2LV2A

Solution nmr structure of c2h2-type zinc-fingers 4 and 5 from human insulinoma-associated protein 1 (fragment 424-497), northeast structural genomics consortium target hr7614b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
b'MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulinoma-associated protein 1
publication title Solution NMR structure of C2H2-type Zinc-fingers 4 and 5 from human Insulinoma-associated protein 1 (fragment 424-497), Northeast Structural Genomics Consortium Target HR7614B (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lv2A00
1X5WA 3EPJA 2YSPA 1YUIA 2EMIA 2EOEA 2GLIA 2YTJA 5KL5A 1BB8A 2YRMA 5KL4A 4R2QA 2DLQA 2ELZA 4IS1C 1UN6B 1RMDA 2EN6A 2EQ1A 2EN4A 3VHTB 2LVHA 2EM5A 4GZNC 1JK2A 1A1IA 2MKNA 1ZAAC 1ZU1A 2YTOA 5KL6A 2EM4A 2LO3A 1ZR9A 2EM8A 2JP9A 2WBTA 1UBDC 2RSIA 2EM6A 2ADRA 2EL6A 2EPUA 2MKDA 4FK5C 2EJ4A 2WBUA 2EN2A 2ENCA 1NCSA 2LT7A 2EOYA 1A1HA 2EOFA 2EOHA 2VRDA 2DGCA 1WJPA 2A25A 2E72A 1B69A 2YTPA 1G2FC 4R2DA 2PRTA 2EMYA 2EP3A 2EOZA 1G2DC 2YTQA 2EOXA 2EOSA 2J7JA 4X9JA 1JK1A 2EN3A 2EOOA 2EMFA 3M99B 2EMCA 2EQ0A 2LCEA 1AAYA 1LLMC 1TF6A 1DGCA 2D9HA 2DRPA 2EQ3A 2EMLA 2DLKA 5KL7A 2ELYA 2EOJA 1X6EA 2YRHA 3MHHC 2YU8A 2EMWA 2CTDA 3MHSC 2EPCA 2ENAA 2CSHA 2EPZA 2YTFA 4R2RA 4IJDA 2EPAA 1A1LA 1TF3A 4R2SA 1A1GA 1A1FA 1TN9A 2YU5A 1BBOA 2YSOA 2BB8A 2LV2A 4R2CA 2WBSA 1X6FA 1X6HA 4R2PA 2EN7A 2EM3A 1P47A 2RPCA 1YUJA 2M9AA 2EM2A 1A1KA 2YTEA 1MEYC 3EPKA 3EPLA 4WSGA 2I13A 4F6NA 2YRKA 2DMIA 2EPRA 2EL4A 2NABA 2JPAA 1X3CA 2EORA 4M9VC 2EMXA 2HGHA 2EMHA 2EMZA 2EOIA 1A1JA 1KJKA 3EPHA 2EN1A 4R2EA 1YSAC 2EMKA 2EN8A 1Z1BA 2EMAA 5KL3A 4F6MA 2YTGA 2EM0A 2WCC3 2EM7A 2GHFA 2EMGA 1F2IG 2EPPA 2YTNA 4R2AA 2EPXA 5KL2A 2EOQA 2R1FA 2EOMA 3UK3C 2ENHA 2CT1A 2MDGA 2EM9A 2EL5A 4F2JC 2EMBA 2YTDA 2YTIA 2EE8A
chains in the Genus database with same CATH superfamily
1X5WA 2UXDE 2EMIA 2EOEA 4O5GA 2YRMA 3J80C 4Q35B 5KL4A 2IHR1 4IS1C 1O0WA 1MGTA 1N36E 4LFCE 1RMDA 2EQ1A 2EN4A 1T38A 4JI0E 3VHTB 1NEIA 3THOB 4BHCA 4M2ZA 3TQMA 1ZAAC 1IBLE 4JV5E 3KZZA 2EM8A 2EPUA 1DQ3A 2EJ4A 4LF4E 2ENCA 1XMQE 2EOYA 2EPMX 2EOFA 2VRDA 2A25A 3ADJA 4P78A 1YPNA 4DKKA 1B69A 1G2FC 2YTQA 2EOXA 3IWCA 1JK1A 2EN3A 5LMUE 1RC7A 2LJUA 5AC5A 4K0KE 2EMFA 5T6JA 1UHZA 2L8TA 2EWLA 4DR3E 4BC9A 3BIDA 5TSEA 5LLQA 1LLMC 2D9HA 3ZOQB 2EMLA 3H09A 2DLKA 4F9AB 4DMIA 4X65E 4OX9E 3L00A 4X66E 4WYQB 2V88A 2RS7A 4R2RA 4IJDA 2EPAA 1A1LA 1TF3A 2FGGA 1A1FA 2YU5A 2YSOA 4R2CA 2WBSA 4R2PA 4DV6E 1EH7A 1P47A 1XNRE 4KZSA 2YTEA 1MEYC 4LF6E 2RTXA 3RMPA 2NA2A 5CFFE 3EPLA 4HEIA 1IQOA 2YZTA 2B7TA 1FKAE 3IWBA 2YRKA 4MLQA 1N33E 2BBGA 2L2NA 1X3CA 2ODRD 2JPAA 4J8ZA 2HJJA 1KJKA 1BBGA 1STUA 4LTYA 3EPHA 2L3CA 2EN1A 3VK6A 2EN8A 2LJHA 5A6BA 2MC5A 4AQYE 4JI6E 2WCC3 5IWAE 4JI8E 2GHFA 4NHRA 4ZYGA 3C6MA 1PJTA 2EPXA 1GTKA 2MDRA 2EOQA 4I8OA 2K7IA 1YFHA 2EMBA 2GPIA 4DR7E 1XNQE 2EPNA 2JR1A 4JI4E 2YTJA 1GZ6A 1YYOA 4JI7E 4R2QA 1ZBTA 2UUCE 1UN6B 4O43A 5IXMB 4GZNC 1JK2A 2F8BA 1ZU1A 2VF1A 2EZ6A 2EM4A 3MSWA 1ZR9A 4ZYEA 4O24A 3IWDA 5AE1A 2EL6A 2ADRA 4FK5C 1L4SA 2WBUA 2M1SA 3C4BA 2LT7A 2VQFE 1A1HA 1IBME 1HNWE 1WJPA 2RS6A 2YTPA 2EP3A 3VYYA 4NXNE 3JU0A 4LF5E 4ZYHA 2VQEE 4DV4E 2RSMA 2EQ3A 1AH5A 4JI5E 5KL7A 2ELYA 2EOJA 2V89A 2L2KB 4LFBE 3DJWA 1A1GA 2UXBE 4DV7E 4DR2E 4X62E 2JXPA 3THNA 2EM2A 2V8QB 2Q8UA 2LRSA 4KWYA 4WSGA 2I13A 2CPNA 5LMNE 2NABA 4LF8E 1X49A 4M9VC 4BCAA 2UU9E 1A1JA 4WFTA 4WXDA 2FTXB 5DNYA 1YSAC 2LMZA 3LLHA 1Z1BA 4LF9E 2EMAA 3JTZA 4DV0E 3T1HE 2K4VA 2N3GA 3HPSA 2LBSB 4BMJA 4GEQB 4JI3E 1YYWA 2R1FA 3ADLA 2LUPB 1PJSA 4O4KA 5A6AA 4YHHE 2EL5A 1DGCA 3J7Yp 2EE8A 2DB2A 1YUIA 4BS9A 3OMLA 4M0VA 1XMOE 1EKZA 5AE3A 1T4LB 4BBYA 2DLQA 2EN6A 2ZM6E 3F6HA 2LVHA 1A1IA 2YT4A 2V87A 2JVAA 1HNZE 2MKNA 4Q28A 2DMYA 1KYQA 2YTOA 2JP9A 2WBTA 4DR4E 2RSIA 2EM6A 4F54A 1ZBQA 2MKDA 2R76A 3ECRA 2EN2A 2LE2A 2EPOA 3J81C 4R2DA 2EMYA 2JYAA 4P7DA 4DR1E 3K6QA 4R8OA 4X9JA 4LF7E 3M99B 4GKJE 4DV2E 2EMCA 1T4OA 2JOBA 2JY9A 2LCEA 1TF6A 1WXRA 4WSPA 4YY3E 1PKPA 3F6GA 5AASA 4ZYDA 5A2QC 4DR5E 5ADZA 3MHHC 2YRHA 2L92A 2YU8A 5A6JA 2EPKX 2CTDA 3MHSC 2EPCA 2ENAA 5A6KA 4NXME 2NUGA 2EPZA 2YTFA 1HNXE 4JI1E 4R2SA 1TN9A 4TUGA 1BBOA 2BB8A 1X6FA 1X6HA 2M4IA 2KONA 2EM3A 2V83A 2V86A 3BGHA 4BHBA 2M9AA 1YUJA 2N8XA 1A1KA 1EH8A 4DV5E 1FJGE 4JI2E 4OOGC 4F6NA 2B9DA 2EL4A 2M7QA 2EORA 4L8NA 5A6BD 4WXCA 2EMXA 2HGHA 2EMHA 4WPYA 2NUFA 2JOXA 4TUIA 3AV0A 4F9BB 5KL3A 2G7HA 4F6MA 4WX9A 2EM7A 1J5EE 3EQ1A 2EMGA 2RQLA 1SFEA 2YTNA 4R2AA 4B3ME 2B7VA 2JWOA 5A69A 4B3TE 3UK3C 2ENHA 4LFAE 2CT1A 2MDGA 1PDAA 2YTIA 1QNTA 1X47A 3EPJA 2YSPA 1T39A 3C6KA 3KZYA 2GLIA 2I9IA 1N34E 5KL5A 2ODRC 3T1YE 1BB8A 3J7AG 3OTOE 2YPNA 2ELZA 1WHNA 4B3RE 2EM5A 1GQEA 4X8WA 4RHBB 5KL6A 2L3JA 2LO3A 1UBDC 4MLVA 2F4VE 2FV4B 3VYXA 1NCSA 2LTRA 2EOHA 2DGCA 2E72A 4L5NC 3JAMC 2UXCE 5IT9C 2UUAE 2PRTA 1G2DC 4DV3E 2EOZA 2DSYA 1UILA 2EOSA 2YWQA 1T4NA 2J7JA 4RH8A 1I94E 1YZ9A 1WHQA 2B3TB 2EOOA 1HR0E 4X64E 4DUYE 4DV1E 2L33A 2EQ0A 3AUZA 5BR8E 1AAYA 2DRPA 1YYKA 3QG5C 3P1XA 2MC6A 1X6EA 1EH6A 2WZOA 3HXLA 1N32E 2EMWA 2HC5A 4HTGA 5AC4A 4R03A 1DI2A 2CSHA 3HQ1A 2UUBE 2KOUA 4LU9A 2DIXA 4JYAE 4GKKE 1QU6A 1J26A 3BF2A 1N3GA 2EPLX 2LV2A 5LL6R 1WRJA 2KHXA 2EN7A 4BC7A 2L2MA 2RPCA 4DUZE 3LMLA 5FLXC 3EPKA 3HTXA 2V85A 3ADGA 3FIGA 1IMUA 1SR9A 3C4TA 2DMIA 2EPRA 3HPZA 5F3WA 1X48A 1PJQA 4M30A 2LTSA 3ADIA 2EMZA 2EOIA 2E5LE 2VE7C 3KWRA 4R2EA 2EMKA 2LUQA 2YTGA 2EM0A 3DF6A 2NUEA 4KHPE 5IV8B 1F2IG 1RQ0A 2EPPA 4DR6E 3BBGA 1IBKE 2HHHE 2E1MA 5AE2A 5KL2A 1IQSA 2EOMA 2L6MA 4B3SE 2N3HA 4N4RB 4NZVA 4F9CB 2EM9A 2H36X 4F2JC 2YTDA
chains in the Genus database with same CATH topology
1X5WA 3EPJA 2YSPA 1YUIA 2EMIA 2EOEA 2GLIA 2YTJA 5KL5A 1BB8A 2YRMA 5KL4A 4R2QA 2DLQA 2ELZA 4IS1C 1UN6B 1RMDA 2EN6A 2EQ1A 2EN4A 3VHTB 2LVHA 2EM5A 4GZNC 1JK2A 1A1IA 2MKNA 1ZAAC 1ZU1A 2YTOA 5KL6A 2EM4A 2LO3A 1ZR9A 2EM8A 2JP9A 2WBTA 1UBDC 2RSIA 2EM6A 2ADRA 2EL6A 2EPUA 2MKDA 4FK5C 2EJ4A 2WBUA 2EN2A 2ENCA 1NCSA 2LT7A 2EOYA 1A1HA 2EOFA 2EOHA 2VRDA 2DGCA 1WJPA 2A25A 2E72A 1B69A 2YTPA 1G2FC 4R2DA 2PRTA 2EMYA 2EP3A 2EOZA 1G2DC 2YTQA 2EOXA 2EOSA 2J7JA 4X9JA 1JK1A 2EN3A 2EOOA 2EMFA 3M99B 2EMCA 2EQ0A 2LCEA 1AAYA 1LLMC 1TF6A 1DGCA 2D9HA 2DRPA 2EQ3A 2EMLA 2DLKA 5KL7A 2ELYA 2EOJA 1X6EA 2YRHA 3MHHC 2YU8A 2EMWA 2CTDA 3MHSC 2EPCA 2ENAA 2CSHA 2EPZA 2YTFA 4R2RA 4IJDA 2EPAA 1A1LA 1TF3A 4R2SA 1A1GA 1A1FA 1TN9A 2YU5A 1BBOA 2YSOA 2BB8A 2LV2A 4R2CA 2WBSA 1X6FA 1X6HA 4R2PA 2EN7A 2EM3A 1P47A 2RPCA 1YUJA 2M9AA 2EM2A 1A1KA 2YTEA 1MEYC 3EPKA 3EPLA 4WSGA 2I13A 4F6NA 2YRKA 2DMIA 2EPRA 2EL4A 2NABA 2JPAA 1X3CA 2EORA 4M9VC 2EMXA 2HGHA 2EMHA 2EMZA 2EOIA 1A1JA 1KJKA 3EPHA 2EN1A 4R2EA 1YSAC 2EMKA 2EN8A 1Z1BA 2EMAA 5KL3A 4F6MA 2YTGA 2EM0A 2WCC3 2EM7A 2GHFA 2EMGA 1F2IG 2EPPA 2YTNA 4R2AA 2EPXA 5KL2A 2EOQA 2R1FA 2EOMA 3UK3C 2ENHA 2CT1A 2MDGA 2EM9A 2EL5A 4F2JC 2EMBA 2YTDA 2YTIA 2EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5W A;  3EPJ A;  2YSP A;  1YUI A;  2EMI A;  2EOE A;  2GLI A;  2YTJ A;  5KL5 A;  1BB8 A;  2YRM A;  5KL4 A;  4R2Q A;  2DLQ A;  2ELZ A;  4IS1 C;  1UN6 B;  1RMD A;  2EN6 A;  2EQ1 A;  2EN4 A;  3VHT B;  2LVH A;  2EM5 A;  4GZN C;  1JK2 A;  1A1I A;  2MKN A;  1ZAA C;  1ZU1 A;  2YTO A;  5KL6 A;  2EM4 A;  2LO3 A;  1ZR9 A;  2EM8 A;  2JP9 A;  2WBT A;  1UBD C;  2RSI A;  2EM6 A;  2ADR A;  2EL6 A;  2EPU A;  2MKD A;  4FK5 C;  2EJ4 A;  2WBU A;  2EN2 A;  2ENC A;  1NCS A;  2LT7 A;  2EOY A;  1A1H A;  2EOF A;  2EOH A;  2VRD A;  2DGC A;  1WJP A;  2A25 A;  2E72 A;  1B69 A;  2YTP A;  1G2F C;  4R2D A;  2PRT A;  2EMY A;  2EP3 A;  2EOZ A;  1G2D C;  2YTQ A;  2EOX A;  2EOS A;  2J7J A;  4X9J A;  1JK1 A;  2EN3 A;  2EOO A;  2EMF A;  3M99 B;  2EMC A;  2EQ0 A;  2LCE A;  1AAY A;  1LLM C;  1TF6 A;  1DGC A;  2D9H A;  2DRP A;  2EQ3 A;  2EML A;  2DLK A;  5KL7 A;  2ELY A;  2EOJ A;  1X6E A;  2YRH A;  3MHH C;  2YU8 A;  2EMW A;  2CTD A;  3MHS C;  2EPC A;  2ENA A;  2CSH A;  2EPZ A;  2YTF A;  4R2R A;  4IJD A;  2EPA A;  1A1L A;  1TF3 A;  4R2S A;  1A1G A;  1A1F A;  1TN9 A;  2YU5 A;  1BBO A;  2YSO A;  2BB8 A;  2LV2 A;  4R2C A;  2WBS A;  1X6F A;  1X6H A;  4R2P A;  2EN7 A;  2EM3 A;  1P47 A;  2RPC A;  1YUJ A;  2M9A A;  2EM2 A;  1A1K A;  2YTE A;  1MEY C;  3EPK A;  3EPL A;  4WSG A;  2I13 A;  4F6N A;  2YRK A;  2DMI A;  2EPR A;  2EL4 A;  2NAB A;  2JPA A;  1X3C A;  2EOR A;  4M9V C;  2EMX A;  2HGH A;  2EMH A;  2EMZ A;  2EOI A;  1A1J A;  1KJK A;  3EPH A;  2EN1 A;  4R2E A;  1YSA C;  2EMK A;  2EN8 A;  1Z1B A;  2EMA A;  5KL3 A;  4F6M A;  2YTG A;  2EM0 A;  2WCC 3;  2EM7 A;  2GHF A;  2EMG A;  1F2I G;  2EPP A;  2YTN A;  4R2A A;  2EPX A;  5KL2 A;  2EOQ A;  2R1F A;  2EOM A;  3UK3 C;  2ENH A;  2CT1 A;  2MDG A;  2EM9 A;  2EL5 A;  4F2J C;  2EMB A;  2YTD A;  2YTI A;  2EE8 A; 
#chains in the Genus database with same CATH topology
 1X5W A;  2UXD E;  2EMI A;  2EOE A;  4O5G A;  2YRM A;  3J80 C;  4Q35 B;  5KL4 A;  2IHR 1;  4IS1 C;  1O0W A;  1MGT A;  1N36 E;  4LFC E;  1RMD A;  2EQ1 A;  2EN4 A;  1T38 A;  4JI0 E;  3VHT B;  1NEI A;  3THO B;  4BHC A;  4M2Z A;  3TQM A;  1ZAA C;  1IBL E;  4JV5 E;  3KZZ A;  2EM8 A;  2EPU A;  1DQ3 A;  2EJ4 A;  4LF4 E;  2ENC A;  1XMQ E;  2EOY A;  2EPM X;  2EOF A;  2VRD A;  2A25 A;  3ADJ A;  4P78 A;  1YPN A;  4DKK A;  1B69 A;  1G2F C;  2YTQ A;  2EOX A;  3IWC A;  1JK1 A;  2EN3 A;  5LMU E;  1RC7 A;  2LJU A;  5AC5 A;  4K0K E;  2EMF A;  5T6J A;  1UHZ A;  2L8T A;  2EWL A;  4DR3 E;  4BC9 A;  3BID A;  5TSE A;  5LLQ A;  1LLM C;  2D9H A;  3ZOQ B;  2EML A;  3H09 A;  2DLK A;  4F9A B;  4DMI A;  4X65 E;  4OX9 E;  3L00 A;  4X66 E;  4WYQ B;  2V88 A;  2RS7 A;  4R2R A;  4IJD A;  2EPA A;  1A1L A;  1TF3 A;  2FGG A;  1A1F A;  2YU5 A;  2YSO A;  4R2C A;  2WBS A;  4R2P A;  4DV6 E;  1EH7 A;  1P47 A;  1XNR E;  4KZS A;  2YTE A;  1MEY C;  4LF6 E;  2RTX A;  3RMP A;  2NA2 A;  5CFF E;  3EPL A;  4HEI A;  1IQO A;  2YZT A;  2B7T A;  1FKA E;  3IWB A;  2YRK A;  4MLQ A;  1N33 E;  2BBG A;  2L2N A;  1X3C A;  2ODR D;  2JPA A;  4J8Z A;  2HJJ A;  1KJK A;  1BBG A;  1STU A;  4LTY A;  3EPH A;  2L3C A;  2EN1 A;  3VK6 A;  2EN8 A;  2LJH A;  5A6B A;  2MC5 A;  4AQY E;  4JI6 E;  2WCC 3;  5IWA E;  4JI8 E;  2GHF A;  4NHR A;  4ZYG A;  3C6M A;  1PJT A;  2EPX A;  1GTK A;  2MDR A;  2EOQ A;  4I8O A;  2K7I A;  1YFH A;  2EMB A;  2GPI A;  4DR7 E;  1XNQ E;  2EPN A;  2JR1 A;  4JI4 E;  2YTJ A;  1GZ6 A;  1YYO A;  4JI7 E;  4R2Q A;  1ZBT A;  2UUC E;  1UN6 B;  4O43 A;  5IXM B;  4GZN C;  1JK2 A;  2F8B A;  1ZU1 A;  2VF1 A;  2EZ6 A;  2EM4 A;  3MSW A;  1ZR9 A;  4ZYE A;  4O24 A;  3IWD A;  5AE1 A;  2EL6 A;  2ADR A;  4FK5 C;  1L4S A;  2WBU A;  2M1S A;  3C4B A;  2LT7 A;  2VQF E;  1A1H A;  1IBM E;  1HNW E;  1WJP A;  2RS6 A;  2YTP A;  2EP3 A;  3VYY A;  4NXN E;  3JU0 A;  4LF5 E;  4ZYH A;  2VQE E;  4DV4 E;  2RSM A;  2EQ3 A;  1AH5 A;  4JI5 E;  5KL7 A;  2ELY A;  2EOJ A;  2V89 A;  2L2K B;  4LFB E;  3DJW A;  1A1G A;  2UXB E;  4DV7 E;  4DR2 E;  4X62 E;  2JXP A;  3THN A;  2EM2 A;  2V8Q B;  2Q8U A;  2LRS A;  4KWY A;  4WSG A;  2I13 A;  2CPN A;  5LMN E;  2NAB A;  4LF8 E;  1X49 A;  4M9V C;  4BCA A;  2UU9 E;  1A1J A;  4WFT A;  4WXD A;  2FTX B;  5DNY A;  1YSA C;  2LMZ A;  3LLH A;  1Z1B A;  4LF9 E;  2EMA A;  3JTZ A;  4DV0 E;  3T1H E;  2K4V A;  2N3G A;  3HPS A;  2LBS B;  4BMJ A;  4GEQ B;  4JI3 E;  1YYW A;  2R1F A;  3ADL A;  2LUP B;  1PJS A;  4O4K A;  5A6A A;  4YHH E;  2EL5 A;  1DGC A;  3J7Y p;  2EE8 A;  2DB2 A;  1YUI A;  4BS9 A;  3OML A;  4M0V A;  1XMO E;  1EKZ A;  5AE3 A;  1T4L B;  4BBY A;  2DLQ A;  2EN6 A;  2ZM6 E;  3F6H A;  2LVH A;  1A1I A;  2YT4 A;  2V87 A;  2JVA A;  1HNZ E;  2MKN A;  4Q28 A;  2DMY A;  1KYQ A;  2YTO A;  2JP9 A;  2WBT A;  4DR4 E;  2RSI A;  2EM6 A;  4F54 A;  1ZBQ A;  2MKD A;  2R76 A;  3ECR A;  2EN2 A;  2LE2 A;  2EPO A;  3J81 C;  4R2D A;  2EMY A;  2JYA A;  4P7D A;  4DR1 E;  3K6Q A;  4R8O A;  4X9J A;  4LF7 E;  3M99 B;  4GKJ E;  4DV2 E;  2EMC A;  1T4O A;  2JOB A;  2JY9 A;  2LCE A;  1TF6 A;  1WXR A;  4WSP A;  4YY3 E;  1PKP A;  3F6G A;  5AAS A;  4ZYD A;  5A2Q C;  4DR5 E;  5ADZ A;  3MHH C;  2YRH A;  2L92 A;  2YU8 A;  5A6J A;  2EPK X;  2CTD A;  3MHS C;  2EPC A;  2ENA A;  5A6K A;  4NXM E;  2NUG A;  2EPZ A;  2YTF A;  1HNX E;  4JI1 E;  4R2S A;  1TN9 A;  4TUG A;  1BBO A;  2BB8 A;  1X6F A;  1X6H A;  2M4I A;  2KON A;  2EM3 A;  2V83 A;  2V86 A;  3BGH A;  4BHB A;  2M9A A;  1YUJ A;  2N8X A;  1A1K A;  1EH8 A;  4DV5 E;  1FJG E;  4JI2 E;  4OOG C;  4F6N A;  2B9D A;  2EL4 A;  2M7Q A;  2EOR A;  4L8N A;  5A6B D;  4WXC A;  2EMX A;  2HGH A;  2EMH A;  4WPY A;  2NUF A;  2JOX A;  4TUI A;  3AV0 A;  4F9B B;  5KL3 A;  2G7H A;  4F6M A;  4WX9 A;  2EM7 A;  1J5E E;  3EQ1 A;  2EMG A;  2RQL A;  1SFE A;  2YTN A;  4R2A A;  4B3M E;  2B7V A;  2JWO A;  5A69 A;  4B3T E;  3UK3 C;  2ENH A;  4LFA E;  2CT1 A;  2MDG A;  1PDA A;  2YTI A;  1QNT A;  1X47 A;  3EPJ A;  2YSP A;  1T39 A;  3C6K A;  3KZY A;  2GLI A;  2I9I A;  1N34 E;  5KL5 A;  2ODR C;  3T1Y E;  1BB8 A;  3J7A G;  3OTO E;  2YPN A;  2ELZ A;  1WHN A;  4B3R E;  2EM5 A;  1GQE A;  4X8W A;  4RHB B;  5KL6 A;  2L3J A;  2LO3 A;  1UBD C;  4MLV A;  2F4V E;  2FV4 B;  3VYX A;  1NCS A;  2LTR A;  2EOH A;  2DGC A;  2E72 A;  4L5N C;  3JAM C;  2UXC E;  5IT9 C;  2UUA E;  2PRT A;  1G2D C;  4DV3 E;  2EOZ A;  2DSY A;  1UIL A;  2EOS A;  2YWQ A;  1T4N A;  2J7J A;  4RH8 A;  1I94 E;  1YZ9 A;  1WHQ A;  2B3T B;  2EOO A;  1HR0 E;  4X64 E;  4DUY E;  4DV1 E;  2L33 A;  2EQ0 A;  3AUZ A;  5BR8 E;  1AAY A;  2DRP A;  1YYK A;  3QG5 C;  3P1X A;  2MC6 A;  1X6E A;  1EH6 A;  2WZO A;  3HXL A;  1N32 E;  2EMW A;  2HC5 A;  4HTG A;  5AC4 A;  4R03 A;  1DI2 A;  2CSH A;  3HQ1 A;  2UUB E;  2KOU A;  4LU9 A;  2DIX A;  4JYA E;  4GKK E;  1QU6 A;  1J26 A;  3BF2 A;  1N3G A;  2EPL X;  2LV2 A;  5LL6 R;  1WRJ A;  2KHX A;  2EN7 A;  4BC7 A;  2L2M A;  2RPC A;  4DUZ E;  3LML A;  5FLX C;  3EPK A;  3HTX A;  2V85 A;  3ADG A;  3FIG A;  1IMU A;  1SR9 A;  3C4T A;  2DMI A;  2EPR A;  3HPZ A;  5F3W A;  1X48 A;  1PJQ A;  4M30 A;  2LTS A;  3ADI A;  2EMZ A;  2EOI A;  2E5L E;  2VE7 C;  3KWR A;  4R2E A;  2EMK A;  2LUQ A;  2YTG A;  2EM0 A;  3DF6 A;  2NUE A;  4KHP E;  5IV8 B;  1F2I G;  1RQ0 A;  2EPP A;  4DR6 E;  3BBG A;  1IBK E;  2HHH E;  2E1M A;  5AE2 A;  5KL2 A;  1IQS A;  2EOM A;  2L6M A;  4B3S E;  2N3H A;  4N4R B;  4NZV A;  4F9C B;  2EM9 A;  2H36 X;  4F2J C;  2YTD A; 
#chains in the Genus database with same CATH homology
 1X5W A;  3EPJ A;  2YSP A;  1YUI A;  2EMI A;  2EOE A;  2GLI A;  2YTJ A;  5KL5 A;  1BB8 A;  2YRM A;  5KL4 A;  4R2Q A;  2DLQ A;  2ELZ A;  4IS1 C;  1UN6 B;  1RMD A;  2EN6 A;  2EQ1 A;  2EN4 A;  3VHT B;  2LVH A;  2EM5 A;  4GZN C;  1JK2 A;  1A1I A;  2MKN A;  1ZAA C;  1ZU1 A;  2YTO A;  5KL6 A;  2EM4 A;  2LO3 A;  1ZR9 A;  2EM8 A;  2JP9 A;  2WBT A;  1UBD C;  2RSI A;  2EM6 A;  2ADR A;  2EL6 A;  2EPU A;  2MKD A;  4FK5 C;  2EJ4 A;  2WBU A;  2EN2 A;  2ENC A;  1NCS A;  2LT7 A;  2EOY A;  1A1H A;  2EOF A;  2EOH A;  2VRD A;  2DGC A;  1WJP A;  2A25 A;  2E72 A;  1B69 A;  2YTP A;  1G2F C;  4R2D A;  2PRT A;  2EMY A;  2EP3 A;  2EOZ A;  1G2D C;  2YTQ A;  2EOX A;  2EOS A;  2J7J A;  4X9J A;  1JK1 A;  2EN3 A;  2EOO A;  2EMF A;  3M99 B;  2EMC A;  2EQ0 A;  2LCE A;  1AAY A;  1LLM C;  1TF6 A;  1DGC A;  2D9H A;  2DRP A;  2EQ3 A;  2EML A;  2DLK A;  5KL7 A;  2ELY A;  2EOJ A;  1X6E A;  2YRH A;  3MHH C;  2YU8 A;  2EMW A;  2CTD A;  3MHS C;  2EPC A;  2ENA A;  2CSH A;  2EPZ A;  2YTF A;  4R2R A;  4IJD A;  2EPA A;  1A1L A;  1TF3 A;  4R2S A;  1A1G A;  1A1F A;  1TN9 A;  2YU5 A;  1BBO A;  2YSO A;  2BB8 A;  2LV2 A;  4R2C A;  2WBS A;  1X6F A;  1X6H A;  4R2P A;  2EN7 A;  2EM3 A;  1P47 A;  2RPC A;  1YUJ A;  2M9A A;  2EM2 A;  1A1K A;  2YTE A;  1MEY C;  3EPK A;  3EPL A;  4WSG A;  2I13 A;  4F6N A;  2YRK A;  2DMI A;  2EPR A;  2EL4 A;  2NAB A;  2JPA A;  1X3C A;  2EOR A;  4M9V C;  2EMX A;  2HGH A;  2EMH A;  2EMZ A;  2EOI A;  1A1J A;  1KJK A;  3EPH A;  2EN1 A;  4R2E A;  1YSA C;  2EMK A;  2EN8 A;  1Z1B A;  2EMA A;  5KL3 A;  4F6M A;  2YTG A;  2EM0 A;  2WCC 3;  2EM7 A;  2GHF A;  2EMG A;  1F2I G;  2EPP A;  2YTN A;  4R2A A;  2EPX A;  5KL2 A;  2EOQ A;  2R1F A;  2EOM A;  3UK3 C;  2ENH A;  2CT1 A;  2MDG A;  2EM9 A;  2EL5 A;  4F2J C;  2EMB A;  2YTD A;  2YTI A;  2EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...