;  2B7T A;  2LMZ A;  3F6H A;  4WPY A;  4F9C B;  3VYX A;  4B3M E;  2LUQ A;  3IWC A;  3HQ1 A;  4JI1 E;  1PKP A;  4JI7 E;  4LFB E;  1GQE A;  1HNW E;  2RS7 A;  3ZOQ B;  4X66 E;  3J7A G;  2L3J A;  3OML A;  2ODR D;  2VQE E;  3HTX A;  4GEQ B;  4LF8 E;  4Q28 A;  5LL6 R;  3MSW A;  4DUZ E;  2LTS A;  2RS6 A;  4B3T E;  3RMP A;  4JV5 E;  1T4N A;  4LF4 E;  2F4V E;  4WSP A;  4X65 E;  4KHP E;  2CPN A;  2H36 X;  1YYO A;  1WHN A;  4DR6 E;  5BR8 E;  2ZM6 E;  1DQ3 A;  4F9A B;  4M2Z A;  2RTX A;  1YYK A;  4JYA E;  3J81 C;  2L2M A;  1J5E E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...