5TSEA

2.35 angstrom crystal structure minor lipoprotein from acinetobacter baumannii.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
ATPLVYKKLSLELPAKTDDLETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTVTFQIEDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQISANRLPKAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title 2.35 Angstrom Crystal Structure Minor Lipoprotein from Acinetobacter baumannii.
rcsb
source organism Acinetobacter baumannii
molecule tags Lipid binding protein
total genus 38
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5tseA00
5IV8B 4KWYA 2JXPA 3BF2A 4NHRA 4RH8A 4RHBB 5IXMB 2R76A 4N4RB 5TSEA 2N8XA 4Q35B
chains in the Genus database with same CATH superfamily
2A25A 2DB2A 4F54A 2EPKX 5A6BA 2LO3A 3TQMA 1I94E 2NABA 2EP3A 3JAMC 4R2CA 4F6NA 2M9AA 1J5EE 4BC7A 2EN4A 4NXNE 4JI3E 2EMIA 1A1KA 3EQ1A 2B7VA 1O0WA 2I13A 2YRKA 4DV0E 2YTIA 2ELYA 1J26A 2MC6A 1A1JA 4DV1E 4O5GA 4F9CB 4M9VC 2EOJA 3C6KA 1RQ0A 2YTFA 2EM6A 2L2MA 1T4NA 1GQEA 2VQFE 1TF6A 1WHNA 2EM9A 2EMKA 1N36E 1X49A 2EM7A 4BHBA 2EZ6A 4KHPE 2L3CA 1X47A 3RMPA 2EOYA 2EPLX 2N3GA 1T4OA 1HNZE 4DR7E 5CFFE 4DR5E 2GPIA 2RS6A 3HXLA 1TN9A 2DMYA 2KOUA 2L33A 4R2QA 2JWOA 5IXMB 2JPAA 1XNQE 2WZOA 4L5NC 2WBUA 1FJGE 2RSIA 3L00A 2RSMA 2M1SA 1ZR9A 2HC5A 4JYAE 3THOB 2E5LE 4DV4E 2ENCA 3T1HE 3C6MA 3T1YE 1N32E 3VYYA 5A69A 1T38A 1PJTA 4LF4E 2V86A 2YTJA 3DF6A 5TSEA 2EMXA 1A1IA 2M7QA 4FK5C 4DR1E 2YTDA 1WHQA 5A6BD 4WPYA 2F4VE 3IWDA 4K0KE 3ADIA 4O43A 4X64E 4OX9E 2PRTA 2EE8A 4R2RA 2LV2A 3JU0A 1AAYA 2NA2A 3HQ1A 4DV3E 4B3SE 2EOOA 5A6JA 4DR6E 5KL5A 4RHBB 4TUIA 2JR1A 2YRHA 2LRSA 3J80C 4LFCE 3OMLA 3JTZA 4LF8E 2MKDA 1YPNA 1DQ3A 5AE1A 4DV5E 1F2IG 3HPSA 5AC4A 5IV8B 3EPLA 2EMYA 4JI0E 2EM5A 3M99B 5DNYA 5IT9C 1EH6A 4R2AA 2LJHA 1STUA 4IJDA 1YYOA 2JXPA 4HEIA 5A6KA 2EQ0A 4O24A 1ZBQA 1YZ9A 1WXRA 3K6QA 1X6FA 1BBGA 1T4LB 4MLVA 4WSGA 2YTOA 2DLKA 2L6MA 1A1HA 2FGGA 2LTRA 3KZZA 2EPOA 2Q8UA 2YTPA 2EOEA 4BHCA 4F6MA 4JI2E 2BB8A 4NZVA 4B3TE 1UILA 1G2FC 1IQSA 2MC5A 1EH7A 5ADZA 2GHFA 3J7AG 4LF7E 4JV5E 4LU9A 2EPRA 2K4VA 2EOQA 2WCC3 2JP9A 2EPCA 4ZYHA 1BBOA 2EN3A 4GZNC 2EM2A 1XMOE 4R2SA 2V85A 1WRJA 3THNA 2L92A 2NUEA 2LTSA 2WBSA 4JI4E 4WXCA 2RTXA 2HGHA 3ECRA 1PJSA 2FV4B 2YT4A 2EMGA 2EQ1A 2V83A 4DUZE 3AUZA 1JK1A 2L3JA 5AE3A 2EPZA 2VF1A 2YPNA 4DKKA 5KL2A 2BBGA 3BIDA 4LF9E 4WYQB 2YWQA 3UK3C 5LLQA 2EMAA 4BBYA 2EPUA 2EN6A 1DGCA 4MLQA 2E1MA 2JOBA 1QU6A 2YTEA 3F6GA 4JI5E 2L2KB 2LT7A 2H36X 2LUPB 1HNWE 5F3WA 5A6AA 4Q35B 2E72A 2EOXA 1A1GA 1TF3A 4IS1C 2EN1A 2LJUA 5AE2A 3IWCA 2LE2A 1YYWA 5AC5A 4YHHE 2NUFA 1PKPA 2N8XA 1MEYC 2CPNA 3BBGA 1SR9A 4NHRA 1AH5A 2ODRD 3J81C 5KL4A 5T6JA 2EOSA 2MDRA 2V8QB 2MDGA 2DSYA 1YSAC 2ADRA 2EWLA 1GTKA 4P78A 4TUGA 1G2DC 2UU9E 2EM8A 2EMZA 4F9AB 3ADJA 2EOHA 3C4BA 3OTOE 1HR0E 2CSHA 2RQLA 2UXCE 4JI6E 4N4RB 2DGCA 5FLXC 3KWRA 3VK6A 2FTXB 2EL5A 3ADLA 2JVAA 1DI2A 1A1FA 2EMFA 4M2ZA 1YFHA 4WX9A 2F8BA 4LFAE 1X6EA 2EOFA 2DRPA 5KL7A 2DLQA 2R76A 2L8TA 4B3ME 2EMCA 1EH8A 2UUBE 2UXDE 4LF6E 1ZBTA 3ZOQB 4F2JC 3AV0A 4DV7E 5LL6R 2LBSB 2V88A 5KL3A 2KHXA 3DJWA 1EKZA 1XNRE 2EOZA 2EPAA 2ENHA 2L2NA 2ZM6E 1LLMC 1X48A 2M4IA 1P47A 2DMIA 2HJJA 2EL6A 2CTDA 2CT1A 1MGTA 4KWYA 4X65E 2EN7A 2HHHE 3KZYA 3C4TA 5KL6A 4WFTA 1B69A 2R1FA 2G7HA 2EM3A 4DR4E 2EMWA 3VYXA 3QG5C 2EPPA 1IQOA 1YYKA 2RS7A 4DMIA 1PJQA 3BGHA 4P7DA 2KONA 4R8OA 3MHHC 2RPCA 2EQ3A 5BR8E 1YUJA 1IBKE 1QNTA 1UBDC 2EM4A 4M0VA 2EMBA 4R2EA 2LVHA 4OOGC 2YU5A 1NCSA 4R2PA 4DV2E 2EPMX 4O4KA 2VE7C 2I9IA 1N34E 4L8NA 3HPZA 1BB8A 4M30A 4BC9A 4ZYEA 2D9HA 2GLIA 1N3GA 2B3TB 2EPXA 2VRDA 4ZYGA 1KJKA 4B3RE 2YSOA 4GEQB 3F6HA 4JI1E 4R2DA 2EOMA 2EJ4A 2YTQA 4WSPA 1WJPA 4X66E 2V87A 3BF2A 1A1LA 1JK2A 4Q28A 2EMHA 1N33E 3ADGA 2ODRC 4J8ZA 3J7Yp 5LMUE 1T39A 5IWAE 4I8OA 4DUYE 4LF5E 3MHSC 4BS9A 4BCAA 1SFEA 2YU8A 2UUCE 1RMDA 2B9DA 2EOIA 2MKNA 4DV6E 4ZYDA 4AQYE 3MSWA 4R03A 1FKAE 2LCEA 2YTNA 2EN2A 2J7JA 2WBTA 2IHR1 2LUQA 1YUIA 3LLHA 1UN6B 4JI8E 2VQEE 2UXBE 1NEIA 5A2QC 4LFBE 2YZTA 2N3HA 3EPKA 4LTYA 4HTGA 1PDAA 2EPNA 1X3CA 4GKKE 1IBME 3LMLA 1IBLE 2B7TA 3IWBA 1HNXE 3P1XA 2LMZA 2NUGA 2K7IA 1ZU1A 2JYAA 2EL4A 4KZSA 2YSPA 2JOXA 1XMQE 3FIGA 3H09A 1ZAAC 2V89A 3EPJA 2YTGA 2EMLA 1RC7A 4RH8A 1GZ6A 4X9JA 4DR3E 1X6HA 4DR2E 2ENAA 2EN8A 3EPHA 3VHTB 2JY9A 4JI7E 4X62E 2ELZA 5AASA 3HTXA 1IMUA 1UHZA 2UUAE 1L4SA 4WXDA 4NXME 4GKJE 4BMJA 2DIXA 2YRMA 1KYQA 2EM0A 1Z1BA 1X5WA 2EORA 5LMNE 4F9BB 4X8WA 4YY3E
chains in the Genus database with same CATH topology
5IV8B 4KWYA 2JXPA 3BF2A 4NHRA 4RH8A 4RHBB 5IXMB 2R76A 4N4RB 5TSEA 2N8XA 4Q35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV8 B;  4KWY A;  2JXP A;  3BF2 A;  4NHR A;  4RH8 A;  4RHB B;  5IXM B;  2R76 A;  4N4R B;  5TSE A;  2N8X A;  4Q35 B; 
#chains in the Genus database with same CATH topology
 2A25 A;  2DB2 A;  4F54 A;  2EPK X;  5A6B A;  2LO3 A;  3TQM A;  1I94 E;  2NAB A;  2EP3 A;  3JAM C;  4R2C A;  4F6N A;  2M9A A;  1J5E E;  4BC7 A;  2EN4 A;  4NXN E;  4JI3 E;  2EMI A;  1A1K A;  3EQ1 A;  2B7V A;  1O0W A;  2I13 A;  2YRK A;  4DV0 E;  2YTI A;  2ELY A;  1J26 A;  2MC6 A;  1A1J A;  4DV1 E;  4O5G A;  4F9C B;  4M9V C;  2EOJ A;  3C6K A;  1RQ0 A;  2YTF A;  2EM6 A;  2L2M A;  1T4N A;  1GQE A;  2VQF E;  1TF6 A;  1WHN A;  2EM9 A;  2EMK A;  1N36 E;  1X49 A;  2EM7 A;  4BHB A;  2EZ6 A;  4KHP E;  2L3C A;  1X47 A;  3RMP A;  2EOY A;  2EPL X;  2N3G A;  1T4O A;  1HNZ E;  4DR7 E;  5CFF E;  4DR5 E;  2GPI A;  2RS6 A;  3HXL A;  1TN9 A;  2DMY A;  2KOU A;  2L33 A;  4R2Q A;  2JWO A;  5IXM B;  2JPA A;  1XNQ E;  2WZO A;  4L5N C;  2WBU A;  1FJG E;  2RSI A;  3L00 A;  2RSM A;  2M1S A;  1ZR9 A;  2HC5 A;  4JYA E;  3THO B;  2E5L E;  4DV4 E;  2ENC A;  3T1H E;  3C6M A;  3T1Y E;  1N32 E;  3VYY A;  5A69 A;  1T38 A;  1PJT A;  4LF4 E;  2V86 A;  2YTJ A;  3DF6 A;  5TSE A;  2EMX A;  1A1I A;  2M7Q A;  4FK5 C;  4DR1 E;  2YTD A;  1WHQ A;  5A6B D;  4WPY A;  2F4V E;  3IWD A;  4K0K E;  3ADI A;  4O43 A;  4X64 E;  4OX9 E;  2PRT A;  2EE8 A;  4R2R A;  2LV2 A;  3JU0 A;  1AAY A;  2NA2 A;  3HQ1 A;  4DV3 E;  4B3S E;  2EOO A;  5A6J A;  4DR6 E;  5KL5 A;  4RHB B;  4TUI A;  2JR1 A;  2YRH A;  2LRS A;  3J80 C;  4LFC E;  3OML A;  3JTZ A;  4LF8 E;  2MKD A;  1YPN A;  1DQ3 A;  5AE1 A;  4DV5 E;  1F2I G;  3HPS A;  5AC4 A;  5IV8 B;  3EPL A;  2EMY A;  4JI0 E;  2EM5 A;  3M99 B;  5DNY A;  5IT9 C;  1EH6 A;  4R2A A;  2LJH A;  1STU A;  4IJD A;  1YYO A;  2JXP A;  4HEI A;  5A6K A;  2EQ0 A;  4O24 A;  1ZBQ A;  1YZ9 A;  1WXR A;  3K6Q A;  1X6F A;  1BBG A;  1T4L B;  4MLV A;  4WSG A;  2YTO A;  2DLK A;  2L6M A;  1A1H A;  2FGG A;  2LTR A;  3KZZ A;  2EPO A;  2Q8U A;  2YTP A;  2EOE A;  4BHC A;  4F6M A;  4JI2 E;  2BB8 A;  4NZV A;  4B3T E;  1UIL A;  1G2F C;  1IQS A;  2MC5 A;  1EH7 A;  5ADZ A;  2GHF A;  3J7A G;  4LF7 E;  4JV5 E;  4LU9 A;  2EPR A;  2K4V A;  2EOQ A;  2WCC 3;  2JP9 A;  2EPC A;  4ZYH A;  1BBO A;  2EN3 A;  4GZN C;  2EM2 A;  1XMO E;  4R2S A;  2V85 A;  1WRJ A;  3THN A;  2L92 A;  2NUE A;  2LTS A;  2WBS A;  4JI4 E;  4WXC A;  2RTX A;  2HGH A;  3ECR A;  1PJS A;  2FV4 B;  2YT4 A;  2EMG A;  2EQ1 A;  2V83 A;  4DUZ E;  3AUZ A;  1JK1 A;  2L3J A;  5AE3 A;  2EPZ A;  2VF1 A;  2YPN A;  4DKK A;  5KL2 A;  2BBG A;  3BID A;  4LF9 E;  4WYQ B;  2YWQ A;  3UK3 C;  5LLQ A;  2EMA A;  4BBY A;  2EPU A;  2EN6 A;  1DGC A;  4MLQ A;  2E1M A;  2JOB A;  1QU6 A;  2YTE A;  3F6G A;  4JI5 E;  2L2K B;  2LT7 A;  2H36 X;  2LUP B;  1HNW E;  5F3W A;  5A6A A;  4Q35 B;  2E72 A;  2EOX A;  1A1G A;  1TF3 A;  4IS1 C;  2EN1 A;  2LJU A;  5AE2 A;  3IWC A;  2LE2 A;  1YYW A;  5AC5 A;  4YHH E;  2NUF A;  1PKP A;  2N8X A;  1MEY C;  2CPN A;  3BBG A;  1SR9 A;  4NHR A;  1AH5 A;  2ODR D;  3J81 C;  5KL4 A;  5T6J A;  2EOS A;  2MDR A;  2V8Q B;  2MDG A;  2DSY A;  1YSA C;  2ADR A;  2EWL A;  1GTK A;  4P78 A;  4TUG A;  1G2D C;  2UU9 E;  2EM8 A;  2EMZ A;  4F9A B;  3ADJ A;  2EOH A;  3C4B A;  3OTO E;  1HR0 E;  2CSH A;  2RQL A;  2UXC E;  4JI6 E;  4N4R B;  2DGC A;  5FLX C;  3KWR A;  3VK6 A;  2FTX B;  2EL5 A;  3ADL A;  2JVA A;  1DI2 A;  1A1F A;  2EMF A;  4M2Z A;  1YFH A;  4WX9 A;  2F8B A;  4LFA E;  1X6E A;  2EOF A;  2DRP A;  5KL7 A;  2DLQ A;  2R76 A;  2L8T A;  4B3M E;  2EMC A;  1EH8 A;  2UUB E;  2UXD E;  4LF6 E;  1ZBT A;  3ZOQ B;  4F2J C;  3AV0 A;  4DV7 E;  5LL6 R;  2LBS B;  2V88 A;  5KL3 A;  2KHX A;  3DJW A;  1EKZ A;  1XNR E;  2EOZ A;  2EPA A;  2ENH A;  2L2N A;  2ZM6 E;  1LLM C;  1X48 A;  2M4I A;  1P47 A;  2DMI A;  2HJJ A;  2EL6 A;  2CTD A;  2CT1 A;  1MGT A;  4KWY A;  4X65 E;  2EN7 A;  2HHH E;  3KZY A;  3C4T A;  5KL6 A;  4WFT A;  1B69 A;  2R1F A;  2G7H A;  2EM3 A;  4DR4 E;  2EMW A;  3VYX A;  3QG5 C;  2EPP A;  1IQO A;  1YYK A;  2RS7 A;  4DMI A;  1PJQ A;  3BGH A;  4P7D A;  2KON A;  4R8O A;  3MHH C;  2RPC A;  2EQ3 A;  5BR8 E;  1YUJ A;  1IBK E;  1QNT A;  1UBD C;  2EM4 A;  4M0V A;  2EMB A;  4R2E A;  2LVH A;  4OOG C;  2YU5 A;  1NCS A;  4R2P A;  4DV2 E;  2EPM X;  4O4K A;  2VE7 C;  2I9I A;  1N34 E;  4L8N A;  3HPZ A;  1BB8 A;  4M30 A;  4BC9 A;  4ZYE A;  2D9H A;  2GLI A;  1N3G A;  2B3T B;  2EPX A;  2VRD A;  4ZYG A;  1KJK A;  4B3R E;  2YSO A;  4GEQ B;  3F6H A;  4JI1 E;  4R2D A;  2EOM A;  2EJ4 A;  2YTQ A;  4WSP A;  1WJP A;  4X66 E;  2V87 A;  3BF2 A;  1A1L A;  1JK2 A;  4Q28 A;  2EMH A;  1N33 E;  3ADG A;  2ODR C;  4J8Z A;  3J7Y p;  5LMU E;  1T39 A;  5IWA E;  4I8O A;  4DUY E;  4LF5 E;  3MHS C;  4BS9 A;  4BCA A;  1SFE A;  2YU8 A;  2UUC E;  1RMD A;  2B9D A;  2EOI A;  2MKN A;  4DV6 E;  4ZYD A;  4AQY E;  3MSW A;  4R03 A;  1FKA E;  2LCE A;  2YTN A;  2EN2 A;  2J7J A;  2WBT A;  2IHR 1;  2LUQ A;  1YUI A;  3LLH A;  1UN6 B;  4JI8 E;  2VQE E;  2UXB E;  1NEI A;  5A2Q C;  4LFB E;  2YZT A;  2N3H A;  3EPK A;  4LTY A;  4HTG A;  1PDA A;  2EPN A;  1X3C A;  4GKK E;  1IBM E;  3LML A;  1IBL E;  2B7T A;  3IWB A;  1HNX E;  3P1X A;  2LMZ A;  2NUG A;  2K7I A;  1ZU1 A;  2JYA A;  2EL4 A;  4KZS A;  2YSP A;  2JOX A;  1XMQ E;  3FIG A;  3H09 A;  1ZAA C;  2V89 A;  3EPJ A;  2YTG A;  2EML A;  1RC7 A;  4RH8 A;  1GZ6 A;  4X9J A;  4DR3 E;  1X6H A;  4DR2 E;  2ENA A;  2EN8 A;  3EPH A;  3VHT B;  2JY9 A;  4JI7 E;  4X62 E;  2ELZ A;  5AAS A;  3HTX A;  1IMU A;  1UHZ A;  2UUA E;  1L4S A;  4WXD A;  4NXM E;  4GKJ E;  4BMJ A;  2DIX A;  2YRM A;  1KYQ A;  2EM0 A;  1Z1B A;  1X5W A;  2EOR A;  5LMN E;  4F9B B;  4X8W A;  4YY3 E; 
#chains in the Genus database with same CATH homology
 5IV8 B;  4KWY A;  2JXP A;  3BF2 A;  4NHR A;  4RH8 A;  4RHB B;  5IXM B;  2R76 A;  4N4R B;  5TSE A;  2N8X A;  4Q35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...