2LV2A

Solution nmr structure of c2h2-type zinc-fingers 4 and 5 from human insulinoma-associated protein 1 (fragment 424-497), northeast structural genomics consortium target hr7614b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Insulinoma-associated protein 1
publication title Solution NMR structure of C2H2-type Zinc-fingers 4 and 5 from human Insulinoma-associated protein 1 (fragment 424-497), Northeast Structural Genomics Consortium Target HR7614B (CASP Target)
rcsb
source organism Homo sapiens
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lv2A00
2EOMA 3MHHC 1A1LA 1G2DC 3MHSC 2VRDA 2RPCA 2EM8A 1KJKA 5KL2A 2EMYA 4F2JC 2ELZA 2EMAA 2EM6A 1A1JA 2EQ0A 1F2IG 2EM4A 2EOOA 2R1FA 2EE8A 1B69A 2EM0A 1X3CA 1A1GA 2YTFA 2ENCA 2GHFA 2EN8A 2EOHA 1TF6A 2EMKA 2WCC3 2EPZA 2YRHA 2EN1A 1MEYC 3M99B 1ZU1A 4R2RA 2LV2A 2LVHA 5KL7A 1TF3A 2EOXA 4M9VC 4FK5C 2LCEA 2YRKA 2A25A 2EPCA 2NABA 4R2PA 5KL6A 2EPXA 2EORA 2BB8A 2EMIA 2EOSA 2EL6A 2M9AA 2YTEA 2I13A 4IJDA 4X9JA 4GZNC 1BBOA 2YSOA 2WBTA 2ENAA 2EOZA 1X6FA 2EOYA 4R2CA 2LT7A 2E72A 2GLIA 2YRMA 2EQ3A 2EMWA 1A1HA 2EN6A 4R2QA 1UBDC 1YUIA 2EM7A 1RMDA 2MDGA 2J7JA 2DRPA 2YU5A 4R2AA 3EPHA 2EL4A 4R2EA 1JK2A 1JK1A 2HGHA 2CTDA 2YTOA 1A1KA 1A1FA 2EMZA 2WBSA 2CSHA 2EPPA 2EL5A 1P47A 2DGCA 2EMLA 1X5WA 2EM2A 2CT1A 5KL3A 1YSAC 2D9HA 2RSIA 5KL5A 2EOJA 4R2DA 2EMBA 2EQ1A 3EPJA 1UN6B 2DMIA 2DLKA 1X6EA 2EJ4A 2EMGA 2EMCA 2EM5A 2WBUA 2EMFA 2YTPA 1X6HA 4WSGA 1Z1BA 4F6MA 1AAYA 1G2FC 2YTIA 2YU8A 2EN3A 2ENHA 2EOIA 3EPLA 4F6NA 2MKNA 1LLMC 2JP9A 2PRTA 2DLQA 2YTJA 3EPKA 2EOEA 2EN2A 2EOQA 2EPRA 2EPAA 1A1IA 1DGCA 2LO3A 2EMHA 2YTQA 2YTGA 2EMXA 1TN9A 2ADRA 2EN4A 2YTDA 2YTNA 1NCSA 1YUJA 2EM9A 2YSPA 1BB8A 1ZAAC 4IS1C 1ZR9A 2ELYA 3UK3C 1WJPA 2EM3A 4R2SA 5KL4A 2MKDA 2EOFA 3VHTB 2EN7A 2EPUA 2EP3A 2JPAA
chains in the Genus database with same CATH superfamily
1AH5A 1UILA 5A69A 1G2DC 1KYQA 3MHSC 2RPCA 2EM8A 2M7QA 5AASA 2L3CA 2YZTA 2ELZA 1PKPA 2EM4A 3T1HE 4K0KE 2ENCA 2MC6A 3J7AG 1X47A 4DR4E 3OMLA 2YRHA 1ZU1A 4JI6E 4R2RA 2LV2A 2LVHA 4ZYEA 2EOXA 3ECRA 2F8BA 2VQEE 4M9VC 1J26A 1N32E 1IBME 4YY3E 3VK6A 5A6JA 2EORA 4DV5E 4X64E 1GTKA 3IWDA 3J81C 2EOZA 2L2MA 2YRMA 2EQ3A 1QU6A 4DV0E 1UBDC 4R2QA 1FJGE 2VE7C 4R2AA 1HNXE 1PJTA 2BBGA 2EL4A 1EKZA 2YTOA 4M30A 4B3SE 2EPKX 1PJSA 5LL6R 2EMZA 2WBSA 2EPPA 2HJJA 2DGCA 5IWAE 5A6BD 2EM2A 2N8XA 4DV7E 1T39A 2CT1A 1DQ3A 2RSIA 2EPOA 5KL5A 2NUGA 2EMBA 2EQ1A 2UXBE 2EMGA 3H09A 2NA2A 3LLHA 2WZOA 2RTXA 1YPNA 3AUZA 2KONA 4F6MA 4R03A 2DIXA 4DR5E 2MKNA 4JI5E 1LLMC 1T4LB 2PRTA 3IWCA 1N33E 2JYAA 3EQ1A 4J8ZA 4DR7E 2EOQA 1EH7A 2EPAA 1A1IA 5AE3A 1MGTA 4X66E 2EMXA 2B7VA 1TN9A 4O5GA 1YUJA 2E1MA 2EM9A 1ZAAC 4O24A 1ZR9A 2DB2A 2LUPB 2UU9E 1WJPA 2V87A 2V83A 4NZVA 2MKDA 4F9AB 2UUCE 2EN7A 4ZYHA 2JPAA 4LF6E 3C6MA 3C4BA 4DV2E 1YZ9A 2L3JA 2YWQA 4HEIA 4GEQB 2LTSA 1UHZA 1A1JA 2MDRA 5A6BA 4DV3E 1B69A 2K7IA 4B3ME 2EM0A 1N36E 1A1GA 3KZZA 3LMLA 2EOHA 1XNRE 2EMKA 2WCC3 2ODRD 1TF3A 2LCEA 2YRKA 2A25A 4I8OA 3C6KA 4R2PA 4OOGC 5KL6A 4JI4E 4KHPE 2EPXA 2EMIA 2MC5A 2EOSA 4P7DA 4DUZE 2V8QB 2EL6A 3MSWA 2I13A 1BBGA 2L6MA 4IJDA 1BBOA 2ENAA 4R2CA 2FGGA 2VF1A 5IT9C 2K4VA 2EMWA 2EN6A 1YUIA 1J5EE 4BC9A 1RMDA 2MDGA 2J7JA 2RQLA 1HNZE 2DRPA 1YYKA 1L4SA 1N34E 4R2EA 2JOBA 1JK2A 2HGHA 2EPLX 1A1KA 2LE2A 1A1FA 2EZ6A 5IXMB 4BHBA 2DSYA 2EMLA 3ADLA 4LFAE 3ADIA 4LF9E 2IHR1 2HHHE 4JI1E 1X6EA 2EJ4A 2EMCA 4GKJE 2UUBE 2EMFA 2YTPA 4WSGA 4X62E 1Z1BA 3F6GA 5IV8B 1STUA 2YTIA 2YU8A 2EN3A 4WSPA 2EOIA 3P1XA 3K6QA 4LF5E 4L5NC 4LU9A 4TUIA 2KOUA 5AE1A 3EPKA 4N4RB 3HTXA 2EMHA 2LMZA 2YTGA 2YTDA 2YTNA 2NUEA 2YSPA 3HPSA 4BCAA 5A2QC 4IS1C 2DMYA 2ELYA 5AC4A 4WX9A 2RS7A 1WRJA 2UXCE 2EOMA 2VQFE 3IWBA 4ZYDA 1A1LA 2L2KB 2JWOA 2L8TA 2VRDA 3RMPA 2EMYA 4LTYA 3JAMC 1FKAE 4DR6E 2EM6A 5CFFE 1XNQE 1ZBQA 4HTGA 4WFTA 3QG5C 2EE8A 1QNTA 1X3CA 2YTFA 2EN8A 1TF6A 4P78A 5F3WA 2EPZA 2EN1A 1MEYC 1IMUA 4OX9E 5LLQA 2V86A 4JI2E 1N3GA 1GZ6A 2EPCA 4AQYE 4NXNE 4DV1E 4BS9A 2YPNA 3ADGA 2CPNA 4O4KA 3THOB 2BB8A 4TUGA 2M9AA 2YTEA 3HQ1A 1RQ0A 4X9JA 2YSOA 4GKKE 2NUFA 1X6FA 2M4IA 2HC5A 2LT7A 2E72A 1EH8A 2LJUA 4BHCA 5TSEA 2EM7A 1O0WA 2YU5A 1IBKE 3FIGA 4M2ZA 1T4OA 1JK1A 4Q28A 4LFCE 2V89A 2RSMA 3AV0A 3KZYA 1P47A 3ADJA 2RS6A 4JI3E 1NEIA 4JI7E 1X5WA 2LRSA 3VYYA 1YSAC 2D9HA 4MLQA 4RH8A 5DNYA 2EOJA 5A6AA 1T38A 1T4NA 4NHRA 4DV4E 5BR8E 1UN6B 2DMIA 4DR2E 2JY9A 4O43A 4X8WA 1PJQA 2EM5A 3HPZA 2WBUA 2L92A 1RC7A 1HR0E 1X6HA 1AAYA 4F54A 1G2FC 2ENHA 3L00A 3EPLA 2M1SA 4LF7E 2DLQA 1EH6A 1IQOA 4ZYGA 2EOEA 3C4TA 2GPIA 2ODRC 4F9CB 1WHQA 1DI2A 2N3GA 3TQMA 2LO3A 4WPYA 2YTQA 2H36X 4BBYA 2EN4A 2V88A 1I94E 4LFBE 1BB8A 3BF2A 2R76A 1WHNA 3UK3C 2EM3A 4RHBB 3T1YE 5KL4A 4WYQB 5FLXC 3THNA 2EOFA 2JOXA 2EPUA 2LBSB 3KWRA 3MHHC 5AE2A 2UUAE 2JVAA 2Q8UA 3JU0A 1KJKA 5KL2A 2F4VE 4F2JC 1IQSA 3J7Yp 2ZM6E 2EMAA 3BGHA 2EQ0A 4JI8E 1F2IG 2EOOA 2R1FA 2FTXB 2GHFA 4L8NA 5A6KA 2EPNA 3M99B 5AC5A 5KL7A 4DR1E 4FK5C 2LJHA 3DF6A 1GQEA 2NABA 3HXLA 4M0VA 4JI0E 2LUQA 5LMNE 3JTZA 1YFHA 3BBGA 2G7HA 1WXRA 3OTOE 4KWYA 4GZNC 1YYOA 2EWLA 2WBTA 4DKKA 4R8OA 3F6HA 2EOYA 2KHXA 4BMJA 4DV6E 2GLIA 3DJWA 4DUYE 1A1HA 2B7TA 1XMQE 2L2NA 3EPHA 4F9BB 4Q35B 4B3RE 1SR9A 2CTDA 4BC7A 4WXCA 4KZSA 2FV4B 1YYWA 2EPMX 2CSHA 3ZOQB 2EL5A 1IBLE 4LF4E 2JXPA 2E5LE 4JYAE 2B9DA 2B3TB 1X48A 1ZBTA 5KL3A 4R2DA 4WXDA 4LF8E 3EPJA 2DLKA 4DR3E 3BIDA 5LMUE 2L33A 5T6JA 2JR1A 4NXME 1X49A 1SFEA 4F6NA 2I9IA 1HNWE 4MLVA 2JP9A 2YTJA 4JV5E 2LTRA 1XMOE 1PDAA 4DMIA 3VYXA 4YHHE 4X65E 2EN2A 2EPRA 2V85A 1DGCA 5ADZA 2ADRA 2N3HA 1NCSA 4B3TE 3J80C 4R2SA 2UXDE 2YT4A 3VHTB 2EP3A
chains in the Genus database with same CATH topology
2EOMA 3MHHC 1A1LA 1G2DC 3MHSC 2VRDA 2RPCA 2EM8A 1KJKA 5KL2A 2EMYA 4F2JC 2ELZA 2EMAA 2EM6A 1A1JA 2EQ0A 1F2IG 2EM4A 2EOOA 2R1FA 2EE8A 1B69A 2EM0A 1X3CA 1A1GA 2YTFA 2ENCA 2GHFA 2EN8A 2EOHA 1TF6A 2EMKA 2WCC3 2EPZA 2YRHA 2EN1A 1MEYC 3M99B 1ZU1A 4R2RA 2LV2A 2LVHA 5KL7A 1TF3A 2EOXA 4M9VC 4FK5C 2LCEA 2YRKA 2A25A 2EPCA 2NABA 4R2PA 5KL6A 2EPXA 2EORA 2BB8A 2EMIA 2EOSA 2EL6A 2M9AA 2YTEA 2I13A 4IJDA 4X9JA 4GZNC 1BBOA 2YSOA 2WBTA 2ENAA 2EOZA 1X6FA 2EOYA 4R2CA 2LT7A 2E72A 2GLIA 2YRMA 2EQ3A 2EMWA 1A1HA 2EN6A 4R2QA 1UBDC 1YUIA 2EM7A 1RMDA 2MDGA 2J7JA 2DRPA 2YU5A 4R2AA 3EPHA 2EL4A 4R2EA 1JK2A 1JK1A 2HGHA 2CTDA 2YTOA 1A1KA 1A1FA 2EMZA 2WBSA 2CSHA 2EPPA 2EL5A 1P47A 2DGCA 2EMLA 1X5WA 2EM2A 2CT1A 5KL3A 1YSAC 2D9HA 2RSIA 5KL5A 2EOJA 4R2DA 2EMBA 2EQ1A 3EPJA 1UN6B 2DMIA 2DLKA 1X6EA 2EJ4A 2EMGA 2EMCA 2EM5A 2WBUA 2EMFA 2YTPA 1X6HA 4WSGA 1Z1BA 4F6MA 1AAYA 1G2FC 2YTIA 2YU8A 2EN3A 2ENHA 2EOIA 3EPLA 4F6NA 2MKNA 1LLMC 2JP9A 2PRTA 2DLQA 2YTJA 3EPKA 2EOEA 2EN2A 2EOQA 2EPRA 2EPAA 1A1IA 1DGCA 2LO3A 2EMHA 2YTQA 2YTGA 2EMXA 1TN9A 2ADRA 2EN4A 2YTDA 2YTNA 1NCSA 1YUJA 2EM9A 2YSPA 1BB8A 1ZAAC 4IS1C 1ZR9A 2ELYA 3UK3C 1WJPA 2EM3A 4R2SA 5KL4A 2MKDA 2EOFA 3VHTB 2EN7A 2EPUA 2EP3A 2JPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOM A;  3MHH C;  1A1L A;  1G2D C;  3MHS C;  2VRD A;  2RPC A;  2EM8 A;  1KJK A;  5KL2 A;  2EMY A;  4F2J C;  2ELZ A;  2EMA A;  2EM6 A;  1A1J A;  2EQ0 A;  1F2I G;  2EM4 A;  2EOO A;  2R1F A;  2EE8 A;  1B69 A;  2EM0 A;  1X3C A;  1A1G A;  2YTF A;  2ENC A;  2GHF A;  2EN8 A;  2EOH A;  1TF6 A;  2EMK A;  2WCC 3;  2EPZ A;  2YRH A;  2EN1 A;  1MEY C;  3M99 B;  1ZU1 A;  4R2R A;  2LV2 A;  2LVH A;  5KL7 A;  1TF3 A;  2EOX A;  4M9V C;  4FK5 C;  2LCE A;  2YRK A;  2A25 A;  2EPC A;  2NAB A;  4R2P A;  5KL6 A;  2EPX A;  2EOR A;  2BB8 A;  2EMI A;  2EOS A;  2EL6 A;  2M9A A;  2YTE A;  2I13 A;  4IJD A;  4X9J A;  4GZN C;  1BBO A;  2YSO A;  2WBT A;  2ENA A;  2EOZ A;  1X6F A;  2EOY A;  4R2C A;  2LT7 A;  2E72 A;  2GLI A;  2YRM A;  2EQ3 A;  2EMW A;  1A1H A;  2EN6 A;  4R2Q A;  1UBD C;  1YUI A;  2EM7 A;  1RMD A;  2MDG A;  2J7J A;  2DRP A;  2YU5 A;  4R2A A;  3EPH A;  2EL4 A;  4R2E A;  1JK2 A;  1JK1 A;  2HGH A;  2CTD A;  2YTO A;  1A1K A;  1A1F A;  2EMZ A;  2WBS A;  2CSH A;  2EPP A;  2EL5 A;  1P47 A;  2DGC A;  2EML A;  1X5W A;  2EM2 A;  2CT1 A;  5KL3 A;  1YSA C;  2D9H A;  2RSI A;  5KL5 A;  2EOJ A;  4R2D A;  2EMB A;  2EQ1 A;  3EPJ A;  1UN6 B;  2DMI A;  2DLK A;  1X6E A;  2EJ4 A;  2EMG A;  2EMC A;  2EM5 A;  2WBU A;  2EMF A;  2YTP A;  1X6H A;  4WSG A;  1Z1B A;  4F6M A;  1AAY A;  1G2F C;  2YTI A;  2YU8 A;  2EN3 A;  2ENH A;  2EOI A;  3EPL A;  4F6N A;  2MKN A;  1LLM C;  2JP9 A;  2PRT A;  2DLQ A;  2YTJ A;  3EPK A;  2EOE A;  2EN2 A;  2EOQ A;  2EPR A;  2EPA A;  1A1I A;  1DGC A;  2LO3 A;  2EMH A;  2YTQ A;  2YTG A;  2EMX A;  1TN9 A;  2ADR A;  2EN4 A;  2YTD A;  2YTN A;  1NCS A;  1YUJ A;  2EM9 A;  2YSP A;  1BB8 A;  1ZAA C;  4IS1 C;  1ZR9 A;  2ELY A;  3UK3 C;  1WJP A;  2EM3 A;  4R2S A;  5KL4 A;  2MKD A;  2EOF A;  3VHT B;  2EN7 A;  2EPU A;  2EP3 A;  2JPA A; 
#chains in the Genus database with same CATH topology
 1AH5 A;  1UIL A;  5A69 A;  1G2D C;  1KYQ A;  3MHS C;  2RPC A;  2EM8 A;  2M7Q A;  5AAS A;  2L3C A;  2YZT A;  2ELZ A;  1PKP A;  2EM4 A;  3T1H E;  4K0K E;  2ENC A;  2MC6 A;  3J7A G;  1X47 A;  4DR4 E;  3OML A;  2YRH A;  1ZU1 A;  4JI6 E;  4R2R A;  2LV2 A;  2LVH A;  4ZYE A;  2EOX A;  3ECR A;  2F8B A;  2VQE E;  4M9V C;  1J26 A;  1N32 E;  1IBM E;  4YY3 E;  3VK6 A;  5A6J A;  2EOR A;  4DV5 E;  4X64 E;  1GTK A;  3IWD A;  3J81 C;  2EOZ A;  2L2M A;  2YRM A;  2EQ3 A;  1QU6 A;  4DV0 E;  1UBD C;  4R2Q A;  1FJG E;  2VE7 C;  4R2A A;  1HNX E;  1PJT A;  2BBG A;  2EL4 A;  1EKZ A;  2YTO A;  4M30 A;  4B3S E;  2EPK X;  1PJS A;  5LL6 R;  2EMZ A;  2WBS A;  2EPP A;  2HJJ A;  2DGC A;  5IWA E;  5A6B D;  2EM2 A;  2N8X A;  4DV7 E;  1T39 A;  2CT1 A;  1DQ3 A;  2RSI A;  2EPO A;  5KL5 A;  2NUG A;  2EMB A;  2EQ1 A;  2UXB E;  2EMG A;  3H09 A;  2NA2 A;  3LLH A;  2WZO A;  2RTX A;  1YPN A;  3AUZ A;  2KON A;  4F6M A;  4R03 A;  2DIX A;  4DR5 E;  2MKN A;  4JI5 E;  1LLM C;  1T4L B;  2PRT A;  3IWC A;  1N33 E;  2JYA A;  3EQ1 A;  4J8Z A;  4DR7 E;  2EOQ A;  1EH7 A;  2EPA A;  1A1I A;  5AE3 A;  1MGT A;  4X66 E;  2EMX A;  2B7V A;  1TN9 A;  4O5G A;  1YUJ A;  2E1M A;  2EM9 A;  1ZAA C;  4O24 A;  1ZR9 A;  2DB2 A;  2LUP B;  2UU9 E;  1WJP A;  2V87 A;  2V83 A;  4NZV A;  2MKD A;  4F9A B;  2UUC E;  2EN7 A;  4ZYH A;  2JPA A;  4LF6 E;  3C6M A;  3C4B A;  4DV2 E;  1YZ9 A;  2L3J A;  2YWQ A;  4HEI A;  4GEQ B;  2LTS A;  1UHZ A;  1A1J A;  2MDR A;  5A6B A;  4DV3 E;  1B69 A;  2K7I A;  4B3M E;  2EM0 A;  1N36 E;  1A1G A;  3KZZ A;  3LML A;  2EOH A;  1XNR E;  2EMK A;  2WCC 3;  2ODR D;  1TF3 A;  2LCE A;  2YRK A;  2A25 A;  4I8O A;  3C6K A;  4R2P A;  4OOG C;  5KL6 A;  4JI4 E;  4KHP E;  2EPX A;  2EMI A;  2MC5 A;  2EOS A;  4P7D A;  4DUZ E;  2V8Q B;  2EL6 A;  3MSW A;  2I13 A;  1BBG A;  2L6M A;  4IJD A;  1BBO A;  2ENA A;  4R2C A;  2FGG A;  2VF1 A;  5IT9 C;  2K4V A;  2EMW A;  2EN6 A;  1YUI A;  1J5E E;  4BC9 A;  1RMD A;  2MDG A;  2J7J A;  2RQL A;  1HNZ E;  2DRP A;  1YYK A;  1L4S A;  1N34 E;  4R2E A;  2JOB A;  1JK2 A;  2HGH A;  2EPL X;  1A1K A;  2LE2 A;  1A1F A;  2EZ6 A;  5IXM B;  4BHB A;  2DSY A;  2EML A;  3ADL A;  4LFA E;  3ADI A;  4LF9 E;  2IHR 1;  2HHH E;  4JI1 E;  1X6E A;  2EJ4 A;  2EMC A;  4GKJ E;  2UUB E;  2EMF A;  2YTP A;  4WSG A;  4X62 E;  1Z1B A;  3F6G A;  5IV8 B;  1STU A;  2YTI A;  2YU8 A;  2EN3 A;  4WSP A;  2EOI A;  3P1X A;  3K6Q A;  4LF5 E;  4L5N C;  4LU9 A;  4TUI A;  2KOU A;  5AE1 A;  3EPK A;  4N4R B;  3HTX A;  2EMH A;  2LMZ A;  2YTG A;  2YTD A;  2YTN A;  2NUE A;  2YSP A;  3HPS A;  4BCA A;  5A2Q C;  4IS1 C;  2DMY A;  2ELY A;  5AC4 A;  4WX9 A;  2RS7 A;  1WRJ A;  2UXC E;  2EOM A;  2VQF E;  3IWB A;  4ZYD A;  1A1L A;  2L2K B;  2JWO A;  2L8T A;  2VRD A;  3RMP A;  2EMY A;  4LTY A;  3JAM C;  1FKA E;  4DR6 E;  2EM6 A;  5CFF E;  1XNQ E;  1ZBQ A;  4HTG A;  4WFT A;  3QG5 C;  2EE8 A;  1QNT A;  1X3C A;  2YTF A;  2EN8 A;  1TF6 A;  4P78 A;  5F3W A;  2EPZ A;  2EN1 A;  1MEY C;  1IMU A;  4OX9 E;  5LLQ A;  2V86 A;  4JI2 E;  1N3G A;  1GZ6 A;  2EPC A;  4AQY E;  4NXN E;  4DV1 E;  4BS9 A;  2YPN A;  3ADG A;  2CPN A;  4O4K A;  3THO B;  2BB8 A;  4TUG A;  2M9A A;  2YTE A;  3HQ1 A;  1RQ0 A;  4X9J A;  2YSO A;  4GKK E;  2NUF A;  1X6F A;  2M4I A;  2HC5 A;  2LT7 A;  2E72 A;  1EH8 A;  2LJU A;  4BHC A;  5TSE A;  2EM7 A;  1O0W A;  2YU5 A;  1IBK E;  3FIG A;  4M2Z A;  1T4O A;  1JK1 A;  4Q28 A;  4LFC E;  2V89 A;  2RSM A;  3AV0 A;  3KZY A;  1P47 A;  3ADJ A;  2RS6 A;  4JI3 E;  1NEI A;  4JI7 E;  1X5W A;  2LRS A;  3VYY A;  1YSA C;  2D9H A;  4MLQ A;  4RH8 A;  5DNY A;  2EOJ A;  5A6A A;  1T38 A;  1T4N A;  4NHR A;  4DV4 E;  5BR8 E;  1UN6 B;  2DMI A;  4DR2 E;  2JY9 A;  4O43 A;  4X8W A;  1PJQ A;  2EM5 A;  3HPZ A;  2WBU A;  2L92 A;  1RC7 A;  1HR0 E;  1X6H A;  1AAY A;  4F54 A;  1G2F C;  2ENH A;  3L00 A;  3EPL A;  2M1S A;  4LF7 E;  2DLQ A;  1EH6 A;  1IQO A;  4ZYG A;  2EOE A;  3C4T A;  2GPI A;  2ODR C;  4F9C B;  1WHQ A;  1DI2 A;  2N3G A;  3TQM A;  2LO3 A;  4WPY A;  2YTQ A;  2H36 X;  4BBY A;  2EN4 A;  2V88 A;  1I94 E;  4LFB E;  1BB8 A;  3BF2 A;  2R76 A;  1WHN A;  3UK3 C;  2EM3 A;  4RHB B;  3T1Y E;  5KL4 A;  4WYQ B;  5FLX C;  3THN A;  2EOF A;  2JOX A;  2EPU A;  2LBS B;  3KWR A;  3MHH C;  5AE2 A;  2UUA E;  2JVA A;  2Q8U A;  3JU0 A;  1KJK A;  5KL2 A;  2F4V E;  4F2J C;  1IQS A;  3J7Y p;  2ZM6 E;  2EMA A;  3BGH A;  2EQ0 A;  4JI8 E;  1F2I G;  2EOO A;  2R1F A;  2FTX B;  2GHF A;  4L8N A;  5A6K A;  2EPN A;  3M99 B;  5AC5 A;  5KL7 A;  4DR1 E;  4FK5 C;  2LJH A;  3DF6 A;  1GQE A;  2NAB A;  3HXL A;  4M0V A;  4JI0 E;  2LUQ A;  5LMN E;  3JTZ A;  1YFH A;  3BBG A;  2G7H A;  1WXR A;  3OTO E;  4KWY A;  4GZN C;  1YYO A;  2EWL A;  2WBT A;  4DKK A;  4R8O A;  3F6H A;  2EOY A;  2KHX A;  4BMJ A;  4DV6 E;  2GLI A;  3DJW A;  4DUY E;  1A1H A;  2B7T A;  1XMQ E;  2L2N A;  3EPH A;  4F9B B;  4Q35 B;  4B3R E;  1SR9 A;  2CTD A;  4BC7 A;  4WXC A;  4KZS A;  2FV4 B;  1YYW A;  2EPM X;  2CSH A;  3ZOQ B;  2EL5 A;  1IBL E;  4LF4 E;  2JXP A;  2E5L E;  4JYA E;  2B9D A;  2B3T B;  1X48 A;  1ZBT A;  5KL3 A;  4R2D A;  4WXD A;  4LF8 E;  3EPJ A;  2DLK A;  4DR3 E;  3BID A;  5LMU E;  2L33 A;  5T6J A;  2JR1 A;  4NXM E;  1X49 A;  1SFE A;  4F6N A;  2I9I A;  1HNW E;  4MLV A;  2JP9 A;  2YTJ A;  4JV5 E;  2LTR A;  1XMO E;  1PDA A;  4DMI A;  3VYX A;  4YHH E;  4X65 E;  2EN2 A;  2EPR A;  2V85 A;  1DGC A;  5ADZ A;  2ADR A;  2N3H A;  1NCS A;  4B3T E;  3J80 C;  4R2S A;  2UXD E;  2YT4 A;  3VHT B;  2EP3 A; 
#chains in the Genus database with same CATH homology
 2EOM A;  3MHH C;  1A1L A;  1G2D C;  3MHS C;  2VRD A;  2RPC A;  2EM8 A;  1KJK A;  5KL2 A;  2EMY A;  4F2J C;  2ELZ A;  2EMA A;  2EM6 A;  1A1J A;  2EQ0 A;  1F2I G;  2EM4 A;  2EOO A;  2R1F A;  2EE8 A;  1B69 A;  2EM0 A;  1X3C A;  1A1G A;  2YTF A;  2ENC A;  2GHF A;  2EN8 A;  2EOH A;  1TF6 A;  2EMK A;  2WCC 3;  2EPZ A;  2YRH A;  2EN1 A;  1MEY C;  3M99 B;  1ZU1 A;  4R2R A;  2LV2 A;  2LVH A;  5KL7 A;  1TF3 A;  2EOX A;  4M9V C;  4FK5 C;  2LCE A;  2YRK A;  2A25 A;  2EPC A;  2NAB A;  4R2P A;  5KL6 A;  2EPX A;  2EOR A;  2BB8 A;  2EMI A;  2EOS A;  2EL6 A;  2M9A A;  2YTE A;  2I13 A;  4IJD A;  4X9J A;  4GZN C;  1BBO A;  2YSO A;  2WBT A;  2ENA A;  2EOZ A;  1X6F A;  2EOY A;  4R2C A;  2LT7 A;  2E72 A;  2GLI A;  2YRM A;  2EQ3 A;  2EMW A;  1A1H A;  2EN6 A;  4R2Q A;  1UBD C;  1YUI A;  2EM7 A;  1RMD A;  2MDG A;  2J7J A;  2DRP A;  2YU5 A;  4R2A A;  3EPH A;  2EL4 A;  4R2E A;  1JK2 A;  1JK1 A;  2HGH A;  2CTD A;  2YTO A;  1A1K A;  1A1F A;  2EMZ A;  2WBS A;  2CSH A;  2EPP A;  2EL5 A;  1P47 A;  2DGC A;  2EML A;  1X5W A;  2EM2 A;  2CT1 A;  5KL3 A;  1YSA C;  2D9H A;  2RSI A;  5KL5 A;  2EOJ A;  4R2D A;  2EMB A;  2EQ1 A;  3EPJ A;  1UN6 B;  2DMI A;  2DLK A;  1X6E A;  2EJ4 A;  2EMG A;  2EMC A;  2EM5 A;  2WBU A;  2EMF A;  2YTP A;  1X6H A;  4WSG A;  1Z1B A;  4F6M A;  1AAY A;  1G2F C;  2YTI A;  2YU8 A;  2EN3 A;  2ENH A;  2EOI A;  3EPL A;  4F6N A;  2MKN A;  1LLM C;  2JP9 A;  2PRT A;  2DLQ A;  2YTJ A;  3EPK A;  2EOE A;  2EN2 A;  2EOQ A;  2EPR A;  2EPA A;  1A1I A;  1DGC A;  2LO3 A;  2EMH A;  2YTQ A;  2YTG A;  2EMX A;  1TN9 A;  2ADR A;  2EN4 A;  2YTD A;  2YTN A;  1NCS A;  1YUJ A;  2EM9 A;  2YSP A;  1BB8 A;  1ZAA C;  4IS1 C;  1ZR9 A;  2ELY A;  3UK3 C;  1WJP A;  2EM3 A;  4R2S A;  5KL4 A;  2MKD A;  2EOF A;  3VHT B;  2EN7 A;  2EPU A;  2EP3 A;  2JPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...