5TSEA

2.35 angstrom crystal structure minor lipoprotein from acinetobacter baumannii.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
ATPLVYKKLSLELPAKTDDLETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTVTFQIEDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQISANRLPKAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title 2.35 Angstrom Crystal Structure Minor Lipoprotein from Acinetobacter baumannii.
rcsb
source organism Acinetobacter baumannii
molecule tags Lipid binding protein
total genus 38
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 5tseA00
5TSEA 5IV8B 3BF2A 2R76A 4NHRA 5IXMB 4Q35B 4KWYA 4N4RB 2JXPA 2N8XA 4RH8A 4RHBB
chains in the Genus database with same CATH superfamily
3THNA 2JOBA 2EPCA 2FTXB 3J7Yp 1IQSA 1YPNA 2YTJA 1X48A 5T6JA 5F3WA 2MDRA 4BHBA 2YRHA 4X66E 3VK6A 1UHZA 1TF6A 2EM8A 4M30A 1SFEA 1PJSA 1PJTA 1X6HA 4JI7E 1WRJA 2E5LE 2YRMA 4P78A 2M1SA 4R2EA 2DRPA 2RTXA 2L3JA 2L3CA 1GZ6A 1O0WA 4WYQB 4F6NA 4DV0E 2L33A 2EPUA 2NUEA 2F4VE 2EN7A 5AE2A 2EPLX 5KL5A 4IJDA 4J8ZA 4BS9A 2L2KB 1F2IG 1ZAAC 3HTXA 5LL6R 1YSAC 2DMYA 3ADGA 5CFFE 2EP3A 4K0KE 4Q35B 2EMBA 2EPOA 2YU5A 4R03A 3EQ1A 2KOUA 5IWAE 3F6GA 1T4OA 2I9IA 1JK2A 4I8OA 2EPNA 1N3GA 1IMUA 4LF9E 2EOJA 4ZYGA 2EN2A 4KWYA 1YZ9A 1N32E 4B3TE 2NUFA 1AH5A 1BBOA 4F9AB 4JYAE 2EOSA 1YYOA 4F2JC 5LMNE 2YTGA 5A2QC 3FIGA 2YSOA 3DF6A 4B3RE 1IBKE 2R1FA 2EN4A 4AQYE 4X62E 4R2SA 4HEIA 3J81C 1EH8A 1GQEA 3C4TA 2DLKA 2EOMA 1PJQA 3P1XA 2WBUA 5ADZA 1X6FA 5A6JA 4NXME 5AE1A 2DGCA 2NUGA 1G2DC 3EPHA 3BBGA 2EPZA 4JI2E 2M7QA 3T1HE 4MLVA 2EQ3A 4DMIA 1T4LB 2LO3A 4JI1E 1EH6A 2JWOA 4DKKA 2JOXA 2EWLA 4KZSA 1T39A 4X8WA 2LV2A 2VQEE 2DSYA 4N4RB 2EMIA 4DUZE 1A1IA 2EQ0A 4M0VA 4JI4E 2L6MA 1N33E 2LRSA 1X47A 2YTIA 4Q28A 2EMGA 1T4NA 3EPKA 3HPZA 3C6KA 4ZYDA 3QG5C 4O4KA 4DR2E 1EH7A 3BIDA 2M9AA 2ENCA 2ENAA 2EN8A 1RMDA 3MSWA 4X9JA 2EMZA 4L5NC 1WHQA 4OOGC 2UUBE 3C4BA 5A6AA 2ENHA 4DR6E 2EMXA 3EPLA 2EMYA 1L4SA 3BGHA 3IWDA 2FV4B 4WSGA 1NEIA 4LFAE 3LMLA 4LF7E 1X3CA 1EKZA 2LCEA 1IBLE 3JTZA 3TQMA 2H36X 2V88A 5AC5A 1UBDC 1A1FA 2RSIA 4JI3E 2N8XA 2UUAE 3AV0A 2B3TB 1RC7A 2EOIA 1DI2A 3F6HA 5DNYA 5A69A 4R2QA 1P47A 2J7JA 2EL5A 4NZVA 4M2ZA 2EM0A 2EN6A 2HJJA 1ZU1A 2GLIA 5BR8E 1MEYC 4O24A 5LLQA 2CPNA 3OTOE 2VQFE 1AAYA 1TF3A 1IBME 2RPCA 2RQLA 4F54A 3ADLA 2EN1A 2EMCA 2ZM6E 1A1GA 2V89A 2YTFA 4BC9A 4BCAA 1HNXE 4YY3E 2EORA 4DV4E 4GZNC 4LF5E 4DR7E 5KL6A 2EPPA 3EPJA 4WPYA 2DMIA 2NABA 1A1LA 2E1MA 1ZBTA 1ZBQA 5TSEA 4BHCA 2JYAA 5IXMB 3HQ1A 1RQ0A 4MLQA 2JR1A 3THOB 2MC5A 2EM9A 2EL4A 2EMKA 1FJGE 2F8BA 2EM3A 4NXNE 1FKAE 5AE3A 4WX9A 2RSMA 3UK3C 4R2PA 2EOHA 1DQ3A 1STUA 2MKDA 2B9DA 4RH8A 2L2NA 2V85A 2EPKX 1QU6A 2VRDA 2EJ4A 4F9CB 2LUPB 2IHR1 2EPRA 1YYKA 2DB2A 2E72A 2LE2A 2M4IA 4DV5E 3DJWA 4DV7E 3M99B 5AASA 1A1JA 4LU9A 2RS7A 2A25A 4ZYHA 4LF6E 4GKKE 3VYYA 2B7TA 2ELZA 2LMZA 5A6BD 1B69A 4DR3E 2EMAA 4BBYA 4F9BB 2WCC3 4WXDA 3HXLA 2HHHE 2EL6A 2GPIA 4ZYEA 3ADIA 2HGHA 2DIXA 1ZR9A 1WXRA 3H09A 2L8TA 4LF8E 4HTGA 1YYWA 4WXCA 2EZ6A 2LUQA 2JPAA 2YTDA 1WHNA 3AUZA 2EOQA 1WJPA 2V8QB 2G7HA 1J26A 4FK5C 2YTPA 3KZZA 1UN6B 2LJUA 4WSPA 1BB8A 1DGCA 2YSPA 1YUJA 1NCSA 2YTQA 2RS6A 4DV6E 3JU0A 1A1HA 2BBGA 2EPAA 4DV3E 3T1YE 4TUIA 2LTRA 2EM7A 4DR5E 5A6KA 4RHBB 3OMLA 4JI6E 2UXBE 4F6MA 2L2MA 2YTEA 1JK1A 2EMLA 4DV1E 2ELYA 2YTNA 3JAMC 4NHRA 2N3GA 3L00A 1HR0E 3ECRA 2YU8A 1XNRE 2ODRD 4B3ME 2YWQA 2EE8A 4DR1E 1PDAA 4JV5E 2KHXA 2EPXA 2EOFA 2LT7A 4GKJE 2EOOA 3VHTB 4X65E 1X6EA 4R2RA 1PKPA 1HNWE 4BC7A 2EMHA 1BBGA 1G2FC 5AC4A 3RMPA 1KYQA 2UXCE 2EOXA 2HC5A 2ADRA 2EM6A 4M9VC 1YUIA 1X5WA 2DLQA 2ODRC 3J7AG 1QNTA 2WZOA 4R2CA 2YPNA 1XNQE 1A1KA 2EM2A 2EPMX 2GHFA 2D9HA 2MKNA 5IV8B 3ADJA 4LF4E 1IQOA 1SR9A 4P7DA 2JY9A 2VE7C 4L8NA 2YT4A 2LTSA 3BF2A 1I94E 5KL4A 1X49A 2EOYA 2Q8UA 1XMQE 2YZTA 5IT9C 3ZOQB 1TN9A 4OX9E 5KL3A 2LVHA 1XMOE 4DUYE 5FLXC 2I13A 2K7IA 2LBSB 2KONA 2EOEA 2CTDA 2K4VA 4O5GA 1YFHA 2FGGA 1T38A 4YHHE 4BMJA 1KJKA 4B3SE 2V86A 2EN3A 5LMUE 3LLHA 3K6QA 1LLMC 4GEQB 2UU9E 2CT1A 2EMWA 2JVAA 4R2DA 4IS1C 4O43A 4JI8E 2N3HA 4JI5E 4KHPE 4TUGA 3MHSC 3J80C 3MHHC 1N34E 4WFTA 1J5EE 2MC6A 3IWCA 4LFBE 4LTYA 1GTKA 1UILA 3HPSA 2MDGA 4LFCE 4R8OA 2WBSA 1MGTA 2L92A 3IWBA 2CSHA 2LJHA 2V87A 4DR4E 4DV2E 2EM5A 1Z1BA 2UUCE 2WBTA 5KL7A 4X64E 4R2AA 2EMFA 2UXDE 5A6BA 4JI0E 2YTOA 2V83A 2NA2A 2R76A 2B7VA 2JP9A 5KL2A 3KZYA 2EM4A 1HNZE 3C6MA 2PRTA 2BB8A 2EQ1A 3KWRA 2JXPA 2EOZA 2YRKA 3VYXA 1N36E 2VF1A
chains in the Genus database with same CATH topology
5TSEA 5IV8B 3BF2A 2R76A 4NHRA 5IXMB 4Q35B 4KWYA 4N4RB 2JXPA 2N8XA 4RH8A 4RHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSE A;  5IV8 B;  3BF2 A;  2R76 A;  4NHR A;  5IXM B;  4Q35 B;  4KWY A;  4N4R B;  2JXP A;  2N8X A;  4RH8 A;  4RHB B; 
#chains in the Genus database with same CATH topology
 3THN A;  2JOB A;  2EPC A;  2FTX B;  3J7Y p;  1IQS A;  1YPN A;  2YTJ A;  1X48 A;  5T6J A;  5F3W A;  2MDR A;  4BHB A;  2YRH A;  4X66 E;  3VK6 A;  1UHZ A;  1TF6 A;  2EM8 A;  4M30 A;  1SFE A;  1PJS A;  1PJT A;  1X6H A;  4JI7 E;  1WRJ A;  2E5L E;  2YRM A;  4P78 A;  2M1S A;  4R2E A;  2DRP A;  2RTX A;  2L3J A;  2L3C A;  1GZ6 A;  1O0W A;  4WYQ B;  4F6N A;  4DV0 E;  2L33 A;  2EPU A;  2NUE A;  2F4V E;  2EN7 A;  5AE2 A;  2EPL X;  5KL5 A;  4IJD A;  4J8Z A;  4BS9 A;  2L2K B;  1F2I G;  1ZAA C;  3HTX A;  5LL6 R;  1YSA C;  2DMY A;  3ADG A;  5CFF E;  2EP3 A;  4K0K E;  4Q35 B;  2EMB A;  2EPO A;  2YU5 A;  4R03 A;  3EQ1 A;  2KOU A;  5IWA E;  3F6G A;  1T4O A;  2I9I A;  1JK2 A;  4I8O A;  2EPN A;  1N3G A;  1IMU A;  4LF9 E;  2EOJ A;  4ZYG A;  2EN2 A;  4KWY A;  1YZ9 A;  1N32 E;  4B3T E;  2NUF A;  1AH5 A;  1BBO A;  4F9A B;  4JYA E;  2EOS A;  1YYO A;  4F2J C;  5LMN E;  2YTG A;  5A2Q C;  3FIG A;  2YSO A;  3DF6 A;  4B3R E;  1IBK E;  2R1F A;  2EN4 A;  4AQY E;  4X62 E;  4R2S A;  4HEI A;  3J81 C;  1EH8 A;  1GQE A;  3C4T A;  2DLK A;  2EOM A;  1PJQ A;  3P1X A;  2WBU A;  5ADZ A;  1X6F A;  5A6J A;  4NXM E;  5AE1 A;  2DGC A;  2NUG A;  1G2D C;  3EPH A;  3BBG A;  2EPZ A;  4JI2 E;  2M7Q A;  3T1H E;  4MLV A;  2EQ3 A;  4DMI A;  1T4L B;  2LO3 A;  4JI1 E;  1EH6 A;  2JWO A;  4DKK A;  2JOX A;  2EWL A;  4KZS A;  1T39 A;  4X8W A;  2LV2 A;  2VQE E;  2DSY A;  4N4R B;  2EMI A;  4DUZ E;  1A1I A;  2EQ0 A;  4M0V A;  4JI4 E;  2L6M A;  1N33 E;  2LRS A;  1X47 A;  2YTI A;  4Q28 A;  2EMG A;  1T4N A;  3EPK A;  3HPZ A;  3C6K A;  4ZYD A;  3QG5 C;  4O4K A;  4DR2 E;  1EH7 A;  3BID A;  2M9A A;  2ENC A;  2ENA A;  2EN8 A;  1RMD A;  3MSW A;  4X9J A;  2EMZ A;  4L5N C;  1WHQ A;  4OOG C;  2UUB E;  3C4B A;  5A6A A;  2ENH A;  4DR6 E;  2EMX A;  3EPL A;  2EMY A;  1L4S A;  3BGH A;  3IWD A;  2FV4 B;  4WSG A;  1NEI A;  4LFA E;  3LML A;  4LF7 E;  1X3C A;  1EKZ A;  2LCE A;  1IBL E;  3JTZ A;  3TQM A;  2H36 X;  2V88 A;  5AC5 A;  1UBD C;  1A1F A;  2RSI A;  4JI3 E;  2N8X A;  2UUA E;  3AV0 A;  2B3T B;  1RC7 A;  2EOI A;  1DI2 A;  3F6H A;  5DNY A;  5A69 A;  4R2Q A;  1P47 A;  2J7J A;  2EL5 A;  4NZV A;  4M2Z A;  2EM0 A;  2EN6 A;  2HJJ A;  1ZU1 A;  2GLI A;  5BR8 E;  1MEY C;  4O24 A;  5LLQ A;  2CPN A;  3OTO E;  2VQF E;  1AAY A;  1TF3 A;  1IBM E;  2RPC A;  2RQL A;  4F54 A;  3ADL A;  2EN1 A;  2EMC A;  2ZM6 E;  1A1G A;  2V89 A;  2YTF A;  4BC9 A;  4BCA A;  1HNX E;  4YY3 E;  2EOR A;  4DV4 E;  4GZN C;  4LF5 E;  4DR7 E;  5KL6 A;  2EPP A;  3EPJ A;  4WPY A;  2DMI A;  2NAB A;  1A1L A;  2E1M A;  1ZBT A;  1ZBQ A;  5TSE A;  4BHC A;  2JYA A;  5IXM B;  3HQ1 A;  1RQ0 A;  4MLQ A;  2JR1 A;  3THO B;  2MC5 A;  2EM9 A;  2EL4 A;  2EMK A;  1FJG E;  2F8B A;  2EM3 A;  4NXN E;  1FKA E;  5AE3 A;  4WX9 A;  2RSM A;  3UK3 C;  4R2P A;  2EOH A;  1DQ3 A;  1STU A;  2MKD A;  2B9D A;  4RH8 A;  2L2N A;  2V85 A;  2EPK X;  1QU6 A;  2VRD A;  2EJ4 A;  4F9C B;  2LUP B;  2IHR 1;  2EPR A;  1YYK A;  2DB2 A;  2E72 A;  2LE2 A;  2M4I A;  4DV5 E;  3DJW A;  4DV7 E;  3M99 B;  5AAS A;  1A1J A;  4LU9 A;  2RS7 A;  2A25 A;  4ZYH A;  4LF6 E;  4GKK E;  3VYY A;  2B7T A;  2ELZ A;  2LMZ A;  5A6B D;  1B69 A;  4DR3 E;  2EMA A;  4BBY A;  4F9B B;  2WCC 3;  4WXD A;  3HXL A;  2HHH E;  2EL6 A;  2GPI A;  4ZYE A;  3ADI A;  2HGH A;  2DIX A;  1ZR9 A;  1WXR A;  3H09 A;  2L8T A;  4LF8 E;  4HTG A;  1YYW A;  4WXC A;  2EZ6 A;  2LUQ A;  2JPA A;  2YTD A;  1WHN A;  3AUZ A;  2EOQ A;  1WJP A;  2V8Q B;  2G7H A;  1J26 A;  4FK5 C;  2YTP A;  3KZZ A;  1UN6 B;  2LJU A;  4WSP A;  1BB8 A;  1DGC A;  2YSP A;  1YUJ A;  1NCS A;  2YTQ A;  2RS6 A;  4DV6 E;  3JU0 A;  1A1H A;  2BBG A;  2EPA A;  4DV3 E;  3T1Y E;  4TUI A;  2LTR A;  2EM7 A;  4DR5 E;  5A6K A;  4RHB B;  3OML A;  4JI6 E;  2UXB E;  4F6M A;  2L2M A;  2YTE A;  1JK1 A;  2EML A;  4DV1 E;  2ELY A;  2YTN A;  3JAM C;  4NHR A;  2N3G A;  3L00 A;  1HR0 E;  3ECR A;  2YU8 A;  1XNR E;  2ODR D;  4B3M E;  2YWQ A;  2EE8 A;  4DR1 E;  1PDA A;  4JV5 E;  2KHX A;  2EPX A;  2EOF A;  2LT7 A;  4GKJ E;  2EOO A;  3VHT B;  4X65 E;  1X6E A;  4R2R A;  1PKP A;  1HNW E;  4BC7 A;  2EMH A;  1BBG A;  1G2F C;  5AC4 A;  3RMP A;  1KYQ A;  2UXC E;  2EOX A;  2HC5 A;  2ADR A;  2EM6 A;  4M9V C;  1YUI A;  1X5W A;  2DLQ A;  2ODR C;  3J7A G;  1QNT A;  2WZO A;  4R2C A;  2YPN A;  1XNQ E;  1A1K A;  2EM2 A;  2EPM X;  2GHF A;  2D9H A;  2MKN A;  5IV8 B;  3ADJ A;  4LF4 E;  1IQO A;  1SR9 A;  4P7D A;  2JY9 A;  2VE7 C;  4L8N A;  2YT4 A;  2LTS A;  3BF2 A;  1I94 E;  5KL4 A;  1X49 A;  2EOY A;  2Q8U A;  1XMQ E;  2YZT A;  5IT9 C;  3ZOQ B;  1TN9 A;  4OX9 E;  5KL3 A;  2LVH A;  1XMO E;  4DUY E;  5FLX C;  2I13 A;  2K7I A;  2LBS B;  2KON A;  2EOE A;  2CTD A;  2K4V A;  4O5G A;  1YFH A;  2FGG A;  1T38 A;  4YHH E;  4BMJ A;  1KJK A;  4B3S E;  2V86 A;  2EN3 A;  5LMU E;  3LLH A;  3K6Q A;  1LLM C;  4GEQ B;  2UU9 E;  2CT1 A;  2EMW A;  2JVA A;  4R2D A;  4IS1 C;  4O43 A;  4JI8 E;  2N3H A;  4JI5 E;  4KHP E;  4TUG A;  3MHS C;  3J80 C;  3MHH C;  1N34 E;  4WFT A;  1J5E E;  2MC6 A;  3IWC A;  4LFB E;  4LTY A;  1GTK A;  1UIL A;  3HPS A;  2MDG A;  4LFC E;  4R8O A;  2WBS A;  1MGT A;  2L92 A;  3IWB A;  2CSH A;  2LJH A;  2V87 A;  4DR4 E;  4DV2 E;  2EM5 A;  1Z1B A;  2UUC E;  2WBT A;  5KL7 A;  4X64 E;  4R2A A;  2EMF A;  2UXD E;  5A6B A;  4JI0 E;  2YTO A;  2V83 A;  2NA2 A;  2R76 A;  2B7V A;  2JP9 A;  5KL2 A;  3KZY A;  2EM4 A;  1HNZ E;  3C6M A;  2PRT A;  2BB8 A;  2EQ1 A;  3KWR A;  2JXP A;  2EOZ A;  2YRK A;  3VYX A;  1N36 E;  2VF1 A; 
#chains in the Genus database with same CATH homology
 5TSE A;  5IV8 B;  3BF2 A;  2R76 A;  4NHR A;  5IXM B;  4Q35 B;  4KWY A;  4N4R B;  2JXP A;  2N8X A;  4RH8 A;  4RHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...