2LV2A

Solution nmr structure of c2h2-type zinc-fingers 4 and 5 from human insulinoma-associated protein 1 (fragment 424-497), northeast structural genomics consortium target hr7614b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulinoma-associated protein 1
publication title Solution NMR structure of C2H2-type Zinc-fingers 4 and 5 from human Insulinoma-associated protein 1 (fragment 424-497), Northeast Structural Genomics Consortium Target HR7614B (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lv2A00
1X6EA 2WCC3 2EM5A 2A25A 3M99B 5KL4A 4X9JA 1ZR9A 2YTPA 3MHHC 2EM3A 1A1FA 4IJDA 2HGHA 2EOJA 2CTDA 1JK2A 2EQ1A 2YRMA 2NABA 2EOEA 1BBOA 2ENHA 1X6HA 3MHSC 2LCEA 2D9HA 2EMZA 2EMHA 2EMYA 2J7JA 2ELYA 2YTNA 2EN2A 2EM7A 1YSAC 2WBTA 2EPPA 5KL6A 2EPZA 2EMWA 2I13A 4WSGA 2EORA 2EM2A 2EN4A 2YTFA 1A1LA 2DMIA 1ZAAC 2EL4A 2VRDA 1TF6A 4R2AA 1WJPA 2EOZA 1UBDC 2DLKA 2RSIA 4GZNC 2EMFA 2MKNA 2EN8A 2M9AA 2EPCA 1UN6B 2EL6A 2JP9A 2EOSA 2EMXA 2YSPA 4R2EA 1YUJA 2EN6A 2EOOA 5KL5A 1X5WA 2LV2A 2YTGA 3EPKA 4R2SA 2EMBA 2EOXA 5KL3A 2GHFA 2MDGA 2YRKA 2EOIA 1G2FC 2EN3A 2EOHA 2GLIA 2ENAA 1A1JA 2DGCA 2YTEA 1KJKA 2EQ0A 2EOMA 2CT1A 2EM0A 4R2PA 2JPAA 4R2CA 3EPHA 2YTIA 2BB8A 2LT7A 1YUIA 2EM9A 4F6NA 2MKDA 2EOYA 1X3CA 2LO3A 1RMDA 2EQ3A 2EPRA 2EJ4A 2YTJA 1LLMC 3EPLA 2EMGA 2PRTA 2DLQA 2EM8A 2EN1A 2CSHA 4F2JC 2LVHA 2YSOA 2RPCA 2EM6A 2WBSA 1X6FA 3UK3C 1A1KA 1MEYC 4IS1C 2DRPA 4R2DA 2EMIA 2EOQA 1BB8A 2YU5A 2WBUA 2EN7A 1B69A 1A1GA 1AAYA 4M9VC 2EP3A 1ZU1A 2YTOA 2EPXA 1DGCA 4F6MA 2EE8A 2EMAA 2ELZA 2EPUA 1TF3A 1TN9A 4FK5C 5KL2A 4R2RA 2R1FA 1NCSA 2EL5A 1A1HA 3EPJA 2EOFA 2EMLA 2YRHA 5KL7A 1P47A 2E72A 1A1IA 2YU8A 2EPAA 1Z1BA 1F2IG 1G2DC 2ENCA 4R2QA 1JK1A 2EM4A 2YTQA 2YTDA 3VHTB 2EMKA 2ADRA 2EMCA
chains in the Genus database with same CATH superfamily
4BC7A 2LTRA 4LFBE 1T39A 2NUEA 2YTPA 4IJDA 2HGHA 2NUGA 3LMLA 2EQ1A 4O24A 4ZYDA 1N3GA 2EOEA 3BGHA 2D9HA 4LF6E 2LTSA 3BIDA 4J8ZA 2HC5A 4M30A 2JY9A 2EORA 3H09A 1YYWA 1A1LA 1T4OA 2EL4A 4ZYGA 2LUPB 1FJGE 2EOZA 1UBDC 4K0KE 4X65E 4OX9E 2M1SA 4Q35B 2JP9A 2V83A 1XMQE 2YSPA 4L5NC 2V8QB 1KYQA 4R2EA 3JAMC 4JYAE 2UUAE 2N8XA 4YHHE 3QG5C 1EH7A 3AV0A 2YRKA 3ADGA 2EOHA 4DKKA 2V86A 2DGCA 1NEIA 1KJKA 2EPKX 2CT1A 3VYXA 1YUIA 2H36X 4LU9A 2N3GA 4LF9E 5IT9C 4LF4E 2K7IA 3ADLA 4NHRA 1LLMC 5TSEA 3EPLA 4DR5E 4JI0E 2B7TA 2PRTA 4RHBB 4B3SE 1IQSA 2CSHA 2EZ6A 2JOBA 4WSPA 2RPCA 3J81C 2DMYA 4DUZE 4IS1C 2YU5A 1A1GA 4B3TE 4DV5E 4JI4E 4MLQA 2YTOA 1X49A 1N32E 1TF3A 2EMAA 2ELZA 1HNWE 5KL2A 1N34E 1HR0E 5AE2A 2WZOA 2KONA 4BBYA 3BBGA 1A1IA 2YRHA 5KL7A 1P47A 1G2DC 2LJHA 4BHCA 1JK1A 2YTQA 3VHTB 2EMKA 3F6GA 1AAYA 2EMCA 3KZYA 2JXPA 2RQLA 2GPIA 4WYQB 4F9CB 2EM3A 1IBME 2CTDA 3J7Yp 2ODRC 2UXBE 2UUCE 3AUZA 1PJSA 2YRMA 2L6MA 4BHBA 5A6BD 4YY3E 4LTYA 4DR3E 1X6HA 3MHSC 2R76A 2FGGA 4DR6E 2EN2A 1YSAC 2WBTA 2EPPA 2UXDE 2I13A 3C4TA 4RH8A 4WFTA 2EN4A 1ZAAC 2VRDA 1GTKA 5AE1A 4R2AA 3EQ1A 1X48A 3DF6A 5IXMB 4F9AB 2RSMA 4R03A 2MKNA 1UN6B 2EL6A 4LF8E 2LUQA 3JU0A 3JTZA 4NXME 2EOSA 5AC5A 4WPYA 1IBKE 1IBLE 3MSWA 4X8WA 2L2KB 3J80C 1I94E 4KZSA 2EOOA 5KL5A 1J5EE 3EPKA 3DJWA 2EMBA 3C6MA 2DIXA 2EOXA 4BCAA 5KL3A 4HEIA 4JV5E 1XMOE 2EOIA 1L4SA 1G2FC 3OMLA 2GLIA 1WRJA 4GEQB 1A1JA 3IWDA 2EM0A 3IWCA 4WX9A 4R2CA 3EPHA 4DV6E 1X47A 4F6NA 3ZOQB 2VF1A 2LMZA 2MKDA 4M2ZA 2JWOA 3K6QA 1RMDA 3VK6A 2EQ3A 3BF2A 2EMGA 1N36E 3HPZA 2EM8A 2VQFE 4B3RE 2LBSB 2LE2A 2YSOA 5LMUE 2EM6A 3UK3C 1MEYC 2VQEE 1O0WA 1BB8A 1B69A 1ZU1A 1DGCA 2G7HA 4BC9A 4ZYHA 1IMUA 2KOUA 4DV7E 1A1HA 2EMLA 2YU8A 2EPAA 2ENCA 2ODRD 4JI7E 4R2QA 2EM4A 2LRSA 3L00A 1X6EA 3HPSA 2WCC3 4X9JA 3T1YE 2M4IA 2M7QA 1A1FA 2EOJA 1HNZE 4LFAE 5IV8B 4KWYA 1QU6A 2EPMX 2JYAA 3RMPA 1MGTA 2NABA 2ENHA 4O43A 3KZZA 2LCEA 2EMZA 2EPNA 2CPNA 2YTNA 2E5LE 4JI3E 4BS9A 4JI1E 3ADIA 4DR7E 1GZ6A 4WSGA 5AC4A 2YTFA 2B7VA 2DMIA 2EWLA 1XNQE 2UXCE 1TF6A 3THOB 1DQ3A 2B9DA 5AASA 3C4BA 2DLKA 2IHR1 2UU9E 4GZNC 2EN8A 3KWRA 4WXCA 1PKPA 4DMIA 2L92A 4X62E 3IWBA 1RC7A 2EMXA 5A6BA 2VE7C 4R8OA 2EN6A 2BBGA 2V88A 1XNRE 1X5WA 2LV2A 5A69A 4DV0E 1HNXE 4R2SA 5A6KA 2GHFA 1T4NA 2MDGA 2MC6A 5BR8E 1EH6A 2ENAA 2EQ0A 2V89A 4R2PA 4Q28A 3THNA 4M0VA 3HTXA 4GKJE 1BBGA 2BB8A 2LT7A 1ZBQA 2NA2A 2EM9A 4I8OA 2F8BA 5LMNE 5ADZA 2EOYA 2KHXA 4JI6E 2MDRA 1X3CA 2LO3A 3LLHA 4B3ME 2EPRA 2V85A 4P7DA 2L8TA 2DLQA 4DV1E 1FKAE 1DI2A 1UILA 4MLVA 2LVHA 2YZTA 4HTGA 4F2JC 2Q8UA 2WBSA 1X6FA 1A1KA 4DUYE 2EOQA 2JVAA 1PJTA 4WXDA 2WBUA 4JI8E 4DV4E 4KHPE 1T38A 2EPXA 2V87A 2F4VE 2R1FA 1PJQA 2EL5A 2HHHE 1UHZA 3EPJA 1SFEA 1AH5A 2E72A 2EPLX 1YPNA 1F2IG 5T6JA 1STUA 2YTDA 1SR9A 4JI2E 1IQOA 2EM5A 2A25A 3M99B 5KL4A 2E1MA 2FTXB 5FLXC 1ZR9A 1WHQA 3MHHC 4JI5E 5IWAE 3ADJA 1JK2A 2RS7A 1YYKA 4GKKE 4P78A 1BBOA 4ZYEA 2B3TB 3F6HA 2DB2A 2EMHA 2EMYA 2J7JA 2ELYA 2LJUA 4DV3E 4X66E 4DR1E 1N33E 2EM7A 1J26A 5CFFE 5A6AA 2L2MA 5KL6A 2EPZA 2EMWA 2N3HA 1ZBTA 2EM2A 1WJPA 4L8NA 2RSIA 2JOXA 2EMFA 3ECRA 2M9AA 5A6JA 2EPCA 1GQEA 4O5GA 4DV2E 2L3CA 3HQ1A 2L33A 4F54A 4TUIA 3VYYA 4DR4E 2RS6A 3TQMA 4F9BB 1YUJA 3C6KA 4NZVA 2YTGA 4LF7E 2I9IA 2NUFA 5A2QC 2ZM6E 2EN3A 1EKZA 4NXNE 3P1XA 3J7AG 2YTEA 3OTOE 2EOMA 4OOGC 5LLQA 2JPAA 2YTIA 2UUBE 2L2NA 4TUGA 1WXRA 3HXLA 2FV4B 2YTJA 2EJ4A 2L3JA 4LFCE 1WHNA 5F3WA 2DSYA 2EN1A 2JR1A 2MC5A 1RQ0A 1YYOA 1QNTA 1YFHA 4BMJA 4LF5E 4AQYE 2DRPA 5DNYA 4R2DA 3FIGA 2K4VA 2HJJA 2EMIA 1T4LB 2EN7A 3T1HE 4M9VC 2EP3A 5LL6R 2YT4A 1EH8A 2EPOA 4O4KA 4N4RB 4F6MA 2EE8A 2EPUA 1TN9A 4FK5C 4R2RA 1NCSA 4X64E 1YZ9A 2RTXA 2YWQA 2EOFA 2YPNA 1Z1BA 4DR2E 5AE3A 1PDAA 2ADRA
chains in the Genus database with same CATH topology
1X6EA 2WCC3 2EM5A 2A25A 3M99B 5KL4A 4X9JA 1ZR9A 2YTPA 3MHHC 2EM3A 1A1FA 4IJDA 2HGHA 2EOJA 2CTDA 1JK2A 2EQ1A 2YRMA 2NABA 2EOEA 1BBOA 2ENHA 1X6HA 3MHSC 2LCEA 2D9HA 2EMZA 2EMHA 2EMYA 2J7JA 2ELYA 2YTNA 2EN2A 2EM7A 1YSAC 2WBTA 2EPPA 5KL6A 2EPZA 2EMWA 2I13A 4WSGA 2EORA 2EM2A 2EN4A 2YTFA 1A1LA 2DMIA 1ZAAC 2EL4A 2VRDA 1TF6A 4R2AA 1WJPA 2EOZA 1UBDC 2DLKA 2RSIA 4GZNC 2EMFA 2MKNA 2EN8A 2M9AA 2EPCA 1UN6B 2EL6A 2JP9A 2EOSA 2EMXA 2YSPA 4R2EA 1YUJA 2EN6A 2EOOA 5KL5A 1X5WA 2LV2A 2YTGA 3EPKA 4R2SA 2EMBA 2EOXA 5KL3A 2GHFA 2MDGA 2YRKA 2EOIA 1G2FC 2EN3A 2EOHA 2GLIA 2ENAA 1A1JA 2DGCA 2YTEA 1KJKA 2EQ0A 2EOMA 2CT1A 2EM0A 4R2PA 2JPAA 4R2CA 3EPHA 2YTIA 2BB8A 2LT7A 1YUIA 2EM9A 4F6NA 2MKDA 2EOYA 1X3CA 2LO3A 1RMDA 2EQ3A 2EPRA 2EJ4A 2YTJA 1LLMC 3EPLA 2EMGA 2PRTA 2DLQA 2EM8A 2EN1A 2CSHA 4F2JC 2LVHA 2YSOA 2RPCA 2EM6A 2WBSA 1X6FA 3UK3C 1A1KA 1MEYC 4IS1C 2DRPA 4R2DA 2EMIA 2EOQA 1BB8A 2YU5A 2WBUA 2EN7A 1B69A 1A1GA 1AAYA 4M9VC 2EP3A 1ZU1A 2YTOA 2EPXA 1DGCA 4F6MA 2EE8A 2EMAA 2ELZA 2EPUA 1TF3A 1TN9A 4FK5C 5KL2A 4R2RA 2R1FA 1NCSA 2EL5A 1A1HA 3EPJA 2EOFA 2EMLA 2YRHA 5KL7A 1P47A 2E72A 1A1IA 2YU8A 2EPAA 1Z1BA 1F2IG 1G2DC 2ENCA 4R2QA 1JK1A 2EM4A 2YTQA 2YTDA 3VHTB 2EMKA 2ADRA 2EMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6E A;  2WCC 3;  2EM5 A;  2A25 A;  3M99 B;  5KL4 A;  4X9J A;  1ZR9 A;  2YTP A;  3MHH C;  2EM3 A;  1A1F A;  4IJD A;  2HGH A;  2EOJ A;  2CTD A;  1JK2 A;  2EQ1 A;  2YRM A;  2NAB A;  2EOE A;  1BBO A;  2ENH A;  1X6H A;  3MHS C;  2LCE A;  2D9H A;  2EMZ A;  2EMH A;  2EMY A;  2J7J A;  2ELY A;  2YTN A;  2EN2 A;  2EM7 A;  1YSA C;  2WBT A;  2EPP A;  5KL6 A;  2EPZ A;  2EMW A;  2I13 A;  4WSG A;  2EOR A;  2EM2 A;  2EN4 A;  2YTF A;  1A1L A;  2DMI A;  1ZAA C;  2EL4 A;  2VRD A;  1TF6 A;  4R2A A;  1WJP A;  2EOZ A;  1UBD C;  2DLK A;  2RSI A;  4GZN C;  2EMF A;  2MKN A;  2EN8 A;  2M9A A;  2EPC A;  1UN6 B;  2EL6 A;  2JP9 A;  2EOS A;  2EMX A;  2YSP A;  4R2E A;  1YUJ A;  2EN6 A;  2EOO A;  5KL5 A;  1X5W A;  2LV2 A;  2YTG A;  3EPK A;  4R2S A;  2EMB A;  2EOX A;  5KL3 A;  2GHF A;  2MDG A;  2YRK A;  2EOI A;  1G2F C;  2EN3 A;  2EOH A;  2GLI A;  2ENA A;  1A1J A;  2DGC A;  2YTE A;  1KJK A;  2EQ0 A;  2EOM A;  2CT1 A;  2EM0 A;  4R2P A;  2JPA A;  4R2C A;  3EPH A;  2YTI A;  2BB8 A;  2LT7 A;  1YUI A;  2EM9 A;  4F6N A;  2MKD A;  2EOY A;  1X3C A;  2LO3 A;  1RMD A;  2EQ3 A;  2EPR A;  2EJ4 A;  2YTJ A;  1LLM C;  3EPL A;  2EMG A;  2PRT A;  2DLQ A;  2EM8 A;  2EN1 A;  2CSH A;  4F2J C;  2LVH A;  2YSO A;  2RPC A;  2EM6 A;  2WBS A;  1X6F A;  3UK3 C;  1A1K A;  1MEY C;  4IS1 C;  2DRP A;  4R2D A;  2EMI A;  2EOQ A;  1BB8 A;  2YU5 A;  2WBU A;  2EN7 A;  1B69 A;  1A1G A;  1AAY A;  4M9V C;  2EP3 A;  1ZU1 A;  2YTO A;  2EPX A;  1DGC A;  4F6M A;  2EE8 A;  2EMA A;  2ELZ A;  2EPU A;  1TF3 A;  1TN9 A;  4FK5 C;  5KL2 A;  4R2R A;  2R1F A;  1NCS A;  2EL5 A;  1A1H A;  3EPJ A;  2EOF A;  2EML A;  2YRH A;  5KL7 A;  1P47 A;  2E72 A;  1A1I A;  2YU8 A;  2EPA A;  1Z1B A;  1F2I G;  1G2D C;  2ENC A;  4R2Q A;  1JK1 A;  2EM4 A;  2YTQ A;  2YTD A;  3VHT B;  2EMK A;  2ADR A;  2EMC A; 
#chains in the Genus database with same CATH topology
 4BC7 A;  2LTR A;  4LFB E;  1T39 A;  2NUE A;  2YTP A;  4IJD A;  2HGH A;  2NUG A;  3LML A;  2EQ1 A;  4O24 A;  4ZYD A;  1N3G A;  2EOE A;  3BGH A;  2D9H A;  4LF6 E;  2LTS A;  3BID A;  4J8Z A;  2HC5 A;  4M30 A;  2JY9 A;  2EOR A;  3H09 A;  1YYW A;  1A1L A;  1T4O A;  2EL4 A;  4ZYG A;  2LUP B;  1FJG E;  2EOZ A;  1UBD C;  4K0K E;  4X65 E;  4OX9 E;  2M1S A;  4Q35 B;  2JP9 A;  2V83 A;  1XMQ E;  2YSP A;  4L5N C;  2V8Q B;  1KYQ A;  4R2E A;  3JAM C;  4JYA E;  2UUA E;  2N8X A;  4YHH E;  3QG5 C;  1EH7 A;  3AV0 A;  2YRK A;  3ADG A;  2EOH A;  4DKK A;  2V86 A;  2DGC A;  1NEI A;  1KJK A;  2EPK X;  2CT1 A;  3VYX A;  1YUI A;  2H36 X;  4LU9 A;  2N3G A;  4LF9 E;  5IT9 C;  4LF4 E;  2K7I A;  3ADL A;  4NHR A;  1LLM C;  5TSE A;  3EPL A;  4DR5 E;  4JI0 E;  2B7T A;  2PRT A;  4RHB B;  4B3S E;  1IQS A;  2CSH A;  2EZ6 A;  2JOB A;  4WSP A;  2RPC A;  3J81 C;  2DMY A;  4DUZ E;  4IS1 C;  2YU5 A;  1A1G A;  4B3T E;  4DV5 E;  4JI4 E;  4MLQ A;  2YTO A;  1X49 A;  1N32 E;  1TF3 A;  2EMA A;  2ELZ A;  1HNW E;  5KL2 A;  1N34 E;  1HR0 E;  5AE2 A;  2WZO A;  2KON A;  4BBY A;  3BBG A;  1A1I A;  2YRH A;  5KL7 A;  1P47 A;  1G2D C;  2LJH A;  4BHC A;  1JK1 A;  2YTQ A;  3VHT B;  2EMK A;  3F6G A;  1AAY A;  2EMC A;  3KZY A;  2JXP A;  2RQL A;  2GPI A;  4WYQ B;  4F9C B;  2EM3 A;  1IBM E;  2CTD A;  3J7Y p;  2ODR C;  2UXB E;  2UUC E;  3AUZ A;  1PJS A;  2YRM A;  2L6M A;  4BHB A;  5A6B D;  4YY3 E;  4LTY A;  4DR3 E;  1X6H A;  3MHS C;  2R76 A;  2FGG A;  4DR6 E;  2EN2 A;  1YSA C;  2WBT A;  2EPP A;  2UXD E;  2I13 A;  3C4T A;  4RH8 A;  4WFT A;  2EN4 A;  1ZAA C;  2VRD A;  1GTK A;  5AE1 A;  4R2A A;  3EQ1 A;  1X48 A;  3DF6 A;  5IXM B;  4F9A B;  2RSM A;  4R03 A;  2MKN A;  1UN6 B;  2EL6 A;  4LF8 E;  2LUQ A;  3JU0 A;  3JTZ A;  4NXM E;  2EOS A;  5AC5 A;  4WPY A;  1IBK E;  1IBL E;  3MSW A;  4X8W A;  2L2K B;  3J80 C;  1I94 E;  4KZS A;  2EOO A;  5KL5 A;  1J5E E;  3EPK A;  3DJW A;  2EMB A;  3C6M A;  2DIX A;  2EOX A;  4BCA A;  5KL3 A;  4HEI A;  4JV5 E;  1XMO E;  2EOI A;  1L4S A;  1G2F C;  3OML A;  2GLI A;  1WRJ A;  4GEQ B;  1A1J A;  3IWD A;  2EM0 A;  3IWC A;  4WX9 A;  4R2C A;  3EPH A;  4DV6 E;  1X47 A;  4F6N A;  3ZOQ B;  2VF1 A;  2LMZ A;  2MKD A;  4M2Z A;  2JWO A;  3K6Q A;  1RMD A;  3VK6 A;  2EQ3 A;  3BF2 A;  2EMG A;  1N36 E;  3HPZ A;  2EM8 A;  2VQF E;  4B3R E;  2LBS B;  2LE2 A;  2YSO A;  5LMU E;  2EM6 A;  3UK3 C;  1MEY C;  2VQE E;  1O0W A;  1BB8 A;  1B69 A;  1ZU1 A;  1DGC A;  2G7H A;  4BC9 A;  4ZYH A;  1IMU A;  2KOU A;  4DV7 E;  1A1H A;  2EML A;  2YU8 A;  2EPA A;  2ENC A;  2ODR D;  4JI7 E;  4R2Q A;  2EM4 A;  2LRS A;  3L00 A;  1X6E A;  3HPS A;  2WCC 3;  4X9J A;  3T1Y E;  2M4I A;  2M7Q A;  1A1F A;  2EOJ A;  1HNZ E;  4LFA E;  5IV8 B;  4KWY A;  1QU6 A;  2EPM X;  2JYA A;  3RMP A;  1MGT A;  2NAB A;  2ENH A;  4O43 A;  3KZZ A;  2LCE A;  2EMZ A;  2EPN A;  2CPN A;  2YTN A;  2E5L E;  4JI3 E;  4BS9 A;  4JI1 E;  3ADI A;  4DR7 E;  1GZ6 A;  4WSG A;  5AC4 A;  2YTF A;  2B7V A;  2DMI A;  2EWL A;  1XNQ E;  2UXC E;  1TF6 A;  3THO B;  1DQ3 A;  2B9D A;  5AAS A;  3C4B A;  2DLK A;  2IHR 1;  2UU9 E;  4GZN C;  2EN8 A;  3KWR A;  4WXC A;  1PKP A;  4DMI A;  2L92 A;  4X62 E;  3IWB A;  1RC7 A;  2EMX A;  5A6B A;  2VE7 C;  4R8O A;  2EN6 A;  2BBG A;  2V88 A;  1XNR E;  1X5W A;  2LV2 A;  5A69 A;  4DV0 E;  1HNX E;  4R2S A;  5A6K A;  2GHF A;  1T4N A;  2MDG A;  2MC6 A;  5BR8 E;  1EH6 A;  2ENA A;  2EQ0 A;  2V89 A;  4R2P A;  4Q28 A;  3THN A;  4M0V A;  3HTX A;  4GKJ E;  1BBG A;  2BB8 A;  2LT7 A;  1ZBQ A;  2NA2 A;  2EM9 A;  4I8O A;  2F8B A;  5LMN E;  5ADZ A;  2EOY A;  2KHX A;  4JI6 E;  2MDR A;  1X3C A;  2LO3 A;  3LLH A;  4B3M E;  2EPR A;  2V85 A;  4P7D A;  2L8T A;  2DLQ A;  4DV1 E;  1FKA E;  1DI2 A;  1UIL A;  4MLV A;  2LVH A;  2YZT A;  4HTG A;  4F2J C;  2Q8U A;  2WBS A;  1X6F A;  1A1K A;  4DUY E;  2EOQ A;  2JVA A;  1PJT A;  4WXD A;  2WBU A;  4JI8 E;  4DV4 E;  4KHP E;  1T38 A;  2EPX A;  2V87 A;  2F4V E;  2R1F A;  1PJQ A;  2EL5 A;  2HHH E;  1UHZ A;  3EPJ A;  1SFE A;  1AH5 A;  2E72 A;  2EPL X;  1YPN A;  1F2I G;  5T6J A;  1STU A;  2YTD A;  1SR9 A;  4JI2 E;  1IQO A;  2EM5 A;  2A25 A;  3M99 B;  5KL4 A;  2E1M A;  2FTX B;  5FLX C;  1ZR9 A;  1WHQ A;  3MHH C;  4JI5 E;  5IWA E;  3ADJ A;  1JK2 A;  2RS7 A;  1YYK A;  4GKK E;  4P78 A;  1BBO A;  4ZYE A;  2B3T B;  3F6H A;  2DB2 A;  2EMH A;  2EMY A;  2J7J A;  2ELY A;  2LJU A;  4DV3 E;  4X66 E;  4DR1 E;  1N33 E;  2EM7 A;  1J26 A;  5CFF E;  5A6A A;  2L2M A;  5KL6 A;  2EPZ A;  2EMW A;  2N3H A;  1ZBT A;  2EM2 A;  1WJP A;  4L8N A;  2RSI A;  2JOX A;  2EMF A;  3ECR A;  2M9A A;  5A6J A;  2EPC A;  1GQE A;  4O5G A;  4DV2 E;  2L3C A;  3HQ1 A;  2L33 A;  4F54 A;  4TUI A;  3VYY A;  4DR4 E;  2RS6 A;  3TQM A;  4F9B B;  1YUJ A;  3C6K A;  4NZV A;  2YTG A;  4LF7 E;  2I9I A;  2NUF A;  5A2Q C;  2ZM6 E;  2EN3 A;  1EKZ A;  4NXN E;  3P1X A;  3J7A G;  2YTE A;  3OTO E;  2EOM A;  4OOG C;  5LLQ A;  2JPA A;  2YTI A;  2UUB E;  2L2N A;  4TUG A;  1WXR A;  3HXL A;  2FV4 B;  2YTJ A;  2EJ4 A;  2L3J A;  4LFC E;  1WHN A;  5F3W A;  2DSY A;  2EN1 A;  2JR1 A;  2MC5 A;  1RQ0 A;  1YYO A;  1QNT A;  1YFH A;  4BMJ A;  4LF5 E;  4AQY E;  2DRP A;  5DNY A;  4R2D A;  3FIG A;  2K4V A;  2HJJ A;  2EMI A;  1T4L B;  2EN7 A;  3T1H E;  4M9V C;  2EP3 A;  5LL6 R;  2YT4 A;  1EH8 A;  2EPO A;  4O4K A;  4N4R B;  4F6M A;  2EE8 A;  2EPU A;  1TN9 A;  4FK5 C;  4R2R A;  1NCS A;  4X64 E;  1YZ9 A;  2RTX A;  2YWQ A;  2EOF A;  2YPN A;  1Z1B A;  4DR2 E;  5AE3 A;  1PDA A;  2ADR A; 
#chains in the Genus database with same CATH homology
 1X6E A;  2WCC 3;  2EM5 A;  2A25 A;  3M99 B;  5KL4 A;  4X9J A;  1ZR9 A;  2YTP A;  3MHH C;  2EM3 A;  1A1F A;  4IJD A;  2HGH A;  2EOJ A;  2CTD A;  1JK2 A;  2EQ1 A;  2YRM A;  2NAB A;  2EOE A;  1BBO A;  2ENH A;  1X6H A;  3MHS C;  2LCE A;  2D9H A;  2EMZ A;  2EMH A;  2EMY A;  2J7J A;  2ELY A;  2YTN A;  2EN2 A;  2EM7 A;  1YSA C;  2WBT A;  2EPP A;  5KL6 A;  2EPZ A;  2EMW A;  2I13 A;  4WSG A;  2EOR A;  2EM2 A;  2EN4 A;  2YTF A;  1A1L A;  2DMI A;  1ZAA C;  2EL4 A;  2VRD A;  1TF6 A;  4R2A A;  1WJP A;  2EOZ A;  1UBD C;  2DLK A;  2RSI A;  4GZN C;  2EMF A;  2MKN A;  2EN8 A;  2M9A A;  2EPC A;  1UN6 B;  2EL6 A;  2JP9 A;  2EOS A;  2EMX A;  2YSP A;  4R2E A;  1YUJ A;  2EN6 A;  2EOO A;  5KL5 A;  1X5W A;  2LV2 A;  2YTG A;  3EPK A;  4R2S A;  2EMB A;  2EOX A;  5KL3 A;  2GHF A;  2MDG A;  2YRK A;  2EOI A;  1G2F C;  2EN3 A;  2EOH A;  2GLI A;  2ENA A;  1A1J A;  2DGC A;  2YTE A;  1KJK A;  2EQ0 A;  2EOM A;  2CT1 A;  2EM0 A;  4R2P A;  2JPA A;  4R2C A;  3EPH A;  2YTI A;  2BB8 A;  2LT7 A;  1YUI A;  2EM9 A;  4F6N A;  2MKD A;  2EOY A;  1X3C A;  2LO3 A;  1RMD A;  2EQ3 A;  2EPR A;  2EJ4 A;  2YTJ A;  1LLM C;  3EPL A;  2EMG A;  2PRT A;  2DLQ A;  2EM8 A;  2EN1 A;  2CSH A;  4F2J C;  2LVH A;  2YSO A;  2RPC A;  2EM6 A;  2WBS A;  1X6F A;  3UK3 C;  1A1K A;  1MEY C;  4IS1 C;  2DRP A;  4R2D A;  2EMI A;  2EOQ A;  1BB8 A;  2YU5 A;  2WBU A;  2EN7 A;  1B69 A;  1A1G A;  1AAY A;  4M9V C;  2EP3 A;  1ZU1 A;  2YTO A;  2EPX A;  1DGC A;  4F6M A;  2EE8 A;  2EMA A;  2ELZ A;  2EPU A;  1TF3 A;  1TN9 A;  4FK5 C;  5KL2 A;  4R2R A;  2R1F A;  1NCS A;  2EL5 A;  1A1H A;  3EPJ A;  2EOF A;  2EML A;  2YRH A;  5KL7 A;  1P47 A;  2E72 A;  1A1I A;  2YU8 A;  2EPA A;  1Z1B A;  1F2I G;  1G2D C;  2ENC A;  4R2Q A;  1JK1 A;  2EM4 A;  2YTQ A;  2YTD A;  3VHT B;  2EMK A;  2ADR A;  2EMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...