5TSEA

2.35 angstrom crystal structure minor lipoprotein from acinetobacter baumannii.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
ATPLVYKKLSLELPAKTDDLETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTVTFQIEDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQISANRLPKAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords LPS-assembly lipoprotein LptE
publication title 2.35 Angstrom Crystal Structure Minor Lipoprotein from Acinetobacter baumannii.
rcsb
source organism Acinetobacter baumannii
total genus 38
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5tseA00
4N4RB 5TSEA 4NHRA 4KWYA 2JXPA 4RHBB 3BF2A 5IV8B 4Q35B 2N8XA 2R76A 4RH8A 5IXMB
chains in the Genus database with same CATH superfamily
2FGGA 1DGCA 1XNQE 4F6MA 4NZVA 4OX9E 2EM4A 2CSHA 2RSIA 2EMAA 3THNA 2WBUA 2NA2A 2V88A 2EOYA 1J26A 1T4LB 5A6JA 1X6EA 3MHSC 3DF6A 2WCC3 2EN4A 2EN6A 2UUBE 2DIXA 2K7IA 1G2DC 2EOXA 3T1HE 1EKZA 2MKNA 2LJUA 2ENCA 4YY3E 1T4NA 3J7AG 4R2DA 2EOIA 2N8XA 2R76A 4MLQA 1IQOA 2B7VA 4WPYA 4BHBA 2EP3A 4Q28A 2ODRC 1RQ0A 4B3SE 2IHR1 2BBGA 3F6HA 4O5GA 2EPCA 2EPPA 3C6KA 1X6HA 2EOHA 5AE1A 1WXRA 4ZYGA 4HEIA 3IWDA 4JI7E 2EMXA 4ZYEA 1G2FC 5ADZA 2YU8A 1N36E 3UK3C 4IJDA 4O43A 1GTKA 2YU5A 1TF6A 4DR6E 2LTRA 3J81C 1IBME 2JVAA 1ZBQA 2YSPA 4K0KE 1YYKA 3ZOQB 2YRMA 2VE7C 3HXLA 2EPXA 5FLXC 2EPZA 4BMJA 2ENAA 4WX9A 3VYXA 2WBTA 3BIDA 2YTQA 2LBSB 2JWOA 2EN1A 2L2NA 1AH5A 2GPIA 1PDAA 2EPRA 2JY9A 2M9AA 1MGTA 4LU9A 4DR4E 3KZZA 1B69A 5KL3A 4L5NC 4R03A 4B3TE 2H36X 2VRDA 3F6GA 2E5LE 4F9BB 2VQFE 1L4SA 1WHQA 4NXME 1T38A 4JI5E 2CPNA 4BHCA 1GQEA 1KYQA 1T39A 2B3TB 2N3HA 3JU0A 3EPLA 1DQ3A 1RC7A 2EPAA 2EM7A 4R2EA 1A1IA 4HTGA 4LFCE 3ADLA 2EN7A 2YRHA 1FKAE 4KHPE 4X62E 2EORA 4R8OA 2YRKA 1EH8A 3AV0A 4DR1E 1A1LA 2KOUA 3HQ1A 3C4TA 4DUZE 3EPHA 5F3WA 4KZSA 2EL4A 1YSAC 2LV2A 2MDGA 1A1GA 5A69A 2JR1A 2GHFA 5LMUE 2LCEA 5T6JA 3HPZA 4N4RB 3ADJA 2LUPB 2EPLX 2LO3A 3BBGA 5AC4A 5KL7A 1YUIA 5LLQA 4GKKE 3HTXA 1UBDC 4JYAE 2UXBE 2EMWA 1UN6B 2YPNA 4L8NA 3OMLA 1EH6A 4JV5E 4DV4E 2LE2A 4IS1C 5A6KA 1XMQE 4WYQB 3THOB 1YUJA 5LMNE 2LTSA 3J80C 3LMLA 4BBYA 3VYYA 1RMDA 2CT1A 4ZYDA 2EQ3A 4WFTA 4JI3E 2EPMX 1HNWE 5AE3A 1ZU1A 3IWCA 5A6BD 1T4OA 2GLIA 4DKKA 1ZAAC 1PJQA 4LF6E 2LVHA 4R2CA 4R2AA 2EOZA 2L3JA 2RPCA 2EMKA 3EPJA 4M9VC 2LRSA 4NXNE 1EH7A 4GKJE 2EN2A 2I9IA 4DMIA 2DMYA 4BCAA 2ADRA 2FTXB 4JI6E 5A2QC 2LMZA 2BB8A 3KZYA 2EQ0A 2MKDA 4LF5E 3HPSA 1YYOA 4R2SA 2EE8A 1QU6A 1X3CA 2E72A 2EOJA 2WZOA 2ELZA 4B3RE 4X65E 4R2PA 4X64E 1J5EE 4WSPA 3IWBA 1TN9A 4GEQB 4P7DA 2EPKX 4WSGA 5BR8E 4JI1E 1O0WA 2EM2A 4R2QA 2UUAE 2DRPA 3ADIA 1N32E 2YTGA 1A1FA 1YYWA 2YTFA 2EQ1A 3ECRA 3VK6A 5AC5A 2M4IA 4ZYHA 2YTDA 3T1YE 1X5WA 2NUGA 4DV2E 2L92A 2JP9A 2LUQA 5AE2A 3DJWA 3MSWA 3EPKA 4BC9A 2B9DA 1NEIA 1QNTA 3K6QA 2YT4A 3LLHA 1F2IG 2WBSA 1X48A 2L2KB 4NHRA 4X66E 4BS9A 2EPUA 2D9HA 2DB2A 4F9AB 2EMFA 2UXCE 1JK2A 1WRJA 2ZM6E 2M1SA 2DMIA 2JPAA 2EL6A 4P78A 2YSOA 2RTXA 4RHBB 4TUIA 4X9JA 1Z1BA 2UUCE 4B3ME 4GZNC 2RQLA 1PJTA 2F8BA 4WXDA 1HNZE 4LFAE 3H09A 4Q35B 2JYAA 2YTIA 1X6FA 2FV4B 2J7JA 1IMUA 4FK5C 1IQSA 2JXPA 5IWAE 1LLMC 4M2ZA 3RMPA 2PRTA 1XMOE 2EOMA 2R1FA 2YWQA 4YHHE 3L00A 2EMLA 4X8WA 4DV3E 4R2RA 2EPOA 2EN3A 2RSMA 2B7TA 2DGCA 2LT7A 3TQMA 1HR0E 4DV0E 4BC7A 3VHTB 5A6AA 4I8OA 3C4BA 1X47A 5IXMB 2JOXA 2EMGA 3EQ1A 3BGHA 4DUYE 4DR3E 5LL6R 1KJKA 2LJHA 4M0VA 4RH8A 2EZ6A 2YTOA 4DV1E 4O24A 2A25A 1IBKE 2YTJA 1JK1A 2L2MA 5IT9C 2MDRA 1NCSA 1P47A 5A6BA 4F6NA 1HNXE 2I13A 1BBGA 4LTYA 3P1XA 2Q8UA 2EMCA 2EL5A 2EMZA 5KL6A 1TF3A 3KWRA 1UILA 2EMHA 3ADGA 2M7QA 4JI8E 1UHZA 5KL4A 2EM9A 1N3GA 5IV8B 1BB8A 2RS6A 2EM8A 2RS7A 1XNRE 4F2JC 2EMIA 2EN8A 1N33E 2EJ4A 1GZ6A 1X49A 4M30A 3JAMC 1DI2A 4KWYA 2EM0A 4MLVA 5DNYA 2DLQA 2ODRD 3FIGA 1PKPA 2EM6A 2NUFA 2MC6A 2ELYA 2ENHA 4TUGA 2YZTA 2EWLA 2EOQA 2V86A 2HHHE 4LF7E 1AAYA 2CTDA 2YTPA 4LF4E 4DV5E 4J8ZA 4F9CB 2NABA 2G7HA 1ZR9A 1IBLE 2EM5A 2N3GA 4JI4E 2EOEA 2F4VE 2KONA 2MC5A 4WXCA 2V85A 2V87A 3JTZA 4AQYE 2V83A 4OOGC 2EPNA 4DV7E 5CFFE 1YFHA 1A1HA 2UXDE 2L6MA 3C6MA 2DLKA 2YTNA 3BF2A 4DR2E 2JOBA 1A1JA 1SFEA 5AASA 1A1KA 1YPNA 3J7Yp 2K4VA 1N34E 2EM3A 1ZBTA 2DSYA 2EMYA 2L8TA 4F54A 1PJSA 2EOSA 2L33A 3AUZA 5TSEA 2YTEA 4DV6E 2NUEA 2VF1A 4O4KA 2L3CA 1SR9A 4DR7E 2HJJA 1I94E 2KHXA 1FJGE 2V8QB 4LF9E 2EOFA 2HC5A 1MEYC 2VQEE 5KL2A 1STUA 1BBOA 2EMBA 4JI0E 3M99B 2E1MA 2EOOA 3OTOE 4LF8E 4DR5E 2UU9E 4JI2E 1WHNA 5KL5A 2HGHA 3QG5C 2V89A 1WJPA 4LFBE 3MHHC 1YZ9A
chains in the Genus database with same CATH topology
4N4RB 5TSEA 4NHRA 4KWYA 2JXPA 4RHBB 3BF2A 5IV8B 4Q35B 2N8XA 2R76A 4RH8A 5IXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4R B;  5TSE A;  4NHR A;  4KWY A;  2JXP A;  4RHB B;  3BF2 A;  5IV8 B;  4Q35 B;  2N8X A;  2R76 A;  4RH8 A;  5IXM B; 
#chains in the Genus database with same CATH topology
 2FGG A;  1DGC A;  1XNQ E;  4F6M A;  4NZV A;  4OX9 E;  2EM4 A;  2CSH A;  2RSI A;  2EMA A;  3THN A;  2WBU A;  2NA2 A;  2V88 A;  2EOY A;  1J26 A;  1T4L B;  5A6J A;  1X6E A;  3MHS C;  3DF6 A;  2WCC 3;  2EN4 A;  2EN6 A;  2UUB E;  2DIX A;  2K7I A;  1G2D C;  2EOX A;  3T1H E;  1EKZ A;  2MKN A;  2LJU A;  2ENC A;  4YY3 E;  1T4N A;  3J7A G;  4R2D A;  2EOI A;  2N8X A;  2R76 A;  4MLQ A;  1IQO A;  2B7V A;  4WPY A;  4BHB A;  2EP3 A;  4Q28 A;  2ODR C;  1RQ0 A;  4B3S E;  2IHR 1;  2BBG A;  3F6H A;  4O5G A;  2EPC A;  2EPP A;  3C6K A;  1X6H A;  2EOH A;  5AE1 A;  1WXR A;  4ZYG A;  4HEI A;  3IWD A;  4JI7 E;  2EMX A;  4ZYE A;  1G2F C;  5ADZ A;  2YU8 A;  1N36 E;  3UK3 C;  4IJD A;  4O43 A;  1GTK A;  2YU5 A;  1TF6 A;  4DR6 E;  2LTR A;  3J81 C;  1IBM E;  2JVA A;  1ZBQ A;  2YSP A;  4K0K E;  1YYK A;  3ZOQ B;  2YRM A;  2VE7 C;  3HXL A;  2EPX A;  5FLX C;  2EPZ A;  4BMJ A;  2ENA A;  4WX9 A;  3VYX A;  2WBT A;  3BID A;  2YTQ A;  2LBS B;  2JWO A;  2EN1 A;  2L2N A;  1AH5 A;  2GPI A;  1PDA A;  2EPR A;  2JY9 A;  2M9A A;  1MGT A;  4LU9 A;  4DR4 E;  3KZZ A;  1B69 A;  5KL3 A;  4L5N C;  4R03 A;  4B3T E;  2H36 X;  2VRD A;  3F6G A;  2E5L E;  4F9B B;  2VQF E;  1L4S A;  1WHQ A;  4NXM E;  1T38 A;  4JI5 E;  2CPN A;  4BHC A;  1GQE A;  1KYQ A;  1T39 A;  2B3T B;  2N3H A;  3JU0 A;  3EPL A;  1DQ3 A;  1RC7 A;  2EPA A;  2EM7 A;  4R2E A;  1A1I A;  4HTG A;  4LFC E;  3ADL A;  2EN7 A;  2YRH A;  1FKA E;  4KHP E;  4X62 E;  2EOR A;  4R8O A;  2YRK A;  1EH8 A;  3AV0 A;  4DR1 E;  1A1L A;  2KOU A;  3HQ1 A;  3C4T A;  4DUZ E;  3EPH A;  5F3W A;  4KZS A;  2EL4 A;  1YSA C;  2LV2 A;  2MDG A;  1A1G A;  5A69 A;  2JR1 A;  2GHF A;  5LMU E;  2LCE A;  5T6J A;  3HPZ A;  4N4R B;  3ADJ A;  2LUP B;  2EPL X;  2LO3 A;  3BBG A;  5AC4 A;  5KL7 A;  1YUI A;  5LLQ A;  4GKK E;  3HTX A;  1UBD C;  4JYA E;  2UXB E;  2EMW A;  1UN6 B;  2YPN A;  4L8N A;  3OML A;  1EH6 A;  4JV5 E;  4DV4 E;  2LE2 A;  4IS1 C;  5A6K A;  1XMQ E;  4WYQ B;  3THO B;  1YUJ A;  5LMN E;  2LTS A;  3J80 C;  3LML A;  4BBY A;  3VYY A;  1RMD A;  2CT1 A;  4ZYD A;  2EQ3 A;  4WFT A;  4JI3 E;  2EPM X;  1HNW E;  5AE3 A;  1ZU1 A;  3IWC A;  5A6B D;  1T4O A;  2GLI A;  4DKK A;  1ZAA C;  1PJQ A;  4LF6 E;  2LVH A;  4R2C A;  4R2A A;  2EOZ A;  2L3J A;  2RPC A;  2EMK A;  3EPJ A;  4M9V C;  2LRS A;  4NXN E;  1EH7 A;  4GKJ E;  2EN2 A;  2I9I A;  4DMI A;  2DMY A;  4BCA A;  2ADR A;  2FTX B;  4JI6 E;  5A2Q C;  2LMZ A;  2BB8 A;  3KZY A;  2EQ0 A;  2MKD A;  4LF5 E;  3HPS A;  1YYO A;  4R2S A;  2EE8 A;  1QU6 A;  1X3C A;  2E72 A;  2EOJ A;  2WZO A;  2ELZ A;  4B3R E;  4X65 E;  4R2P A;  4X64 E;  1J5E E;  4WSP A;  3IWB A;  1TN9 A;  4GEQ B;  4P7D A;  2EPK X;  4WSG A;  5BR8 E;  4JI1 E;  1O0W A;  2EM2 A;  4R2Q A;  2UUA E;  2DRP A;  3ADI A;  1N32 E;  2YTG A;  1A1F A;  1YYW A;  2YTF A;  2EQ1 A;  3ECR A;  3VK6 A;  5AC5 A;  2M4I A;  4ZYH A;  2YTD A;  3T1Y E;  1X5W A;  2NUG A;  4DV2 E;  2L92 A;  2JP9 A;  2LUQ A;  5AE2 A;  3DJW A;  3MSW A;  3EPK A;  4BC9 A;  2B9D A;  1NEI A;  1QNT A;  3K6Q A;  2YT4 A;  3LLH A;  1F2I G;  2WBS A;  1X48 A;  2L2K B;  4NHR A;  4X66 E;  4BS9 A;  2EPU A;  2D9H A;  2DB2 A;  4F9A B;  2EMF A;  2UXC E;  1JK2 A;  1WRJ A;  2ZM6 E;  2M1S A;  2DMI A;  2JPA A;  2EL6 A;  4P78 A;  2YSO A;  2RTX A;  4RHB B;  4TUI A;  4X9J A;  1Z1B A;  2UUC E;  4B3M E;  4GZN C;  2RQL A;  1PJT A;  2F8B A;  4WXD A;  1HNZ E;  4LFA E;  3H09 A;  4Q35 B;  2JYA A;  2YTI A;  1X6F A;  2FV4 B;  2J7J A;  1IMU A;  4FK5 C;  1IQS A;  2JXP A;  5IWA E;  1LLM C;  4M2Z A;  3RMP A;  2PRT A;  1XMO E;  2EOM A;  2R1F A;  2YWQ A;  4YHH E;  3L00 A;  2EML A;  4X8W A;  4DV3 E;  4R2R A;  2EPO A;  2EN3 A;  2RSM A;  2B7T A;  2DGC A;  2LT7 A;  3TQM A;  1HR0 E;  4DV0 E;  4BC7 A;  3VHT B;  5A6A A;  4I8O A;  3C4B A;  1X47 A;  5IXM B;  2JOX A;  2EMG A;  3EQ1 A;  3BGH A;  4DUY E;  4DR3 E;  5LL6 R;  1KJK A;  2LJH A;  4M0V A;  4RH8 A;  2EZ6 A;  2YTO A;  4DV1 E;  4O24 A;  2A25 A;  1IBK E;  2YTJ A;  1JK1 A;  2L2M A;  5IT9 C;  2MDR A;  1NCS A;  1P47 A;  5A6B A;  4F6N A;  1HNX E;  2I13 A;  1BBG A;  4LTY A;  3P1X A;  2Q8U A;  2EMC A;  2EL5 A;  2EMZ A;  5KL6 A;  1TF3 A;  3KWR A;  1UIL A;  2EMH A;  3ADG A;  2M7Q A;  4JI8 E;  1UHZ A;  5KL4 A;  2EM9 A;  1N3G A;  5IV8 B;  1BB8 A;  2RS6 A;  2EM8 A;  2RS7 A;  1XNR E;  4F2J C;  2EMI A;  2EN8 A;  1N33 E;  2EJ4 A;  1GZ6 A;  1X49 A;  4M30 A;  3JAM C;  1DI2 A;  4KWY A;  2EM0 A;  4MLV A;  5DNY A;  2DLQ A;  2ODR D;  3FIG A;  1PKP A;  2EM6 A;  2NUF A;  2MC6 A;  2ELY A;  2ENH A;  4TUG A;  2YZT A;  2EWL A;  2EOQ A;  2V86 A;  2HHH E;  4LF7 E;  1AAY A;  2CTD A;  2YTP A;  4LF4 E;  4DV5 E;  4J8Z A;  4F9C B;  2NAB A;  2G7H A;  1ZR9 A;  1IBL E;  2EM5 A;  2N3G A;  4JI4 E;  2EOE A;  2F4V E;  2KON A;  2MC5 A;  4WXC A;  2V85 A;  2V87 A;  3JTZ A;  4AQY E;  2V83 A;  4OOG C;  2EPN A;  4DV7 E;  5CFF E;  1YFH A;  1A1H A;  2UXD E;  2L6M A;  3C6M A;  2DLK A;  2YTN A;  3BF2 A;  4DR2 E;  2JOB A;  1A1J A;  1SFE A;  5AAS A;  1A1K A;  1YPN A;  3J7Y p;  2K4V A;  1N34 E;  2EM3 A;  1ZBT A;  2DSY A;  2EMY A;  2L8T A;  4F54 A;  1PJS A;  2EOS A;  2L33 A;  3AUZ A;  5TSE A;  2YTE A;  4DV6 E;  2NUE A;  2VF1 A;  4O4K A;  2L3C A;  1SR9 A;  4DR7 E;  2HJJ A;  1I94 E;  2KHX A;  1FJG E;  2V8Q B;  4LF9 E;  2EOF A;  2HC5 A;  1MEY C;  2VQE E;  5KL2 A;  1STU A;  1BBO A;  2EMB A;  4JI0 E;  3M99 B;  2E1M A;  2EOO A;  3OTO E;  4LF8 E;  4DR5 E;  2UU9 E;  4JI2 E;  1WHN A;  5KL5 A;  2HGH A;  3QG5 C;  2V89 A;  1WJP A;  4LFB E;  3MHH C;  1YZ9 A; 
#chains in the Genus database with same CATH homology
 4N4R B;  5TSE A;  4NHR A;  4KWY A;  2JXP A;  4RHB B;  3BF2 A;  5IV8 B;  4Q35 B;  2N8X A;  2R76 A;  4RH8 A;  5IXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...