4P7DA

Antitoxin hicb3 crystal structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDPAKYESKAVKFNLTMSQNLLTAIDKFIATNRGYKNRSQFLAELAREKIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antitoxin HicB3
publication title Functional and Structural Analysis of HicA3-HicB3, a Novel Toxin-Antitoxin System of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
total genus 30
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.250 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4p7dA01
2DSYA 4P78A 3KWRA 2YZTA 4P7DA
chains in the Genus database with same CATH superfamily
2DSYA 5A6KA 2EM6A 1GTKA 3OTOE 4JI1E 4JI5E 2EWLA 1N3GA 2J7JA 2EPLX 5IXMB 2LTSA 4NXME 3EPLA 3KWRA 4LTYA 4X66E 4R2AA 2YTEA 2FTXB 2LUPB 4JI8E 4GKKE 4M0VA 1F2IG 3ADIA 3JAMC 2EOOA 2YT4A 2LRSA 1N36E 1MGTA 4F9AB 5AC5A 4FK5C 2DLQA 2ELYA 4DR1E 2RSIA 2EPXA 2UU9E 2GLIA 4R03A 2LTRA 5LLQA 2EPAA 5IWAE 3EQ1A 4LF5E 3MHSC 2YTOA 2DIXA 2EPNA 2CSHA 2YTPA 4BBYA 2YTIA 4JI3E 2L8TA 2EOEA 3K6QA 3L00A 4ZYHA 2M7QA 5A2QC 1LLMC 2WBUA 3M99B 2EE8A 2M1SA 4YHHE 1HNXE 2M4IA 2EL5A 4R2SA 1N32E 1L4SA 3RMPA 2V83A 2YTDA 4JI7E 1X6FA 2EMHA 4N4RB 2EN8A 2ZM6E 2EN3A 4BMJA 1TN9A 1QNTA 1XMQE 3H09A 3J7Yp 4R2PA 2MDGA 2EQ1A 4X8WA 2DMIA 1YFHA 1FJGE 2B7VA 2EMIA 3VHTB 1DGCA 2EM3A 2M9AA 2EM2A 5CFFE 4DV3E 5IT9C 1XNRE 2UXBE 4DR4E 1IBLE 4AQYE 4M9VC 2RS6A 2V8QB 2EL4A 2LVHA 2CPNA 2YZTA 1I94E 2F8BA 1X47A 3MSWA 4R8OA 4RHBB 2DB2A 2YTGA 5AC4A 4TUGA 4DV7E 3ADGA 2FGGA 3VYYA 3EPHA 2YRKA 3HQ1A 2NA2A 1JK1A 1KJKA 1X6EA 4Q28A 5DNYA 2LJUA 2YPNA 3BF2A 4O5GA 1JK2A 1N34E 2EM9A 1DQ3A 4JI4E 1YSAC 2ADRA 4R2RA 1AAYA 2EOJA 1EH7A 4K0KE 4DR2E 4L5NC 1P47A 2E5LE 1BBOA 1FKAE 2EOZA 2NUGA 5KL3A 2ENHA 2FV4B 3J81C 3EPKA 4YY3E 2L2KB 3C4BA 2EP3A 3EPJA 1G2FC 2D9HA 2JY9A 2YU8A 2EMBA 4F9CB 4OX9E 3JTZA 5FLXC 4LF6E 4GZNC 1A1IA 4X64E 2A25A 2EMYA 2GPIA 2N3HA 1PJSA 4BHBA 4LF8E 2EOHA 2MKNA 2EOSA 2CTDA 3KZZA 4TUIA 1SFEA 2BB8A 4DMIA 2UUCE 2EJ4A 4NXNE 2JP9A 3ADLA 2K4VA 2EN6A 4JI6E 3FIGA 2HJJA 2MDRA 2R1FA 4F6NA 2N8XA 5AE3A 4B3RE 3BIDA 1PJQA 2EMFA 1X48A 2L92A 4GEQB 1MEYC 1TF6A 3HTXA 4F6MA 3DF6A 2NABA 3J7AG 3IWDA 2UXCE 4BS9A 1A1GA 1PJTA 2EMWA 2I13A 2EPCA 4WSPA 2VF1A 2EOIA 2HC5A 2V88A 2V89A 4LFAE 4JYAE 2K7IA 5AE2A 4B3TE 2YRHA 2KOUA 4O4KA 2EPOA 5BR8E 1AH5A 2F4VE 1T4LB 1RQ0A 4DV6E 2MC6A 5KL2A 3THOB 2EMCA 4JI2E 1GZ6A 2EMZA 4BCAA 2EM4A 2L6MA 2KONA 4J8ZA 4F54A 1T39A 4B3ME 2L3CA 4BC7A 1YYWA 2NUFA 3LMLA 1SR9A 2RTXA 4ZYGA 2PRTA 4KHPE 2EPUA 2EOXA 1IQSA 4DUYE 1IBME 1YUIA 3ZOQB 4R2EA 2CT1A 1G2DC 2JR1A 4O43A 3J80C 2EMKA 3JU0A 2EM5A 2LJHA 4KZSA 1B69A 1UILA 2EMXA 1A1JA 2G7HA 3P1XA 3C6KA 2V86A 3MHHC 4F2JC 5KL7A 4DR5E 2DRPA 2EN2A 1YYOA 1T38A 1PKPA 4HEIA 2JVAA 1ZAAC 1HR0E 2KHXA 1ZBQA 2L3JA 5KL6A 2NUEA 1A1KA 2YWQA 1WRJA 2RPCA 1X3CA 2EM8A 2B3TB 2EOFA 2E72A 4GKJE 2EN7A 4X62E 2E1MA 4WX9A 2WZOA 2UUAE 2H36X 1WJPA 4IS1C 5A6BD 3KZYA 2JYAA 1EH6A 2JXPA 1QU6A 1WHQA 3HPZA 3BBGA 3TQMA 1UN6B 1T4OA 5AASA 2JOBA 4DV0E 2EMAA 3QG5C 5F3WA 2YSPA 4M2ZA 2EM7A 1J26A 1GQEA 3LLHA 1A1FA 2EPKX 3HPSA 2EOQA 4P7DA 1RMDA 5LL6R 1DI2A 1X5WA 4L8NA 4LF7E 2YRMA 3T1HE 2ENCA 5KL5A 5LMUE 1UBDC 1X6HA 4WSGA 1XMOE 2LO3A 3F6HA 3ADJA 4P78A 2L33A 5A6AA 3UK3C 1A1LA 4I8OA 2N3GA 2LV2A 2VRDA 1BB8A 5KL4A 2R76A 2JOXA 4LU9A 2MC5A 1WXRA 2Q8UA 2V85A 4JI0E 2YSOA 4F9BB 3THNA 3VK6A 4LF4E 5A6BA 1IMUA 5A69A 2YTFA 4JV5E 1YYKA 2EQ3A 1PDAA 2WBTA 2LT7A 2ENAA 4WYQB 4X9JA 4RH8A 3T1YE 2ODRD 4DR3E 2B9DA 4WXCA 4NHRA 3BGHA 2LE2A 3VYXA 2RQLA 4ZYEA 1J5EE 3IWBA 4B3SE 4DV5E 4BHCA 2YTNA 1N33E 4IJDA 4ZYDA 1XNQE 1TF3A 4MLVA 4DV1E 1X49A 1ZR9A 1WHNA 4MLQA 2UUBE 3IWCA 2BBGA 2EORA 2LCEA 2YU5A 2EM0A 4O24A 1ZBTA 2L2NA 4X65E 1RC7A 1HNWE 3C6MA 4M30A 2EQ0A 2VE7C 2UXDE 1BBGA 2WBSA 2EOMA 2B7TA 4WPYA 1EH8A 4BC9A 4DV2E 3F6GA 2L2MA 1NEIA 2EOYA 2ODRC 3ECRA 4LF9E 2EMLA 2YTQA 4DUZE 2LUQA 4WFTA 3DJWA 2I9IA 3C4TA 2EN1A 5T6JA 1ZU1A 3HXLA 2EMGA 4LFCE 4DR6E 1IBKE 5ADZA 2VQFE 1STUA 1O0WA 5LMNE 2DMYA 1A1HA 3AV0A 4DR7E 2V87A 2EZ6A 3OMLA 2IHR1 2HGHA 5TSEA 4DV4E 4DKKA 2EL6A 2EPZA 1HNZE 2RSMA 2MKDA 2RS7A 5IV8B 2HHHE 2DLKA 4R2CA 2EPMX 1YPNA 2LMZA 1Z1BA 5A6JA 1EKZA 1NCSA 4NZVA 2DGCA 1KYQA 2WCC3 1T4NA 1YUJA 2GHFA 2EPRA 4R2QA 2ELZA 2VQEE 4WXDA 2JPAA 2LBSB 1IQOA 4LFBE 1YZ9A 2JWOA 1UHZA 4OOGC 2EPPA 2YTJA 2EN4A 4R2DA 4KWYA 3AUZA 5AE1A 4Q35B 4HTGA
chains in the Genus database with same CATH topology
2LE2A 3VYYA 4B3ME 2L3CA 2DSYA 3IWBA 1J5EE 3HQ1A 4BC7A 4DV5E 2NUFA 2NA2A 4B3SE 1YYWA 4JV5E 1N33E 3OTOE 4JI1E 3LMLA 4JI5E 1XNQE 2EWLA 1SR9A 2RTXA 4Q28A 5DNYA 2LTSA 5AE1A 4NXME 4DV1E 4KHPE 1X49A 4DUYE 1WHNA 1IBME 3KWRA 4LTYA 4X66E 1N34E 3ZOQB 1DQ3A 2UUBE 4JI4E 2JR1A 3IWCA 2FTXB 3J80C 2LUPB 3JU0A 4JI8E 2LJHA 4KZSA 4GKKE 1UILA 4F54A 4K0KE 4M0VA 4DR2E 4L5NC 2E5LE 1ZBTA 2G7HA 2L2NA 3P1XA 4X65E 1RC7A 3ADIA 3JAMC 2V86A 2YT4A 1FKAE 2LRSA 1N36E 2NUGA 1HNWE 4M30A 4F9AB 2FV4B 3J81C 2VE7C 4DR5E 4YY3E 2L2KB 2UXDE 3C4BA 4DR1E 1YYOA 2JY9A 1PKPA 4F9CB 2B7TA 2UU9E 4OX9E 2JVAA 3JTZA 5FLXC 4LF6E 1HR0E 2KHXA 1ZBQA 4R03A 2L3JA 4WPYA 2NUEA 4X64E 2LTRA 4BC9A 5IWAE 4DV2E 3F6GA 2L2MA 2N3HA 4LF5E 2B3TB 3ADGA 4LF8E 4GKJE 2DIXA 4X62E 2E1MA 4BBYA 2WZOA 2ODRC 4TUIA 4LF9E 2UUAE 2H36X 4JI3E 4DMIA 2L8TA 2UUCE 3K6QA 4DUZE 4NXNE 2LUQA 4WFTA 3DJWA 2M7QA 3C4TA 5A2QC 1QU6A 1WHQA 2K4VA 5T6JA 3ADLA 3HXLA 4LFCE 2M1SA 2FGGA 3HPZA 1IBKE 4YHHE 4DR6E 5ADZA 4JI6E 1HNXE 2M4IA 2VQFE 3FIGA 1STUA 1T4OA 5AASA 1O0WA 2JOBA 4J8ZA 2MDRA 5LMNE 4DV0E 1N32E 2DMYA 5F3WA 3RMPA 2V83A 5AE3A 4DR3E 3AV0A 4M2ZA 4JI7E 2V87A 2EZ6A 4B3RE 4DR7E 1J26A 4GEQB 2L92A 1X48A 1GQEA 3LLHA 3HPSA 3OMLA 4P7DA 2IHR1 5LL6R 3HTXA 2ZM6E 1DI2A 3DF6A 4BMJA 4L8NA 4DV4E 4LF7E 4DKKA 3J7AG 3T1HE 1XMQE 3H09A 3J7Yp 1HNZE 2RSMA 3IWDA 5LMUE 2UXCE 2RS7A 2HHHE 4BS9A 1XMOE 3F6HA 2LMZA 3ADJA 4P78A 1EKZA 2L33A 4X8WA 4I8OA 1FJGE 2B7VA 4WSPA 2VF1A 2N3GA 1T4NA 2V88A 2V89A 4LFAE 2JOXA 4LU9A 2MC5A 5CFFE 1WXRA 4DV3E 2VQEE 5IT9C 4JYAE 5AE2A 2V85A 4B3TE 2LBSB 4JI0E 1XNRE 2KOUA 2UXBE 4DR4E 4TUGA 5BR8E 4AQYE 1IBLE 4LFBE 2RS6A 4F9BB 3VK6A 4LF4E 2F4VE 2V8QB 1T4LB 1RQ0A 4DV6E 2MC6A 1YZ9A 2CPNA 2JWOA 1UHZA 2YZTA 4OOGC 2F8BA 1X47A 3MSWA 4R8OA 1I94E 4JI2E 1YYKA 1GZ6A 3VYXA 2DB2A 3AUZA 4BCAA 4WYQB 3T1YE 2ODRD 2L6MA 4DV7E 2KONA 2B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSY A;  4P78 A;  3KWR A;  2YZT A;  4P7D A; 
#chains in the Genus database with same CATH topology
 2DSY A;  5A6K A;  2EM6 A;  1GTK A;  3OTO E;  4JI1 E;  4JI5 E;  2EWL A;  1N3G A;  2J7J A;  2EPL X;  5IXM B;  2LTS A;  4NXM E;  3EPL A;  3KWR A;  4LTY A;  4X66 E;  4R2A A;  2YTE A;  2FTX B;  2LUP B;  4JI8 E;  4GKK E;  4M0V A;  1F2I G;  3ADI A;  3JAM C;  2EOO A;  2YT4 A;  2LRS A;  1N36 E;  1MGT A;  4F9A B;  5AC5 A;  4FK5 C;  2DLQ A;  2ELY A;  4DR1 E;  2RSI A;  2EPX A;  2UU9 E;  2GLI A;  4R03 A;  2LTR A;  5LLQ A;  2EPA A;  5IWA E;  3EQ1 A;  4LF5 E;  3MHS C;  2YTO A;  2DIX A;  2EPN A;  2CSH A;  2YTP A;  4BBY A;  2YTI A;  4JI3 E;  2L8T A;  2EOE A;  3K6Q A;  3L00 A;  4ZYH A;  2M7Q A;  5A2Q C;  1LLM C;  2WBU A;  3M99 B;  2EE8 A;  2M1S A;  4YHH E;  1HNX E;  2M4I A;  2EL5 A;  4R2S A;  1N32 E;  1L4S A;  3RMP A;  2V83 A;  2YTD A;  4JI7 E;  1X6F A;  2EMH A;  4N4R B;  2EN8 A;  2ZM6 E;  2EN3 A;  4BMJ A;  1TN9 A;  1QNT A;  1XMQ E;  3H09 A;  3J7Y p;  4R2P A;  2MDG A;  2EQ1 A;  4X8W A;  2DMI A;  1YFH A;  1FJG E;  2B7V A;  2EMI A;  3VHT B;  1DGC A;  2EM3 A;  2M9A A;  2EM2 A;  5CFF E;  4DV3 E;  5IT9 C;  1XNR E;  2UXB E;  4DR4 E;  1IBL E;  4AQY E;  4M9V C;  2RS6 A;  2V8Q B;  2EL4 A;  2LVH A;  2CPN A;  2YZT A;  1I94 E;  2F8B A;  1X47 A;  3MSW A;  4R8O A;  4RHB B;  2DB2 A;  2YTG A;  5AC4 A;  4TUG A;  4DV7 E;  3ADG A;  2FGG A;  3VYY A;  3EPH A;  2YRK A;  3HQ1 A;  2NA2 A;  1JK1 A;  1KJK A;  1X6E A;  4Q28 A;  5DNY A;  2LJU A;  2YPN A;  3BF2 A;  4O5G A;  1JK2 A;  1N34 E;  2EM9 A;  1DQ3 A;  4JI4 E;  1YSA C;  2ADR A;  4R2R A;  1AAY A;  2EOJ A;  1EH7 A;  4K0K E;  4DR2 E;  4L5N C;  1P47 A;  2E5L E;  1BBO A;  1FKA E;  2EOZ A;  2NUG A;  5KL3 A;  2ENH A;  2FV4 B;  3J81 C;  3EPK A;  4YY3 E;  2L2K B;  3C4B A;  2EP3 A;  3EPJ A;  1G2F C;  2D9H A;  2JY9 A;  2YU8 A;  2EMB A;  4F9C B;  4OX9 E;  3JTZ A;  5FLX C;  4LF6 E;  4GZN C;  1A1I A;  4X64 E;  2A25 A;  2EMY A;  2GPI A;  2N3H A;  1PJS A;  4BHB A;  4LF8 E;  2EOH A;  2MKN A;  2EOS A;  2CTD A;  3KZZ A;  4TUI A;  1SFE A;  2BB8 A;  4DMI A;  2UUC E;  2EJ4 A;  4NXN E;  2JP9 A;  3ADL A;  2K4V A;  2EN6 A;  4JI6 E;  3FIG A;  2HJJ A;  2MDR A;  2R1F A;  4F6N A;  2N8X A;  5AE3 A;  4B3R E;  3BID A;  1PJQ A;  2EMF A;  1X48 A;  2L92 A;  4GEQ B;  1MEY C;  1TF6 A;  3HTX A;  4F6M A;  3DF6 A;  2NAB A;  3J7A G;  3IWD A;  2UXC E;  4BS9 A;  1A1G A;  1PJT A;  2EMW A;  2I13 A;  2EPC A;  4WSP A;  2VF1 A;  2EOI A;  2HC5 A;  2V88 A;  2V89 A;  4LFA E;  4JYA E;  2K7I A;  5AE2 A;  4B3T E;  2YRH A;  2KOU A;  4O4K A;  2EPO A;  5BR8 E;  1AH5 A;  2F4V E;  1T4L B;  1RQ0 A;  4DV6 E;  2MC6 A;  5KL2 A;  3THO B;  2EMC A;  4JI2 E;  1GZ6 A;  2EMZ A;  4BCA A;  2EM4 A;  2L6M A;  2KON A;  4J8Z A;  4F54 A;  1T39 A;  4B3M E;  2L3C A;  4BC7 A;  1YYW A;  2NUF A;  3LML A;  1SR9 A;  2RTX A;  4ZYG A;  2PRT A;  4KHP E;  2EPU A;  2EOX A;  1IQS A;  4DUY E;  1IBM E;  1YUI A;  3ZOQ B;  4R2E A;  2CT1 A;  1G2D C;  2JR1 A;  4O43 A;  3J80 C;  2EMK A;  3JU0 A;  2EM5 A;  2LJH A;  4KZS A;  1B69 A;  1UIL A;  2EMX A;  1A1J A;  2G7H A;  3P1X A;  3C6K A;  2V86 A;  3MHH C;  4F2J C;  5KL7 A;  4DR5 E;  2DRP A;  2EN2 A;  1YYO A;  1T38 A;  1PKP A;  4HEI A;  2JVA A;  1ZAA C;  1HR0 E;  2KHX A;  1ZBQ A;  2L3J A;  5KL6 A;  2NUE A;  1A1K A;  2YWQ A;  1WRJ A;  2RPC A;  1X3C A;  2EM8 A;  2B3T B;  2EOF A;  2E72 A;  4GKJ E;  2EN7 A;  4X62 E;  2E1M A;  4WX9 A;  2WZO A;  2UUA E;  2H36 X;  1WJP A;  4IS1 C;  5A6B D;  3KZY A;  2JYA A;  1EH6 A;  2JXP A;  1QU6 A;  1WHQ A;  3HPZ A;  3BBG A;  3TQM A;  1UN6 B;  1T4O A;  5AAS A;  2JOB A;  4DV0 E;  2EMA A;  3QG5 C;  5F3W A;  2YSP A;  4M2Z A;  2EM7 A;  1J26 A;  1GQE A;  3LLH A;  1A1F A;  2EPK X;  3HPS A;  2EOQ A;  4P7D A;  1RMD A;  5LL6 R;  1DI2 A;  1X5W A;  4L8N A;  4LF7 E;  2YRM A;  3T1H E;  2ENC A;  5KL5 A;  5LMU E;  1UBD C;  1X6H A;  4WSG A;  1XMO E;  2LO3 A;  3F6H A;  3ADJ A;  4P78 A;  2L33 A;  5A6A A;  3UK3 C;  1A1L A;  4I8O A;  2N3G A;  2LV2 A;  2VRD A;  1BB8 A;  5KL4 A;  2R76 A;  2JOX A;  4LU9 A;  2MC5 A;  1WXR A;  2Q8U A;  2V85 A;  4JI0 E;  2YSO A;  4F9B B;  3THN A;  3VK6 A;  4LF4 E;  5A6B A;  1IMU A;  5A69 A;  2YTF A;  4JV5 E;  1YYK A;  2EQ3 A;  1PDA A;  2WBT A;  2LT7 A;  2ENA A;  4WYQ B;  4X9J A;  4RH8 A;  3T1Y E;  2ODR D;  4DR3 E;  2B9D A;  4WXC A;  4NHR A;  3BGH A;  2LE2 A;  3VYX A;  2RQL A;  4ZYE A;  1J5E E;  3IWB A;  4B3S E;  4DV5 E;  4BHC A;  2YTN A;  1N33 E;  4IJD A;  4ZYD A;  1XNQ E;  1TF3 A;  4MLV A;  4DV1 E;  1X49 A;  1ZR9 A;  1WHN A;  4MLQ A;  2UUB E;  3IWC A;  2BBG A;  2EOR A;  2LCE A;  2YU5 A;  2EM0 A;  4O24 A;  1ZBT A;  2L2N A;  4X65 E;  1RC7 A;  1HNW E;  3C6M A;  4M30 A;  2EQ0 A;  2VE7 C;  2UXD E;  1BBG A;  2WBS A;  2EOM A;  2B7T A;  4WPY A;  1EH8 A;  4BC9 A;  4DV2 E;  3F6G A;  2L2M A;  1NEI A;  2EOY A;  2ODR C;  3ECR A;  4LF9 E;  2EML A;  2YTQ A;  4DUZ E;  2LUQ A;  4WFT A;  3DJW A;  2I9I A;  3C4T A;  2EN1 A;  5T6J A;  1ZU1 A;  3HXL A;  2EMG A;  4LFC E;  4DR6 E;  1IBK E;  5ADZ A;  2VQF E;  1STU A;  1O0W A;  5LMN E;  2DMY A;  1A1H A;  3AV0 A;  4DR7 E;  2V87 A;  2EZ6 A;  3OML A;  2IHR 1;  2HGH A;  5TSE A;  4DV4 E;  4DKK A;  2EL6 A;  2EPZ A;  1HNZ E;  2RSM A;  2MKD A;  2RS7 A;  5IV8 B;  2HHH E;  2DLK A;  4R2C A;  2EPM X;  1YPN A;  2LMZ A;  1Z1B A;  5A6J A;  1EKZ A;  1NCS A;  4NZV A;  2DGC A;  1KYQ A;  2WCC 3;  1T4N A;  1YUJ A;  2GHF A;  2EPR A;  4R2Q A;  2ELZ A;  2VQE E;  4WXD A;  2JPA A;  2LBS B;  1IQO A;  4LFB E;  1YZ9 A;  2JWO A;  1UHZ A;  4OOG C;  2EPP A;  2YTJ A;  2EN4 A;  4R2D A;  4KWY A;  3AUZ A;  5AE1 A;  4Q35 B;  4HTG A; 
#chains in the Genus database with same CATH homology
 2LE2 A;  3VYY A;  4B3M E;  2L3C A;  2DSY A;  3IWB A;  1J5E E;  3HQ1 A;  4BC7 A;  4DV5 E;  2NUF A;  2NA2 A;  4B3S E;  1YYW A;  4JV5 E;  1N33 E;  3OTO E;  4JI1 E;  3LML A;  4JI5 E;  1XNQ E;  2EWL A;  1SR9 A;  2RTX A;  4Q28 A;  5DNY A;  2LTS A;  5AE1 A;  4NXM E;  4DV1 E;  4KHP E;  1X49 A;  4DUY E;  1WHN A;  1IBM E;  3KWR A;  4LTY A;  4X66 E;  1N34 E;  3ZOQ B;  1DQ3 A;  2UUB E;  4JI4 E;  2JR1 A;  3IWC A;  2FTX B;  3J80 C;  2LUP B;  3JU0 A;  4JI8 E;  2LJH A;  4KZS A;  4GKK E;  1UIL A;  4F54 A;  4K0K E;  4M0V A;  4DR2 E;  4L5N C;  2E5L E;  1ZBT A;  2G7H A;  2L2N A;  3P1X A;  4X65 E;  1RC7 A;  3ADI A;  3JAM C;  2V86 A;  2YT4 A;  1FKA E;  2LRS A;  1N36 E;  2NUG A;  1HNW E;  4M30 A;  4F9A B;  2FV4 B;  3J81 C;  2VE7 C;  4DR5 E;  4YY3 E;  2L2K B;  2UXD E;  3C4B A;  4DR1 E;  1YYO A;  2JY9 A;  1PKP A;  4F9C B;  2B7T A;  2UU9 E;  4OX9 E;  2JVA A;  3JTZ A;  5FLX C;  4LF6 E;  1HR0 E;  2KHX A;  1ZBQ A;  4R03 A;  2L3J A;  4WPY A;  2NUE A;  4X64 E;  2LTR A;  4BC9 A;  5IWA E;  4DV2 E;  3F6G A;  2L2M A;  2N3H A;  4LF5 E;  2B3T B;  3ADG A;  4LF8 E;  4GKJ E;  2DIX A;  4X62 E;  2E1M A;  4BBY A;  2WZO A;  2ODR C;  4TUI A;  4LF9 E;  2UUA E;  2H36 X;  4JI3 E;  4DMI A;  2L8T A;  2UUC E;  3K6Q A;  4DUZ E;  4NXN E;  2LUQ A;  4WFT A;  3DJW A;  2M7Q A;  3C4T A;  5A2Q C;  1QU6 A;  1WHQ A;  2K4V A;  5T6J A;  3ADL A;  3HXL A;  4LFC E;  2M1S A;  2FGG A;  3HPZ A;  1IBK E;  4YHH E;  4DR6 E;  5ADZ A;  4JI6 E;  1HNX E;  2M4I A;  2VQF E;  3FIG A;  1STU A;  1T4O A;  5AAS A;  1O0W A;  2JOB A;  4J8Z A;  2MDR A;  5LMN E;  4DV0 E;  1N32 E;  2DMY A;  5F3W A;  3RMP A;  2V83 A;  5AE3 A;  4DR3 E;  3AV0 A;  4M2Z A;  4JI7 E;  2V87 A;  2EZ6 A;  4B3R E;  4DR7 E;  1J26 A;  4GEQ B;  2L92 A;  1X48 A;  1GQE A;  3LLH A;  3HPS A;  3OML A;  4P7D A;  2IHR 1;  5LL6 R;  3HTX A;  2ZM6 E;  1DI2 A;  3DF6 A;  4BMJ A;  4L8N A;  4DV4 E;  4LF7 E;  4DKK A;  3J7A G;  3T1H E;  1XMQ E;  3H09 A;  3J7Y p;  1HNZ E;  2RSM A;  3IWD A;  5LMU E;  2UXC E;  2RS7 A;  2HHH E;  4BS9 A;  1XMO E;  3F6H A;  2LMZ A;  3ADJ A;  4P78 A;  1EKZ A;  2L33 A;  4X8W A;  4I8O A;  1FJG E;  2B7V A;  4WSP A;  2VF1 A;  2N3G A;  1T4N A;  2V88 A;  2V89 A;  4LFA E;  2JOX A;  4LU9 A;  2MC5 A;  5CFF E;  1WXR A;  4DV3 E;  2VQE E;  5IT9 C;  4JYA E;  5AE2 A;  2V85 A;  4B3T E;  2LBS B;  4JI0 E;  1XNR E;  2KOU A;  2UXB E;  4DR4 E;  4TUG A;  5BR8 E;  4AQY E;  1IBL E;  4LFB E;  2RS6 A;  4F9B B;  3VK6 A;  4LF4 E;  2F4V E;  2V8Q B;  1T4L B;  1RQ0 A;  4DV6 E;  2MC6 A;  1YZ9 A;  2CPN A;  2JWO A;  1UHZ A;  2YZT A;  4OOG C;  2F8B A;  1X47 A;  3MSW A;  4R8O A;  1I94 E;  4JI2 E;  1YYK A;  1GZ6 A;  3VYX A;  2DB2 A;  3AUZ A;  4BCA A;  4WYQ B;  3T1Y E;  2ODR D;  2L6M A;  4DV7 E;  2KON A;  2B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...