2LV2A

Solution nmr structure of c2h2-type zinc-fingers 4 and 5 from human insulinoma-associated protein 1 (fragment 424-497), northeast structural genomics consortium target hr7614b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of C2H2-type Zinc-fingers 4 and 5 from human Insulinoma-associated protein 1 (fragment 424-497), Northeast Structural Genomics Consortium Target HR7614B (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Insulinoma-associated protein 1
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lv2A00
2HGHA 3EPHA 2EJ4A 3MHHC 2EN4A 1X6FA 2EPUA 1LLMC 2D9HA 2EMXA 2YRHA 3EPJA 2EMBA 2ELZA 1X5WA 1JK2A 1UBDC 2R1FA 2EN2A 2YSPA 1JK1A 2EM3A 4WSGA 2LVHA 1F2IG 2EOEA 2EM8A 5KL4A 2DGCA 2YTQA 3VHTB 2YRMA 1TN9A 5KL7A 1ZAAC 5KL2A 2YTEA 3EPLA 2MKDA 2YTGA 2WBUA 2EM4A 5KL6A 1UN6B 2ENCA 3M99B 3EPKA 2YTIA 2EOXA 1MEYC 1A1GA 1AAYA 4R2AA 2PRTA 4F6NA 2YTDA 2EN8A 2EOSA 2EL6A 2DLKA 1B69A 2M9AA 1TF3A 2EMZA 4X9JA 2BB8A 1G2FC 2ADRA 2WBTA 1A1IA 2EOHA 2EOFA 1KJKA 4IS1C 1X3CA 1Z1BA 3UK3C 4R2CA 2EMHA 2EPPA 2RSIA 2EM2A 5KL3A 1A1JA 1YUIA 2LV2A 2DMIA 2EOJA 2EPCA 2EPAA 2EMAA 2LO3A 2EN7A 2EQ1A 2YSOA 2EMIA 2EPXA 2WCC3 1A1KA 1X6HA 2A25A 2VRDA 4M9VC 2CSHA 2EMCA 1DGCA 4R2PA 2EQ0A 4FK5C 2EP3A 1A1FA 2EMLA 2EMWA 2ENHA 2EOYA 2MDGA 4R2RA 2EPRA 4F2JC 1RMDA 2CTDA 2YTJA 4IJDA 2YTPA 1WJPA 1A1LA 2EMYA 2EQ3A 2EM9A 2YTNA 4R2EA 2EL5A 2EL4A 2YU5A 2EOZA 2EE8A 2EOMA 2EPZA 2RPCA 2EM7A 2EN6A 2LT7A 2EM6A 3MHSC 1X6EA 2CT1A 2EMFA 2JP9A 2EMKA 2DLQA 2EOIA 2WBSA 2YTFA 2EN3A 2EOQA 4R2QA 1BBOA 1BB8A 2LCEA 2J7JA 2EOOA 1NCSA 5KL5A 2EM0A 2YRKA 4GZNC 1A1HA 2MKNA 2NABA 2I13A 4R2SA 2E72A 2YTOA 4F6MA 1G2DC 2YU8A 1P47A 1YUJA 2DRPA 1ZR9A 2EM5A 2GHFA 2EMGA 1TF6A 2ELYA 1YSAC 2JPAA 2EORA 4R2DA 2GLIA 1ZU1A 2ENAA 2EN1A
chains in the Genus database with same CATH superfamily
2D9HA 3IWBA 3EQ1A 5A2QC 4K0KE 1RQ0A 3LMLA 4KZSA 1UBDC 1JK1A 4DR7E 4O4KA 2EOEA 1EH7A 1XMQE 5KL4A 2DGCA 2YTQA 3VHTB 4DMIA 1X47A 4DKKA 1PJTA 5ADZA 2LRSA 2GPIA 5T6JA 2M1SA 5BR8E 4YY3E 2WBUA 3M99B 2YTIA 1A1GA 2BBGA 4R2AA 2RTXA 2EL6A 2MC5A 4Q35B 4R03A 2L33A 2BB8A 5AE3A 2EOHA 2EOFA 2KOUA 4IS1C 1X3CA 1Z1BA 4GKJE 1KJKA 4JI0E 1UHZA 1A1JA 4BC9A 5IXMB 2V87A 1IQSA 1DQ3A 4TUGA 1FJGE 5AE2A 5A69A 1T4OA 2VF1A 2VRDA 3J81C 1BBGA 3HPSA 4DV0E 2LJUA 4NXME 2JXPA 1T39A 4R2RA 1L4SA 2ZM6E 3BIDA 1RMDA 4BBYA 4DUZE 2UXDE 5FLXC 1GZ6A 1WJPA 1STUA 4I8OA 1T38A 4DR3E 1AH5A 2EWLA 4WXCA 2EOMA 2EOZA 2EPZA 4O43A 3K6QA 3ADJA 2LE2A 1X6EA 2CT1A 2EMFA 1HNXE 4F9CB 3HTXA 4ZYDA 2EOIA 1N33E 5LMUE 2LCEA 2J7JA 1NCSA 4F9BB 1XNRE 2N3GA 2KONA 2V8QB 2JR1A 5LL6R 4R2SA 4ZYGA 5LLQA 4F6MA 2HJJA 2F4VE 4B3SE 1P47A 1HNZE 2LJHA 2DRPA 1KYQA 2IHR1 2L3JA 2EMGA 1IBKE 1TF6A 2ELYA 2JPAA 1EKZA 2LTSA 4FK5C 4DV3E 2RS6A 4NHRA 1EH8A 1FKAE 4LFCE 3EPHA 1YZ9A 2EPUA 1LLMC 2K7IA 4JI2E 2E1MA 2V86A 2EPLX 2UXBE 3F6GA 2EN2A 5A6KA 4DV6E 2EM3A 2V83A 2LVHA 3ZOQB 3J80C 2EM8A 5AC4A 1PJQA 3KWRA 1TN9A 3BF2A 2VQFE 2YTEA 4BHBA 3THNA 4LF6E 5AE1A 1YYWA 2YTGA 1N34E 2CPNA 4LU9A 4LF4E 3EPKA 3JTZA 1MEYC 2EOXA 2PRTA 2YTDA 2EN8A 3AV0A 4R8OA 4TUIA 4F54A 3RMPA 3OTOE 2E5LE 1B69A 4X9JA 3T1HE 3F6HA 2B3TB 4LF5E 2ADRA 1A1IA 1YYKA 4DV2E 3UK3C 4DV4E 1J26A 2RQLA 2MDRA 3BBGA 2EM2A 1RC7A 3VYYA 1YUIA 2LV2A 2EPCA 4AQYE 2NUEA 2EQ1A 2YSOA 2EMIA 1X6HA 1YPNA 2A25A 1A1FA 2L8TA 1IBLE 4IJDA 4B3ME 1EH6A 2YTPA 2L2NA 4JV5E 2F8BA 2UUBE 4GKKE 4R2EA 3C6MA 3AUZA 1PDAA 5IT9C 2EL5A 3KZYA 2EL4A 2RPCA 2YPNA 1N32E 3JU0A 4RH8A 3MHSC 2ODRC 2NUFA 3VK6A 4BCAA 3DF6A 2H36X 1SR9A 4L5NC 5AC5A 2EN3A 2EOQA 4X8WA 4YHHE 4R2QA 3J7AG 4WX9A 4JI5E 5DNYA 2JOXA 4GZNC 1X48A 3JAMC 2E72A 2YTOA 4DR4E 1G2DC 3BGHA 1PJSA 1YUJA 1IQOA 2EM5A 2GHFA 2I9IA 4BC7A 2HC5A 4WYQB 2L2MA 1IBME 1YSAC 2EPKX 2EORA 3C4BA 2GLIA 2L92A 4JI1E 2DSYA 4B3TE 2EN4A 1X6FA 2EMXA 4JI3E 3EPJA 2EMBA 2UXCE 4O5GA 1XNQE 2YSPA 2L2KB 4X66E 2EPMX 4JI6E 2EZ6A 2JWOA 2LUQA 5A6JA 1NEIA 2YRMA 2B7TA 4DV7E 5KL7A 1T4LB 1ZAAC 5KL2A 4BS9A 3EPLA 4MLQA 2LMZA 1UN6B 2EM4A 5KL6A 2UUCE 2B9DA 3THOB 2LBSB 1WHNA 1AAYA 5LMNE 5A6BD 1I94E 4DV1E 4F6NA 1J5EE 3J7Yp 4LFBE 4X64E 4DR2E 2DLKA 5A6AA 2YZTA 4X62E 4OOGC 4M2ZA 1T4NA 4M0VA 4N4RB 1WRJA 4R2CA 2EMHA 5KL3A 2YWQA 4BHCA 2NUGA 2EOJA 2UU9E 4ZYEA 3HPZA 4P78A 2EPXA 4NZVA 4NXNE 4M9VC 4R2PA 2EQ0A 2EPNA 5IV8B 2EMLA 2JVAA 2MDGA 2Q8UA 2YTJA 2M4IA 4KHPE 4B3RE 2YTNA 2R76A 3ECRA 4WSPA 2WZOA 2HHHE 2EM7A 2KHXA 5AASA 2EN6A 2LT7A 2UUAE 1SFEA 2EMKA 2JYAA 4MLVA 1HR0E 3ADGA 4DR6E 4LF8E 2K4VA 3ADLA 2B7VA 1BB8A 5A6BA 5IWAE 5KL5A 3FIGA 2EM0A 2YRKA 2MKNA 4DV5E 3IWCA 2FGGA 1X49A 4DR5E 1YYOA 1DI2A 2DIXA 4DR1E 1ZR9A 3OMLA 4P7DA 3QG5C 1ZBQA 2DB2A 4LTYA 2N3HA 2YT4A 2ENAA 4JI7E 2EN1A 2HGHA 2EJ4A 3MHHC 2YRHA 4WFTA 2RSMA 2ELZA 1X5WA 4LF7E 1JK2A 1GQEA 2R1FA 2DMYA 4GEQB 4WSGA 1F2IG 2N8XA 4Q28A 4BMJA 4O24A 1QNTA 1WXRA 3IWDA 2V89A 2LUPB 4DUYE 4JI4E 3DJWA 4HEIA 2MC6A 2MKDA 1WHQA 2ENCA 1GTKA 2ODRD 3C6KA 3MSWA 3HQ1A 4WXDA 1UILA 2EOSA 5TSEA 2M9AA 1XMOE 1TF3A 2EMZA 3L00A 2V85A 3KZZA 1G2FC 2WBTA 1ZBTA 2RS7A 1IMUA 3T1YE 2EPPA 1QU6A 2RSIA 4RHBB 2L6MA 2DMIA 4X65E 2EPAA 2EMAA 2LO3A 2EN7A 2WCC3 1A1KA 2EPOA 1MGTA 3ADIA 3P1XA 4WPYA 3TQMA 5CFFE 2CSHA 2EMCA 1DGCA 2VQEE 1PKPA 2EP3A 2EOYA 2EMWA 2ENHA 4L8NA 2FTXB 2EPRA 4F2JC 3H09A 2CTDA 1A1LA 2EMYA 2EQ3A 3LLHA 2EM9A 2G7HA 2YU5A 2NA2A 2L3CA 4LF9E 3VYXA 2EE8A 2JOBA 4M30A 1O0WA 2JY9A 2EM6A 2V88A 4F9AB 5F3WA 2JP9A 1N36E 2FV4B 2DLQA 2M7QA 2LTRA 4HTGA 2WBSA 2YTFA 1BBOA 1HNWE 2EOOA 3C4TA 1YFHA 4JI8E 4JYAE 4J8ZA 1A1HA 2NABA 2I13A 4LFAE 4KWYA 1N3GA 2YU8A 3HXLA 2VE7C 4ZYHA 4R2DA 1ZU1A 4OX9E
chains in the Genus database with same CATH topology
2HGHA 3EPHA 2EJ4A 3MHHC 2EN4A 1X6FA 2EPUA 1LLMC 2D9HA 2EMXA 2YRHA 3EPJA 2EMBA 2ELZA 1X5WA 1JK2A 1UBDC 2R1FA 2EN2A 2YSPA 1JK1A 2EM3A 4WSGA 2LVHA 1F2IG 2EOEA 2EM8A 5KL4A 2DGCA 2YTQA 3VHTB 2YRMA 1TN9A 5KL7A 1ZAAC 5KL2A 2YTEA 3EPLA 2MKDA 2YTGA 2WBUA 2EM4A 5KL6A 1UN6B 2ENCA 3M99B 3EPKA 2YTIA 2EOXA 1MEYC 1A1GA 1AAYA 4R2AA 2PRTA 4F6NA 2YTDA 2EN8A 2EOSA 2EL6A 2DLKA 1B69A 2M9AA 1TF3A 2EMZA 4X9JA 2BB8A 1G2FC 2ADRA 2WBTA 1A1IA 2EOHA 2EOFA 1KJKA 4IS1C 1X3CA 1Z1BA 3UK3C 4R2CA 2EMHA 2EPPA 2RSIA 2EM2A 5KL3A 1A1JA 1YUIA 2LV2A 2DMIA 2EOJA 2EPCA 2EPAA 2EMAA 2LO3A 2EN7A 2EQ1A 2YSOA 2EMIA 2EPXA 2WCC3 1A1KA 1X6HA 2A25A 2VRDA 4M9VC 2CSHA 2EMCA 1DGCA 4R2PA 2EQ0A 4FK5C 2EP3A 1A1FA 2EMLA 2EMWA 2ENHA 2EOYA 2MDGA 4R2RA 2EPRA 4F2JC 1RMDA 2CTDA 2YTJA 4IJDA 2YTPA 1WJPA 1A1LA 2EMYA 2EQ3A 2EM9A 2YTNA 4R2EA 2EL5A 2EL4A 2YU5A 2EOZA 2EE8A 2EOMA 2EPZA 2RPCA 2EM7A 2EN6A 2LT7A 2EM6A 3MHSC 1X6EA 2CT1A 2EMFA 2JP9A 2EMKA 2DLQA 2EOIA 2WBSA 2YTFA 2EN3A 2EOQA 4R2QA 1BBOA 1BB8A 2LCEA 2J7JA 2EOOA 1NCSA 5KL5A 2EM0A 2YRKA 4GZNC 1A1HA 2MKNA 2NABA 2I13A 4R2SA 2E72A 2YTOA 4F6MA 1G2DC 2YU8A 1P47A 1YUJA 2DRPA 1ZR9A 2EM5A 2GHFA 2EMGA 1TF6A 2ELYA 1YSAC 2JPAA 2EORA 4R2DA 2GLIA 1ZU1A 2ENAA 2EN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGH A;  3EPH A;  2EJ4 A;  3MHH C;  2EN4 A;  1X6F A;  2EPU A;  1LLM C;  2D9H A;  2EMX A;  2YRH A;  3EPJ A;  2EMB A;  2ELZ A;  1X5W A;  1JK2 A;  1UBD C;  2R1F A;  2EN2 A;  2YSP A;  1JK1 A;  2EM3 A;  4WSG A;  2LVH A;  1F2I G;  2EOE A;  2EM8 A;  5KL4 A;  2DGC A;  2YTQ A;  3VHT B;  2YRM A;  1TN9 A;  5KL7 A;  1ZAA C;  5KL2 A;  2YTE A;  3EPL A;  2MKD A;  2YTG A;  2WBU A;  2EM4 A;  5KL6 A;  1UN6 B;  2ENC A;  3M99 B;  3EPK A;  2YTI A;  2EOX A;  1MEY C;  1A1G A;  1AAY A;  4R2A A;  2PRT A;  4F6N A;  2YTD A;  2EN8 A;  2EOS A;  2EL6 A;  2DLK A;  1B69 A;  2M9A A;  1TF3 A;  2EMZ A;  4X9J A;  2BB8 A;  1G2F C;  2ADR A;  2WBT A;  1A1I A;  2EOH A;  2EOF A;  1KJK A;  4IS1 C;  1X3C A;  1Z1B A;  3UK3 C;  4R2C A;  2EMH A;  2EPP A;  2RSI A;  2EM2 A;  5KL3 A;  1A1J A;  1YUI A;  2LV2 A;  2DMI A;  2EOJ A;  2EPC A;  2EPA A;  2EMA A;  2LO3 A;  2EN7 A;  2EQ1 A;  2YSO A;  2EMI A;  2EPX A;  2WCC 3;  1A1K A;  1X6H A;  2A25 A;  2VRD A;  4M9V C;  2CSH A;  2EMC A;  1DGC A;  4R2P A;  2EQ0 A;  4FK5 C;  2EP3 A;  1A1F A;  2EML A;  2EMW A;  2ENH A;  2EOY A;  2MDG A;  4R2R A;  2EPR A;  4F2J C;  1RMD A;  2CTD A;  2YTJ A;  4IJD A;  2YTP A;  1WJP A;  1A1L A;  2EMY A;  2EQ3 A;  2EM9 A;  2YTN A;  4R2E A;  2EL5 A;  2EL4 A;  2YU5 A;  2EOZ A;  2EE8 A;  2EOM A;  2EPZ A;  2RPC A;  2EM7 A;  2EN6 A;  2LT7 A;  2EM6 A;  3MHS C;  1X6E A;  2CT1 A;  2EMF A;  2JP9 A;  2EMK A;  2DLQ A;  2EOI A;  2WBS A;  2YTF A;  2EN3 A;  2EOQ A;  4R2Q A;  1BBO A;  1BB8 A;  2LCE A;  2J7J A;  2EOO A;  1NCS A;  5KL5 A;  2EM0 A;  2YRK A;  4GZN C;  1A1H A;  2MKN A;  2NAB A;  2I13 A;  4R2S A;  2E72 A;  2YTO A;  4F6M A;  1G2D C;  2YU8 A;  1P47 A;  1YUJ A;  2DRP A;  1ZR9 A;  2EM5 A;  2GHF A;  2EMG A;  1TF6 A;  2ELY A;  1YSA C;  2JPA A;  2EOR A;  4R2D A;  2GLI A;  1ZU1 A;  2ENA A;  2EN1 A; 
#chains in the Genus database with same CATH topology
 2D9H A;  3IWB A;  3EQ1 A;  5A2Q C;  4K0K E;  1RQ0 A;  3LML A;  4KZS A;  1UBD C;  1JK1 A;  4DR7 E;  4O4K A;  2EOE A;  1EH7 A;  1XMQ E;  5KL4 A;  2DGC A;  2YTQ A;  3VHT B;  4DMI A;  1X47 A;  4DKK A;  1PJT A;  5ADZ A;  2LRS A;  2GPI A;  5T6J A;  2M1S A;  5BR8 E;  4YY3 E;  2WBU A;  3M99 B;  2YTI A;  1A1G A;  2BBG A;  4R2A A;  2RTX A;  2EL6 A;  2MC5 A;  4Q35 B;  4R03 A;  2L33 A;  2BB8 A;  5AE3 A;  2EOH A;  2EOF A;  2KOU A;  4IS1 C;  1X3C A;  1Z1B A;  4GKJ E;  1KJK A;  4JI0 E;  1UHZ A;  1A1J A;  4BC9 A;  5IXM B;  2V87 A;  1IQS A;  1DQ3 A;  4TUG A;  1FJG E;  5AE2 A;  5A69 A;  1T4O A;  2VF1 A;  2VRD A;  3J81 C;  1BBG A;  3HPS A;  4DV0 E;  2LJU A;  4NXM E;  2JXP A;  1T39 A;  4R2R A;  1L4S A;  2ZM6 E;  3BID A;  1RMD A;  4BBY A;  4DUZ E;  2UXD E;  5FLX C;  1GZ6 A;  1WJP A;  1STU A;  4I8O A;  1T38 A;  4DR3 E;  1AH5 A;  2EWL A;  4WXC A;  2EOM A;  2EOZ A;  2EPZ A;  4O43 A;  3K6Q A;  3ADJ A;  2LE2 A;  1X6E A;  2CT1 A;  2EMF A;  1HNX E;  4F9C B;  3HTX A;  4ZYD A;  2EOI A;  1N33 E;  5LMU E;  2LCE A;  2J7J A;  1NCS A;  4F9B B;  1XNR E;  2N3G A;  2KON A;  2V8Q B;  2JR1 A;  5LL6 R;  4R2S A;  4ZYG A;  5LLQ A;  4F6M A;  2HJJ A;  2F4V E;  4B3S E;  1P47 A;  1HNZ E;  2LJH A;  2DRP A;  1KYQ A;  2IHR 1;  2L3J A;  2EMG A;  1IBK E;  1TF6 A;  2ELY A;  2JPA A;  1EKZ A;  2LTS A;  4FK5 C;  4DV3 E;  2RS6 A;  4NHR A;  1EH8 A;  1FKA E;  4LFC E;  3EPH A;  1YZ9 A;  2EPU A;  1LLM C;  2K7I A;  4JI2 E;  2E1M A;  2V86 A;  2EPL X;  2UXB E;  3F6G A;  2EN2 A;  5A6K A;  4DV6 E;  2EM3 A;  2V83 A;  2LVH A;  3ZOQ B;  3J80 C;  2EM8 A;  5AC4 A;  1PJQ A;  3KWR A;  1TN9 A;  3BF2 A;  2VQF E;  2YTE A;  4BHB A;  3THN A;  4LF6 E;  5AE1 A;  1YYW A;  2YTG A;  1N34 E;  2CPN A;  4LU9 A;  4LF4 E;  3EPK A;  3JTZ A;  1MEY C;  2EOX A;  2PRT A;  2YTD A;  2EN8 A;  3AV0 A;  4R8O A;  4TUI A;  4F54 A;  3RMP A;  3OTO E;  2E5L E;  1B69 A;  4X9J A;  3T1H E;  3F6H A;  2B3T B;  4LF5 E;  2ADR A;  1A1I A;  1YYK A;  4DV2 E;  3UK3 C;  4DV4 E;  1J26 A;  2RQL A;  2MDR A;  3BBG A;  2EM2 A;  1RC7 A;  3VYY A;  1YUI A;  2LV2 A;  2EPC A;  4AQY E;  2NUE A;  2EQ1 A;  2YSO A;  2EMI A;  1X6H A;  1YPN A;  2A25 A;  1A1F A;  2L8T A;  1IBL E;  4IJD A;  4B3M E;  1EH6 A;  2YTP A;  2L2N A;  4JV5 E;  2F8B A;  2UUB E;  4GKK E;  4R2E A;  3C6M A;  3AUZ A;  1PDA A;  5IT9 C;  2EL5 A;  3KZY A;  2EL4 A;  2RPC A;  2YPN A;  1N32 E;  3JU0 A;  4RH8 A;  3MHS C;  2ODR C;  2NUF A;  3VK6 A;  4BCA A;  3DF6 A;  2H36 X;  1SR9 A;  4L5N C;  5AC5 A;  2EN3 A;  2EOQ A;  4X8W A;  4YHH E;  4R2Q A;  3J7A G;  4WX9 A;  4JI5 E;  5DNY A;  2JOX A;  4GZN C;  1X48 A;  3JAM C;  2E72 A;  2YTO A;  4DR4 E;  1G2D C;  3BGH A;  1PJS A;  1YUJ A;  1IQO A;  2EM5 A;  2GHF A;  2I9I A;  4BC7 A;  2HC5 A;  4WYQ B;  2L2M A;  1IBM E;  1YSA C;  2EPK X;  2EOR A;  3C4B A;  2GLI A;  2L92 A;  4JI1 E;  2DSY A;  4B3T E;  2EN4 A;  1X6F A;  2EMX A;  4JI3 E;  3EPJ A;  2EMB A;  2UXC E;  4O5G A;  1XNQ E;  2YSP A;  2L2K B;  4X66 E;  2EPM X;  4JI6 E;  2EZ6 A;  2JWO A;  2LUQ A;  5A6J A;  1NEI A;  2YRM A;  2B7T A;  4DV7 E;  5KL7 A;  1T4L B;  1ZAA C;  5KL2 A;  4BS9 A;  3EPL A;  4MLQ A;  2LMZ A;  1UN6 B;  2EM4 A;  5KL6 A;  2UUC E;  2B9D A;  3THO B;  2LBS B;  1WHN A;  1AAY A;  5LMN E;  5A6B D;  1I94 E;  4DV1 E;  4F6N A;  1J5E E;  3J7Y p;  4LFB E;  4X64 E;  4DR2 E;  2DLK A;  5A6A A;  2YZT A;  4X62 E;  4OOG C;  4M2Z A;  1T4N A;  4M0V A;  4N4R B;  1WRJ A;  4R2C A;  2EMH A;  5KL3 A;  2YWQ A;  4BHC A;  2NUG A;  2EOJ A;  2UU9 E;  4ZYE A;  3HPZ A;  4P78 A;  2EPX A;  4NZV A;  4NXN E;  4M9V C;  4R2P A;  2EQ0 A;  2EPN A;  5IV8 B;  2EML A;  2JVA A;  2MDG A;  2Q8U A;  2YTJ A;  2M4I A;  4KHP E;  4B3R E;  2YTN A;  2R76 A;  3ECR A;  4WSP A;  2WZO A;  2HHH E;  2EM7 A;  2KHX A;  5AAS A;  2EN6 A;  2LT7 A;  2UUA E;  1SFE A;  2EMK A;  2JYA A;  4MLV A;  1HR0 E;  3ADG A;  4DR6 E;  4LF8 E;  2K4V A;  3ADL A;  2B7V A;  1BB8 A;  5A6B A;  5IWA E;  5KL5 A;  3FIG A;  2EM0 A;  2YRK A;  2MKN A;  4DV5 E;  3IWC A;  2FGG A;  1X49 A;  4DR5 E;  1YYO A;  1DI2 A;  2DIX A;  4DR1 E;  1ZR9 A;  3OML A;  4P7D A;  3QG5 C;  1ZBQ A;  2DB2 A;  4LTY A;  2N3H A;  2YT4 A;  2ENA A;  4JI7 E;  2EN1 A;  2HGH A;  2EJ4 A;  3MHH C;  2YRH A;  4WFT A;  2RSM A;  2ELZ A;  1X5W A;  4LF7 E;  1JK2 A;  1GQE A;  2R1F A;  2DMY A;  4GEQ B;  4WSG A;  1F2I G;  2N8X A;  4Q28 A;  4BMJ A;  4O24 A;  1QNT A;  1WXR A;  3IWD A;  2V89 A;  2LUP B;  4DUY E;  4JI4 E;  3DJW A;  4HEI A;  2MC6 A;  2MKD A;  1WHQ A;  2ENC A;  1GTK A;  2ODR D;  3C6K A;  3MSW A;  3HQ1 A;  4WXD A;  1UIL A;  2EOS A;  5TSE A;  2M9A A;  1XMO E;  1TF3 A;  2EMZ A;  3L00 A;  2V85 A;  3KZZ A;  1G2F C;  2WBT A;  1ZBT A;  2RS7 A;  1IMU A;  3T1Y E;  2EPP A;  1QU6 A;  2RSI A;  4RHB B;  2L6M A;  2DMI A;  4X65 E;  2EPA A;  2EMA A;  2LO3 A;  2EN7 A;  2WCC 3;  1A1K A;  2EPO A;  1MGT A;  3ADI A;  3P1X A;  4WPY A;  3TQM A;  5CFF E;  2CSH A;  2EMC A;  1DGC A;  2VQE E;  1PKP A;  2EP3 A;  2EOY A;  2EMW A;  2ENH A;  4L8N A;  2FTX B;  2EPR A;  4F2J C;  3H09 A;  2CTD A;  1A1L A;  2EMY A;  2EQ3 A;  3LLH A;  2EM9 A;  2G7H A;  2YU5 A;  2NA2 A;  2L3C A;  4LF9 E;  3VYX A;  2EE8 A;  2JOB A;  4M30 A;  1O0W A;  2JY9 A;  2EM6 A;  2V88 A;  4F9A B;  5F3W A;  2JP9 A;  1N36 E;  2FV4 B;  2DLQ A;  2M7Q A;  2LTR A;  4HTG A;  2WBS A;  2YTF A;  1BBO A;  1HNW E;  2EOO A;  3C4T A;  1YFH A;  4JI8 E;  4JYA E;  4J8Z A;  1A1H A;  2NAB A;  2I13 A;  4LFA E;  4KWY A;  1N3G A;  2YU8 A;  3HXL A;  2VE7 C;  4ZYH A;  4R2D A;  1ZU1 A;  4OX9 E; 
#chains in the Genus database with same CATH homology
 2HGH A;  3EPH A;  2EJ4 A;  3MHH C;  2EN4 A;  1X6F A;  2EPU A;  1LLM C;  2D9H A;  2EMX A;  2YRH A;  3EPJ A;  2EMB A;  2ELZ A;  1X5W A;  1JK2 A;  1UBD C;  2R1F A;  2EN2 A;  2YSP A;  1JK1 A;  2EM3 A;  4WSG A;  2LVH A;  1F2I G;  2EOE A;  2EM8 A;  5KL4 A;  2DGC A;  2YTQ A;  3VHT B;  2YRM A;  1TN9 A;  5KL7 A;  1ZAA C;  5KL2 A;  2YTE A;  3EPL A;  2MKD A;  2YTG A;  2WBU A;  2EM4 A;  5KL6 A;  1UN6 B;  2ENC A;  3M99 B;  3EPK A;  2YTI A;  2EOX A;  1MEY C;  1A1G A;  1AAY A;  4R2A A;  2PRT A;  4F6N A;  2YTD A;  2EN8 A;  2EOS A;  2EL6 A;  2DLK A;  1B69 A;  2M9A A;  1TF3 A;  2EMZ A;  4X9J A;  2BB8 A;  1G2F C;  2ADR A;  2WBT A;  1A1I A;  2EOH A;  2EOF A;  1KJK A;  4IS1 C;  1X3C A;  1Z1B A;  3UK3 C;  4R2C A;  2EMH A;  2EPP A;  2RSI A;  2EM2 A;  5KL3 A;  1A1J A;  1YUI A;  2LV2 A;  2DMI A;  2EOJ A;  2EPC A;  2EPA A;  2EMA A;  2LO3 A;  2EN7 A;  2EQ1 A;  2YSO A;  2EMI A;  2EPX A;  2WCC 3;  1A1K A;  1X6H A;  2A25 A;  2VRD A;  4M9V C;  2CSH A;  2EMC A;  1DGC A;  4R2P A;  2EQ0 A;  4FK5 C;  2EP3 A;  1A1F A;  2EML A;  2EMW A;  2ENH A;  2EOY A;  2MDG A;  4R2R A;  2EPR A;  4F2J C;  1RMD A;  2CTD A;  2YTJ A;  4IJD A;  2YTP A;  1WJP A;  1A1L A;  2EMY A;  2EQ3 A;  2EM9 A;  2YTN A;  4R2E A;  2EL5 A;  2EL4 A;  2YU5 A;  2EOZ A;  2EE8 A;  2EOM A;  2EPZ A;  2RPC A;  2EM7 A;  2EN6 A;  2LT7 A;  2EM6 A;  3MHS C;  1X6E A;  2CT1 A;  2EMF A;  2JP9 A;  2EMK A;  2DLQ A;  2EOI A;  2WBS A;  2YTF A;  2EN3 A;  2EOQ A;  4R2Q A;  1BBO A;  1BB8 A;  2LCE A;  2J7J A;  2EOO A;  1NCS A;  5KL5 A;  2EM0 A;  2YRK A;  4GZN C;  1A1H A;  2MKN A;  2NAB A;  2I13 A;  4R2S A;  2E72 A;  2YTO A;  4F6M A;  1G2D C;  2YU8 A;  1P47 A;  1YUJ A;  2DRP A;  1ZR9 A;  2EM5 A;  2GHF A;  2EMG A;  1TF6 A;  2ELY A;  1YSA C;  2JPA A;  2EOR A;  4R2D A;  2GLI A;  1ZU1 A;  2ENA A;  2EN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...