2LV2A

Solution nmr structure of c2h2-type zinc-fingers 4 and 5 from human insulinoma-associated protein 1 (fragment 424-497), northeast structural genomics consortium target hr7614b
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of C2H2-type Zinc-fingers 4 and 5 from human Insulinoma-associated protein 1 (fragment 424-497), Northeast Structural Genomics Consortium Target HR7614B (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Insulinoma-associated protein 1
total genus 13
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2lv2A00
2EN2A 2GLIA 3M99B 1X5WA 2MDGA 3VHTB 4F2JC 2EPRA 2LVHA 3UK3C 2GHFA 2WCC3 2CSHA 2WBSA 1RMDA 2EORA 2CTDA 4X9JA 2YSOA 1A1LA 2EM4A 2EMYA 4R2AA 4IS1C 2JP9A 1G2DC 2EPXA 1A1IA 1BB8A 2EOHA 1A1JA 2EL4A 5KL7A 1TF3A 1A1HA 1P47A 2EOSA 2EOFA 2EMWA 2YTJA 2R1FA 2EPAA 2YTEA 2EPZA 1A1GA 1AAYA 2YTOA 2EE8A 2EQ3A 5KL4A 2YTIA 2EM7A 5KL3A 2EMIA 2EM0A 1Z1BA 2RPCA 2EOXA 4FK5C 1UBDC 1ZR9A 2A25A 2LCEA 2EPCA 2EP3A 4R2EA 1A1FA 2ELZA 2EMBA 1X3CA 2EOEA 2EN6A 2EOIA 2EOYA 2DGCA 2EM9A 2ENAA 3MHSC 1G2FC 2M9AA 1NCSA 2PRTA 5KL2A 4F6NA 2ADRA 2MKDA 2NABA 4M9VC 4R2DA 4R2QA 1F2IG 1A1KA 2EOOA 2EMXA 5KL5A 2EM2A 4GZNC 2LO3A 2EM5A 2YTGA 2EMGA 2EM8A 2ENCA 1DGCA 2YU5A 2EMLA 2CT1A 2EL5A 4F6MA 2EN8A 1YUIA 1B69A 2MKNA 2WBUA 2EMCA 2EMKA 1MEYC 2EJ4A 2HGHA 1X6HA 2YRHA 2EL6A 2JPAA 2EMZA 2DRPA 3MHHC 2EMFA 2YTPA 2I13A 1KJKA 2EN1A 2DLKA 1X6EA 2YTFA 2EQ1A 1TF6A 2EOZA 1JK1A 2EOMA 4R2CA 2EOJA 2ENHA 2ELYA 2YTNA 4R2PA 1UN6B 1ZAAC 3EPJA 1YUJA 5KL6A 3EPLA 2DMIA 4R2RA 2DLQA 2LT7A 2EPUA 2J7JA 2EMHA 2WBTA 2YRKA 4IJDA 4R2SA 3EPHA 2E72A 2BB8A 2EM6A 2EPPA 2EQ0A 2D9HA 1ZU1A 1TN9A 2YU8A 2VRDA 2YTDA 2RSIA 2YTQA 2EN4A 3EPKA 1JK2A 1BBOA 2EN7A 2EOQA 2EM3A 1YSAC 2EN3A 2YRMA 1WJPA 2LV2A 4WSGA 2YSPA 1LLMC 1X6FA 2EMAA
chains in the Genus database with same CATH superfamily
2EN2A 1UILA 1YFHA 1X5WA 3VHTB 1EH7A 4BBYA 3IWBA 3UK3C 4Q35B 4LF7E 2WBSA 3T1YE 2CTDA 4TUGA 4X9JA 1KYQA 4P7DA 4R2AA 2EMYA 4I8OA 2EPXA 5LLQA 3LMLA 1X48A 4M0VA 2LE2A 3J7Yp 2ODRD 5KL7A 1A1IA 3ADIA 2EOFA 2V87A 3EQ1A 4F9CB 2CPNA 2YTEA 4WSPA 3BIDA 1A1GA 2YPNA 5LMUE 2HHHE 5DNYA 4KHPE 2KHXA 4R03A 2EQ3A 2YTIA 4ZYHA 2EM0A 3IWDA 1IQSA 1HNWE 2EOXA 1FJGE 2H36X 3J81C 2EMBA 1X3CA 2EOEA 2EN6A 2EOIA 3IWCA 1G2FC 2PRTA 1STUA 4DV0E 2JWOA 1EH6A 2JR1A 5IWAE 5A6JA 4R2QA 4JI7E 2JOBA 2EMXA 2EPMX 5A6AA 5BR8E 4GZNC 3BGHA 4OOGC 2LO3A 2EPOA 4DV7E 2ENCA 3H09A 2K7IA 2LUPB 2LRSA 4DV3E 4F6MA 4LTYA 1B69A 1YUIA 3F6HA 2EJ4A 2MC6A 4NHRA 1X6HA 4DR3E 2EL6A 2JPAA 2DRPA 3MHHC 2YT4A 1KJKA 5A6KA 1DI2A 2DLKA 3ADGA 1SR9A 5A69A 4JI1E 2L2KB 4F9AB 2EOJA 2ELYA 1DQ3A 1T4NA 1UN6B 3EPJA 5AE1A 4DMIA 4R2RA 1YYWA 4DUZE 4WXCA 4LF4E 2WBTA 4X65E 2YRKA 2BB8A 3P1XA 2EPPA 2IHR1 1GTKA 2VQFE 4WXDA 2YTDA 4KWYA 3J7AG 4DV5E 1WJPA 2LV2A 3VK6A 2YSPA 4K0KE 3QG5C 2GLIA 2MDGA 4LF9E 2LTRA 2GHFA 3KWRA 4WX9A 4LFCE 1RMDA 3F6GA 3JAMC 4GKJE 2EM4A 1N3GA 4F9BB 1QNTA 1T4OA 1TF3A 4DV1E 1P47A 2JYAA 2JXPA 3BBGA 3KZYA 5IV8B 2EPAA 2EMIA 1Z1BA 1BBGA 2RPCA 4JI3E 3VYXA 4ZYGA 4BS9A 4DV2E 4Q28A 1EKZA 2F8BA 2LCEA 2V8QB 2UUCE 2RS7A 1RQ0A 4TUIA 2MDRA 2DGCA 3TQMA 5KL2A 2VF1A 2L3CA 3DF6A 1PJQA 5AASA 4L8NA 3OMLA 4JI5E 4M30A 5KL5A 2YTGA 4O5GA 3AV0A 2UXBE 1UHZA 4O4KA 2JY9A 2YU5A 1L4SA 2EMLA 1XNRE 2EL5A 2WBUA 4B3SE 2EMKA 1MEYC 4X64E 2Q8UA 1SFEA 2DSYA 4B3TE 2I13A 3HPSA 2VE7C 3J80C 2YTFA 4BC7A 2EQ1A 2M4IA 4DR1E 1T4LB 4NXME 4M2ZA 2VQEE 2LJUA 3C4BA 2JOXA 4L5NC 4OX9E 2EPLX 1HNXE 3EPLA 1IMUA 3THOB 4DV6E 2KONA 2EPUA 3THNA 2I9IA 1YYKA 4B3RE 4N4RB 2B3TB 4R2SA 2EM6A 3C4TA 2D9HA 3JU0A 1TN9A 1ZBQA 2VRDA 2YTQA 2YU8A 3EPKA 4DR4E 1MGTA 5ADZA 2NUGA 3BF2A 4BMJA 2NA2A 1LLMC 4JYAE 4HEIA 2EMAA 5FLXC 2E5LE 3HXLA 2EPRA 2M1SA 2LUQA 3HPZA 2CSHA 1IBME 5A2QC 3C6MA 4JV5E 1A1LA 4IS1C 1G2DC 1BB8A 2EL4A 2EWLA 4DUYE 4DR5E 5AE3A 2JVAA 2R1FA 1HNZE 2FV4B 1AAYA 2R76A 2KOUA 2V85A 4X62E 4ZYDA 2EM7A 1WHQA 2F4VE 2DIXA 4YHHE 2L6MA 4FK5C 2A25A 2EP3A 4R2EA 1YZ9A 3DJWA 2K4VA 4LF6E 2EM9A 3MHSC 2NUEA 2M9AA 1NCSA 2NUFA 1QU6A 2ADRA 3KZZA 2DMYA 5AC4A 5IXMB 2UU9E 4B3ME 1WXRA 1XMQE 1IQOA 1ZBTA 3L00A 3MSWA 3RMPA 2EM2A 4BC9A 4KZSA 4WFTA 2EM5A 4WYQB 4DR2E 1GQEA 2V83A 1T39A 3C6KA 1RC7A 4JI4E 4GEQB 4YY3E 2HGHA 2LJHA 3VYYA 4NZVA 1N32E 2EMFA 3LLHA 4JI2E 2EN1A 2EZ6A 2HC5A 2RS6A 2YZTA 3ADLA 1PJSA 4R2CA 4BCAA 4R2PA 2YTNA 3K6QA 4ZYEA 1YUJA 5KL6A 2B7TA 1I94E 2DMIA 1WRJA 2MC5A 2EMHA 2UUAE 4LFAE 3EPHA 2LBSB 2E72A 2EPKX 2ODRC 4F54A 2LTSA 2UXCE 1NEIA 1JK2A 2M7QA 2EN7A 2WZOA 2EOQA 2EN3A 2DB2A 2RQLA 4X8WA 1XMOE 1PJTA 4WSGA 4LF8E 1X6FA 5F3WA 2YWQA 5AE2A 3M99B 2GPIA 4HTGA 1YYOA 4F2JC 5IT9C 2RTXA 2LVHA 2WCC3 2L33A 2L8TA 4GKKE 4X66E 2EORA 2N8XA 4JI0E 2YSOA 4JI8E 2JP9A 2N3GA 2L2NA 1AH5A 2EOHA 1A1JA 4O43A 1A1HA 1PKPA 3HQ1A 2EOSA 2YTJA 2EMWA 5CFFE 4LFBE 5TSEA 2EPZA 2RSMA 1J5EE 3ADJA 1T38A 4P78A 1N34E 2YTOA 2UUBE 2B9DA 2LMZA 2EE8A 5KL4A 4RHBB 5KL3A 2UXDE 1UBDC 1ZR9A 2L92A 2EPCA 3AUZA 1A1FA 2ELZA 2L2MA 2FTXB 4O24A 1X49A 2EOYA 1FKAE 4DR7E 2EPNA 2ENAA 1GZ6A 4F6NA 4R8OA 2NABA 2MKDA 4M9VC 4AQYE 4BHCA 3T1HE 4R2DA 5T6JA 1F2IG 1A1KA 2EOOA 1O0WA 4BHBA 2B7VA 5A6BA 4DV4E 2EMGA 2EM8A 3ECRA 1DGCA 2BBGA 3OTOE 3HTXA 2CT1A 4MLVA 2MKNA 2E1MA 2EN8A 4LU9A 4DKKA 2EMCA 2ZM6E 2L3JA 1PDAA 4MLQA 3ZOQB 2YRHA 2EMZA 2HJJA 1XNQE 1IBKE 1EH8A 1WHNA 2YTPA 2FGGA 1X6EA 1YPNA 2V89A 4RH8A 1TF6A 2EOZA 1JK1A 2EOMA 2V88A 3FIGA 4DR6E 2ENHA 4NXNE 2V86A 1X47A 1ZAAC 5A6BD 4J8ZA 2DLQA 2LT7A 2G7HA 1J26A 5LL6R 2J7JA 1IBLE 4IJDA 1N36E 1HR0E 5LMNE 2N3HA 2EQ0A 4LF5E 1ZU1A 2RSIA 2EN4A 1BBOA 5AC5A 2EM3A 1YSAC 2YRMA 1N33E 4JI6E 4WPYA 3JTZA
chains in the Genus database with same CATH topology
2EN2A 2GLIA 3M99B 1X5WA 2MDGA 3VHTB 4F2JC 2EPRA 2LVHA 3UK3C 2GHFA 2WCC3 2CSHA 2WBSA 1RMDA 2EORA 2CTDA 4X9JA 2YSOA 1A1LA 2EM4A 2EMYA 4R2AA 4IS1C 2JP9A 1G2DC 2EPXA 1A1IA 1BB8A 2EOHA 1A1JA 2EL4A 5KL7A 1TF3A 1A1HA 1P47A 2EOSA 2EOFA 2EMWA 2YTJA 2R1FA 2EPAA 2YTEA 2EPZA 1A1GA 1AAYA 2YTOA 2EE8A 2EQ3A 5KL4A 2YTIA 2EM7A 5KL3A 2EMIA 2EM0A 1Z1BA 2RPCA 2EOXA 4FK5C 1UBDC 1ZR9A 2A25A 2LCEA 2EPCA 2EP3A 4R2EA 1A1FA 2ELZA 2EMBA 1X3CA 2EOEA 2EN6A 2EOIA 2EOYA 2DGCA 2EM9A 2ENAA 3MHSC 1G2FC 2M9AA 1NCSA 2PRTA 5KL2A 4F6NA 2ADRA 2MKDA 2NABA 4M9VC 4R2DA 4R2QA 1F2IG 1A1KA 2EOOA 2EMXA 5KL5A 2EM2A 4GZNC 2LO3A 2EM5A 2YTGA 2EMGA 2EM8A 2ENCA 1DGCA 2YU5A 2EMLA 2CT1A 2EL5A 4F6MA 2EN8A 1YUIA 1B69A 2MKNA 2WBUA 2EMCA 2EMKA 1MEYC 2EJ4A 2HGHA 1X6HA 2YRHA 2EL6A 2JPAA 2EMZA 2DRPA 3MHHC 2EMFA 2YTPA 2I13A 1KJKA 2EN1A 2DLKA 1X6EA 2YTFA 2EQ1A 1TF6A 2EOZA 1JK1A 2EOMA 4R2CA 2EOJA 2ENHA 2ELYA 2YTNA 4R2PA 1UN6B 1ZAAC 3EPJA 1YUJA 5KL6A 3EPLA 2DMIA 4R2RA 2DLQA 2LT7A 2EPUA 2J7JA 2EMHA 2WBTA 2YRKA 4IJDA 4R2SA 3EPHA 2E72A 2BB8A 2EM6A 2EPPA 2EQ0A 2D9HA 1ZU1A 1TN9A 2YU8A 2VRDA 2YTDA 2RSIA 2YTQA 2EN4A 3EPKA 1JK2A 1BBOA 2EN7A 2EOQA 2EM3A 1YSAC 2EN3A 2YRMA 1WJPA 2LV2A 4WSGA 2YSPA 1LLMC 1X6FA 2EMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN2 A;  2GLI A;  3M99 B;  1X5W A;  2MDG A;  3VHT B;  4F2J C;  2EPR A;  2LVH A;  3UK3 C;  2GHF A;  2WCC 3;  2CSH A;  2WBS A;  1RMD A;  2EOR A;  2CTD A;  4X9J A;  2YSO A;  1A1L A;  2EM4 A;  2EMY A;  4R2A A;  4IS1 C;  2JP9 A;  1G2D C;  2EPX A;  1A1I A;  1BB8 A;  2EOH A;  1A1J A;  2EL4 A;  5KL7 A;  1TF3 A;  1A1H A;  1P47 A;  2EOS A;  2EOF A;  2EMW A;  2YTJ A;  2R1F A;  2EPA A;  2YTE A;  2EPZ A;  1A1G A;  1AAY A;  2YTO A;  2EE8 A;  2EQ3 A;  5KL4 A;  2YTI A;  2EM7 A;  5KL3 A;  2EMI A;  2EM0 A;  1Z1B A;  2RPC A;  2EOX A;  4FK5 C;  1UBD C;  1ZR9 A;  2A25 A;  2LCE A;  2EPC A;  2EP3 A;  4R2E A;  1A1F A;  2ELZ A;  2EMB A;  1X3C A;  2EOE A;  2EN6 A;  2EOI A;  2EOY A;  2DGC A;  2EM9 A;  2ENA A;  3MHS C;  1G2F C;  2M9A A;  1NCS A;  2PRT A;  5KL2 A;  4F6N A;  2ADR A;  2MKD A;  2NAB A;  4M9V C;  4R2D A;  4R2Q A;  1F2I G;  1A1K A;  2EOO A;  2EMX A;  5KL5 A;  2EM2 A;  4GZN C;  2LO3 A;  2EM5 A;  2YTG A;  2EMG A;  2EM8 A;  2ENC A;  1DGC A;  2YU5 A;  2EML A;  2CT1 A;  2EL5 A;  4F6M A;  2EN8 A;  1YUI A;  1B69 A;  2MKN A;  2WBU A;  2EMC A;  2EMK A;  1MEY C;  2EJ4 A;  2HGH A;  1X6H A;  2YRH A;  2EL6 A;  2JPA A;  2EMZ A;  2DRP A;  3MHH C;  2EMF A;  2YTP A;  2I13 A;  1KJK A;  2EN1 A;  2DLK A;  1X6E A;  2YTF A;  2EQ1 A;  1TF6 A;  2EOZ A;  1JK1 A;  2EOM A;  4R2C A;  2EOJ A;  2ENH A;  2ELY A;  2YTN A;  4R2P A;  1UN6 B;  1ZAA C;  3EPJ A;  1YUJ A;  5KL6 A;  3EPL A;  2DMI A;  4R2R A;  2DLQ A;  2LT7 A;  2EPU A;  2J7J A;  2EMH A;  2WBT A;  2YRK A;  4IJD A;  4R2S A;  3EPH A;  2E72 A;  2BB8 A;  2EM6 A;  2EPP A;  2EQ0 A;  2D9H A;  1ZU1 A;  1TN9 A;  2YU8 A;  2VRD A;  2YTD A;  2RSI A;  2YTQ A;  2EN4 A;  3EPK A;  1JK2 A;  1BBO A;  2EN7 A;  2EOQ A;  2EM3 A;  1YSA C;  2EN3 A;  2YRM A;  1WJP A;  2LV2 A;  4WSG A;  2YSP A;  1LLM C;  1X6F A;  2EMA A; 
#chains in the Genus database with same CATH topology
 2EN2 A;  1UIL A;  1YFH A;  1X5W A;  3VHT B;  1EH7 A;  4BBY A;  3IWB A;  3UK3 C;  4Q35 B;  4LF7 E;  2WBS A;  3T1Y E;  2CTD A;  4TUG A;  4X9J A;  1KYQ A;  4P7D A;  4R2A A;  2EMY A;  4I8O A;  2EPX A;  5LLQ A;  3LML A;  1X48 A;  4M0V A;  2LE2 A;  3J7Y p;  2ODR D;  5KL7 A;  1A1I A;  3ADI A;  2EOF A;  2V87 A;  3EQ1 A;  4F9C B;  2CPN A;  2YTE A;  4WSP A;  3BID A;  1A1G A;  2YPN A;  5LMU E;  2HHH E;  5DNY A;  4KHP E;  2KHX A;  4R03 A;  2EQ3 A;  2YTI A;  4ZYH A;  2EM0 A;  3IWD A;  1IQS A;  1HNW E;  2EOX A;  1FJG E;  2H36 X;  3J81 C;  2EMB A;  1X3C A;  2EOE A;  2EN6 A;  2EOI A;  3IWC A;  1G2F C;  2PRT A;  1STU A;  4DV0 E;  2JWO A;  1EH6 A;  2JR1 A;  5IWA E;  5A6J A;  4R2Q A;  4JI7 E;  2JOB A;  2EMX A;  2EPM X;  5A6A A;  5BR8 E;  4GZN C;  3BGH A;  4OOG C;  2LO3 A;  2EPO A;  4DV7 E;  2ENC A;  3H09 A;  2K7I A;  2LUP B;  2LRS A;  4DV3 E;  4F6M A;  4LTY A;  1B69 A;  1YUI A;  3F6H A;  2EJ4 A;  2MC6 A;  4NHR A;  1X6H A;  4DR3 E;  2EL6 A;  2JPA A;  2DRP A;  3MHH C;  2YT4 A;  1KJK A;  5A6K A;  1DI2 A;  2DLK A;  3ADG A;  1SR9 A;  5A69 A;  4JI1 E;  2L2K B;  4F9A B;  2EOJ A;  2ELY A;  1DQ3 A;  1T4N A;  1UN6 B;  3EPJ A;  5AE1 A;  4DMI A;  4R2R A;  1YYW A;  4DUZ E;  4WXC A;  4LF4 E;  2WBT A;  4X65 E;  2YRK A;  2BB8 A;  3P1X A;  2EPP A;  2IHR 1;  1GTK A;  2VQF E;  4WXD A;  2YTD A;  4KWY A;  3J7A G;  4DV5 E;  1WJP A;  2LV2 A;  3VK6 A;  2YSP A;  4K0K E;  3QG5 C;  2GLI A;  2MDG A;  4LF9 E;  2LTR A;  2GHF A;  3KWR A;  4WX9 A;  4LFC E;  1RMD A;  3F6G A;  3JAM C;  4GKJ E;  2EM4 A;  1N3G A;  4F9B B;  1QNT A;  1T4O A;  1TF3 A;  4DV1 E;  1P47 A;  2JYA A;  2JXP A;  3BBG A;  3KZY A;  5IV8 B;  2EPA A;  2EMI A;  1Z1B A;  1BBG A;  2RPC A;  4JI3 E;  3VYX A;  4ZYG A;  4BS9 A;  4DV2 E;  4Q28 A;  1EKZ A;  2F8B A;  2LCE A;  2V8Q B;  2UUC E;  2RS7 A;  1RQ0 A;  4TUI A;  2MDR A;  2DGC A;  3TQM A;  5KL2 A;  2VF1 A;  2L3C A;  3DF6 A;  1PJQ A;  5AAS A;  4L8N A;  3OML A;  4JI5 E;  4M30 A;  5KL5 A;  2YTG A;  4O5G A;  3AV0 A;  2UXB E;  1UHZ A;  4O4K A;  2JY9 A;  2YU5 A;  1L4S A;  2EML A;  1XNR E;  2EL5 A;  2WBU A;  4B3S E;  2EMK A;  1MEY C;  4X64 E;  2Q8U A;  1SFE A;  2DSY A;  4B3T E;  2I13 A;  3HPS A;  2VE7 C;  3J80 C;  2YTF A;  4BC7 A;  2EQ1 A;  2M4I A;  4DR1 E;  1T4L B;  4NXM E;  4M2Z A;  2VQE E;  2LJU A;  3C4B A;  2JOX A;  4L5N C;  4OX9 E;  2EPL X;  1HNX E;  3EPL A;  1IMU A;  3THO B;  4DV6 E;  2KON A;  2EPU A;  3THN A;  2I9I A;  1YYK A;  4B3R E;  4N4R B;  2B3T B;  4R2S A;  2EM6 A;  3C4T A;  2D9H A;  3JU0 A;  1TN9 A;  1ZBQ A;  2VRD A;  2YTQ A;  2YU8 A;  3EPK A;  4DR4 E;  1MGT A;  5ADZ A;  2NUG A;  3BF2 A;  4BMJ A;  2NA2 A;  1LLM C;  4JYA E;  4HEI A;  2EMA A;  5FLX C;  2E5L E;  3HXL A;  2EPR A;  2M1S A;  2LUQ A;  3HPZ A;  2CSH A;  1IBM E;  5A2Q C;  3C6M A;  4JV5 E;  1A1L A;  4IS1 C;  1G2D C;  1BB8 A;  2EL4 A;  2EWL A;  4DUY E;  4DR5 E;  5AE3 A;  2JVA A;  2R1F A;  1HNZ E;  2FV4 B;  1AAY A;  2R76 A;  2KOU A;  2V85 A;  4X62 E;  4ZYD A;  2EM7 A;  1WHQ A;  2F4V E;  2DIX A;  4YHH E;  2L6M A;  4FK5 C;  2A25 A;  2EP3 A;  4R2E A;  1YZ9 A;  3DJW A;  2K4V A;  4LF6 E;  2EM9 A;  3MHS C;  2NUE A;  2M9A A;  1NCS A;  2NUF A;  1QU6 A;  2ADR A;  3KZZ A;  2DMY A;  5AC4 A;  5IXM B;  2UU9 E;  4B3M E;  1WXR A;  1XMQ E;  1IQO A;  1ZBT A;  3L00 A;  3MSW A;  3RMP A;  2EM2 A;  4BC9 A;  4KZS A;  4WFT A;  2EM5 A;  4WYQ B;  4DR2 E;  1GQE A;  2V83 A;  1T39 A;  3C6K A;  1RC7 A;  4JI4 E;  4GEQ B;  4YY3 E;  2HGH A;  2LJH A;  3VYY A;  4NZV A;  1N32 E;  2EMF A;  3LLH A;  4JI2 E;  2EN1 A;  2EZ6 A;  2HC5 A;  2RS6 A;  2YZT A;  3ADL A;  1PJS A;  4R2C A;  4BCA A;  4R2P A;  2YTN A;  3K6Q A;  4ZYE A;  1YUJ A;  5KL6 A;  2B7T A;  1I94 E;  2DMI A;  1WRJ A;  2MC5 A;  2EMH A;  2UUA E;  4LFA E;  3EPH A;  2LBS B;  2E72 A;  2EPK X;  2ODR C;  4F54 A;  2LTS A;  2UXC E;  1NEI A;  1JK2 A;  2M7Q A;  2EN7 A;  2WZO A;  2EOQ A;  2EN3 A;  2DB2 A;  2RQL A;  4X8W A;  1XMO E;  1PJT A;  4WSG A;  4LF8 E;  1X6F A;  5F3W A;  2YWQ A;  5AE2 A;  3M99 B;  2GPI A;  4HTG A;  1YYO A;  4F2J C;  5IT9 C;  2RTX A;  2LVH A;  2WCC 3;  2L33 A;  2L8T A;  4GKK E;  4X66 E;  2EOR A;  2N8X A;  4JI0 E;  2YSO A;  4JI8 E;  2JP9 A;  2N3G A;  2L2N A;  1AH5 A;  2EOH A;  1A1J A;  4O43 A;  1A1H A;  1PKP A;  3HQ1 A;  2EOS A;  2YTJ A;  2EMW A;  5CFF E;  4LFB E;  5TSE A;  2EPZ A;  2RSM A;  1J5E E;  3ADJ A;  1T38 A;  4P78 A;  1N34 E;  2YTO A;  2UUB E;  2B9D A;  2LMZ A;  2EE8 A;  5KL4 A;  4RHB B;  5KL3 A;  2UXD E;  1UBD C;  1ZR9 A;  2L92 A;  2EPC A;  3AUZ A;  1A1F A;  2ELZ A;  2L2M A;  2FTX B;  4O24 A;  1X49 A;  2EOY A;  1FKA E;  4DR7 E;  2EPN A;  2ENA A;  1GZ6 A;  4F6N A;  4R8O A;  2NAB A;  2MKD A;  4M9V C;  4AQY E;  4BHC A;  3T1H E;  4R2D A;  5T6J A;  1F2I G;  1A1K A;  2EOO A;  1O0W A;  4BHB A;  2B7V A;  5A6B A;  4DV4 E;  2EMG A;  2EM8 A;  3ECR A;  1DGC A;  2BBG A;  3OTO E;  3HTX A;  2CT1 A;  4MLV A;  2MKN A;  2E1M A;  2EN8 A;  4LU9 A;  4DKK A;  2EMC A;  2ZM6 E;  2L3J A;  1PDA A;  4MLQ A;  3ZOQ B;  2YRH A;  2EMZ A;  2HJJ A;  1XNQ E;  1IBK E;  1EH8 A;  1WHN A;  2YTP A;  2FGG A;  1X6E A;  1YPN A;  2V89 A;  4RH8 A;  1TF6 A;  2EOZ A;  1JK1 A;  2EOM A;  2V88 A;  3FIG A;  4DR6 E;  2ENH A;  4NXN E;  2V86 A;  1X47 A;  1ZAA C;  5A6B D;  4J8Z A;  2DLQ A;  2LT7 A;  2G7H A;  1J26 A;  5LL6 R;  2J7J A;  1IBL E;  4IJD A;  1N36 E;  1HR0 E;  5LMN E;  2N3H A;  2EQ0 A;  4LF5 E;  1ZU1 A;  2RSI A;  2EN4 A;  1BBO A;  5AC5 A;  2EM3 A;  1YSA C;  2YRM A;  1N33 E;  4JI6 E;  4WPY A;  3JTZ A; 
#chains in the Genus database with same CATH homology
 2EN2 A;  2GLI A;  3M99 B;  1X5W A;  2MDG A;  3VHT B;  4F2J C;  2EPR A;  2LVH A;  3UK3 C;  2GHF A;  2WCC 3;  2CSH A;  2WBS A;  1RMD A;  2EOR A;  2CTD A;  4X9J A;  2YSO A;  1A1L A;  2EM4 A;  2EMY A;  4R2A A;  4IS1 C;  2JP9 A;  1G2D C;  2EPX A;  1A1I A;  1BB8 A;  2EOH A;  1A1J A;  2EL4 A;  5KL7 A;  1TF3 A;  1A1H A;  1P47 A;  2EOS A;  2EOF A;  2EMW A;  2YTJ A;  2R1F A;  2EPA A;  2YTE A;  2EPZ A;  1A1G A;  1AAY A;  2YTO A;  2EE8 A;  2EQ3 A;  5KL4 A;  2YTI A;  2EM7 A;  5KL3 A;  2EMI A;  2EM0 A;  1Z1B A;  2RPC A;  2EOX A;  4FK5 C;  1UBD C;  1ZR9 A;  2A25 A;  2LCE A;  2EPC A;  2EP3 A;  4R2E A;  1A1F A;  2ELZ A;  2EMB A;  1X3C A;  2EOE A;  2EN6 A;  2EOI A;  2EOY A;  2DGC A;  2EM9 A;  2ENA A;  3MHS C;  1G2F C;  2M9A A;  1NCS A;  2PRT A;  5KL2 A;  4F6N A;  2ADR A;  2MKD A;  2NAB A;  4M9V C;  4R2D A;  4R2Q A;  1F2I G;  1A1K A;  2EOO A;  2EMX A;  5KL5 A;  2EM2 A;  4GZN C;  2LO3 A;  2EM5 A;  2YTG A;  2EMG A;  2EM8 A;  2ENC A;  1DGC A;  2YU5 A;  2EML A;  2CT1 A;  2EL5 A;  4F6M A;  2EN8 A;  1YUI A;  1B69 A;  2MKN A;  2WBU A;  2EMC A;  2EMK A;  1MEY C;  2EJ4 A;  2HGH A;  1X6H A;  2YRH A;  2EL6 A;  2JPA A;  2EMZ A;  2DRP A;  3MHH C;  2EMF A;  2YTP A;  2I13 A;  1KJK A;  2EN1 A;  2DLK A;  1X6E A;  2YTF A;  2EQ1 A;  1TF6 A;  2EOZ A;  1JK1 A;  2EOM A;  4R2C A;  2EOJ A;  2ENH A;  2ELY A;  2YTN A;  4R2P A;  1UN6 B;  1ZAA C;  3EPJ A;  1YUJ A;  5KL6 A;  3EPL A;  2DMI A;  4R2R A;  2DLQ A;  2LT7 A;  2EPU A;  2J7J A;  2EMH A;  2WBT A;  2YRK A;  4IJD A;  4R2S A;  3EPH A;  2E72 A;  2BB8 A;  2EM6 A;  2EPP A;  2EQ0 A;  2D9H A;  1ZU1 A;  1TN9 A;  2YU8 A;  2VRD A;  2YTD A;  2RSI A;  2YTQ A;  2EN4 A;  3EPK A;  1JK2 A;  1BBO A;  2EN7 A;  2EOQ A;  2EM3 A;  1YSA C;  2EN3 A;  2YRM A;  1WJP A;  2LV2 A;  4WSG A;  2YSP A;  1LLM C;  1X6F A;  2EMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...