1WHQA

Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords RNA helicase A
total genus 17
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whqA01
4OOGC 1UHZA 2RTXA 2EZ6A 4WFTA 4B3TE 2UU9E 2L2NA 4JI2E 1T4OA 4YHHE 1RC7A 2L3JA 4LF6E 3VYXA 2UXCE 2IHR1 2ZM6E 1XNQE 4DR2E 2B7TA 2VQEE 4DV2E 4JI0E 2NUGA 4DR6E 2RSMA 2JY9A 2B7VA 3LLHA 4X66E 4OX9E 5CFFE 4LF9E 1X48A 2LTRA 2NUFA 1N33E 2MDRA 1IBME 1HR0E 4JI4E 1FJGE 4JI5E 2UUCE 1GQEA 4DKKA 2VQFE 2DMYA 2N3HA 2KHXA 1T4NA 1J5EE 1WHQA 1YYKA 4X62E 4JI8E 1HNXE 1N34E 3ADIA 4DR4E 2L2KB 4JV5E 4B3SE 1DI2A 1QU6A 2UXBE 3C4TA 1PKPA 5LMNE 4NXNE 2DIXA 2LTSA 3ADJA 2JVAA 1I94E 1HNZE 2UXDE 2N3GA 4X65E 4LFAE 3P1XA 4B3RE 1O0WA 3ADGA 2RS7A 2YT4A 4LF5E 2UUBE 5BR8E 3J7Yp 4YY3E 2LJHA 4DR3E 4KHPE 4DV0E 1UILA 2CPNA 3C4BA 2LRSA 1YZ9A 4LF4E 5LMUE 2NA2A 4X8WA 4DV4E 1HNWE 3T1HE 1ZBTA 4K0KE 3VYYA 4DV3E 2E5LE 4JI1E 2UUAE 1X47A 1T4LB 2L3CA 2L33A 4DV1E 1N36E 4DUZE 4M30A 4X64E 4GKJE 4JI6E 3OTOE 3T1YE 3HTXA 4DV6E 2LBSB 1WHNA 4GKKE 4DV7E 4LFBE 4DUYE 1XNRE 4LF7E 4M2ZA 1YYOA 2HHHE 2L2MA 5IWAE 1XMQE 4WYQB 2NUEA 4DR5E 3ADLA 1XMOE 1IBKE 2DB2A 4JYAE 2RS6A 1X49A 4LF8E 1EKZA 2LUQA 2F4VE 4AQYE 1FKAE 2LUPB 4LFCE 4B3ME 1N32E 1YYWA 1RQ0A 4JI7E 2B3TB 4DR1E 1J26A 4NXME 4DV5E 4JI3E 1STUA 1IBLE 4DR7E
chains in the Genus database with same CATH superfamily
2V85A 4OOGC 5AC5A 5T6JA 4YHHE 2EOFA 2EM8A 2ADRA 2MDGA 1WJPA 4ZYEA 1WXRA 2LO3A 2ZM6E 3BBGA 3F6HA 2VQEE 4JI0E 4R2SA 5A6BD 2I9IA 2E72A 3LLHA 2GPIA 4X66E 2KOUA 2HGHA 1X5WA 5IV8B 3EPKA 2YWQA 2A25A 4JI4E 2EOSA 4JI5E 2UUCE 2ENCA 2CT1A 4O5GA 4P78A 2K7IA 3EPLA 5DNYA 2LCEA 1X3CA 2BB8A 4B3SE 1QU6A 1PKPA 2E1MA 2DIXA 3ADJA 1NCSA 2JVAA 2YSPA 4R2DA 2N3GA 4X65E 2D9HA 2WZOA 2EM2A 2YTPA 2FGGA 2RSIA 1NEIA 2FV4B 2EQ3A 3J7Yp 4YY3E 2LJHA 2EOJA 4DR3E 4F6MA 4KHPE 2LE2A 2JWOA 1G2FC 1P47A 5TSEA 2ODRD 1YUJA 2EN4A 5LMUE 4X8WA 1HNWE 3T1HE 4HTGA 1KJKA 4F54A 2E5LE 4BC9A 2L3CA 4DV1E 4BHCA 1SR9A 5KL4A 4BS9A 4X64E 2EM4A 3RMPA 1N36E 3JU0A 3JTZA 1GTKA 2N8XA 2EM0A 1X6EA 2EPMX 4GKKE 4DV7E 4LFBE 4DUYE 3ECRA 1YYOA 4RHBB 1IBKE 4JYAE 2JR1A 3AUZA 2EOXA 4FK5C 3BF2A 5F3WA 1YPNA 3EPJA 4ZYDA 2YSOA 2EL4A 2L8TA 4O24A 4BC7A 4LFCE 4B3ME 2RPCA 4DR1E 4L5NC 1LLMC 4NXME 2ENHA 2RQLA 5AE2A 5IT9C 1IQOA 1A1JA 2RTXA 4ZYHA 4X9JA 2NABA 2YTEA 2L2NA 2LMZA 4RH8A 2CTDA 2WBTA 1BBGA 2EMAA 2DLKA 5AE1A 4GEQB 4NZVA 2UXCE 2YTGA 2IHR1 1XNQE 2EORA 2NUGA 3C6MA 2RSMA 2JY9A 2B7VA 2EPRA 4LF9E 1X48A 1PJQA 3TQMA 1N33E 1GZ6A 2YPNA 5A6AA 1HR0E 1FJGE 1PJTA 2Q8UA 4DKKA 4R8OA 3F6GA 2KHXA 1T4NA 3MHHC 1MGTA 1N34E 4DR4E 2L2KB 2ELZA 2DMIA 2G7HA 1PJSA 2EMHA 4NXNE 2JPAA 2FTXB 1I94E 1G2DC 1HNZE 2YTQA 3BIDA 1TF3A 4B3RE 4WXDA 2RS7A 1X6FA 4LF5E 2JXPA 2I13A 2UUBE 1ZU1A 2DRPA 2WBUA 3DF6A 1UILA 2ENAA 3C4BA 1A1IA 2LRSA 2YTFA 2EMBA 2V89A 2V88A 4DV4E 3C6KA 1AH5A 2EPPA 2M7QA 4DV3E 1UN6B 2EOEA 1RMDA 3EPHA 4GKJE 2EOQA 3JAMC 4BCAA 3DJWA 2DSYA 4DV6E 1WHNA 2EMYA 3EQ1A 2J7JA 4J8ZA 2EQ1A 1XNRE 2JOXA 1KYQA 2L2MA 2MKNA 4WYQB 2R76A 4DMIA 2NUEA 4R03A 2EN8A 4GZNC 1X49A 3KWRA 3THNA 2F4VE 3UK3C 2EM6A 2DGCA 1N32E 2M4IA 4JI7E 2B3TB 2EN7A 2EM3A 3QG5C 2YTOA 1J26A 1Z1BA 3MSWA 4DV5E 1STUA 1IBLE 5AE3A 1TF6A 4B3TE 1SFEA 4I8OA 2UU9E 2EM9A 4O43A 2YTDA 2EPNA 1BB8A 2L6MA 5KL3A 1A1FA 3VYXA 4F2JC 2EM5A 1F2IG 2ELYA 2V87A 1A1LA 1DGCA 3M99B 4OX9E 2V86A 3ZOQB 2DLQA 2LTRA 2EOMA 2VRDA 2EMCA 1X6HA 2NUFA 3IWCA 2EM7A 4WXCA 2EN2A 3THOB 3L00A 3IWDA 1GQEA 2H36X 2N3HA 5KL7A 3HPSA 4R2CA 4R2QA 2EL5A 3ADIA 1EH7A 2JP9A 3OMLA 4JV5E 4WX9A 1DI2A 1B69A 2EOZA 3C4TA 4R2PA 3FIGA 2EP3A 1YUIA 2LTSA 1A1GA 4LU9A 4LFAE 5FLXC 2EE8A 2YTIA 5LLQA 5A6JA 5BR8E 2EOHA 2YU8A 2YRKA 3KZYA 4IJDA 1YFHA 4M9VC 2EOYA 2CSHA 2CPNA 1T38A 2EOIA 2EQ0A 2V83A 1YZ9A 2WCC3 4R2EA 2NA2A 2EPKX 2EJ4A 4BHBA 1UBDC 3AV0A 2EN6A 1QNTA 1BBOA 2R1FA 1X47A 1T4LB 2HC5A 2L33A 2EPXA 2EMZA 5A2QC 4Q35B 3HTXA 2EMKA 5LL6R 1MEYC 4LF7E 4M2ZA 1N3GA 1YSAC 2HHHE 1JK2A 2B9DA 4DR5E 2LT7A 2DB2A 4NHRA 1IMUA 2EPLX 3KZZA 1ZAAC 4R2RA 3IWBA 4LF8E 2EN1A 3VK6A 2EMXA 2YTNA 2EPAA 1FKAE 4KZSA 4HEIA 1DQ3A 4R2AA 1YYWA 1RQ0A 2HJJA 4ZYGA 2EWLA 3J7AG 2EPUA 2L92A 5A6BA 1UHZA 2EZ6A 4WPYA 2MC6A 4WFTA 1TN9A 5A69A 2VE7C 4JI2E 1T4OA 2KONA 2WBSA 1WRJA 1AAYA 4TUIA 1RC7A 2L3JA 2GLIA 4LF6E 2EOOA 4F9CB 5IXMB 4DR2E 2B7TA 4DV2E 1PDAA 4DR6E 2EPZA 5CFFE 4L8NA 5AC4A 2M9AA 3BGHA 2MDRA 1IBME 2YRMA 1EH6A 3J80C 2VQFE 2DMYA 2LV2A 4MLVA 3VHTB 1J5EE 1WHQA 2YRHA 3K6QA 1YYKA 4O4KA 4X62E 4JI8E 5AASA 1HNXE 3HQ1A 2LVHA 5KL2A 2UXBE 1A1HA 2EPCA 2GHFA 5LMNE 4MLQA 2UXDE 4TUGA 2EPOA 3P1XA 1O0WA 3ADGA 2YT4A 4WSGA 2YU5A 4IS1C 4BBYA 5KL6A 4DV0E 2EMLA 4P7DA 2EMWA 2MKDA 4LTYA 3J81C 4LF4E 3LMLA 1L4SA 1ZBTA 3MHSC 3H09A 4K0KE 3VYYA 1JK1A 2PRTA 2MC5A 4F9AB 4JI1E 2UUAE 2ODRC 2JOBA 4DUZE 4M30A 2BBGA 4JI6E 3OTOE 3T1YE 4M0VA 2LBSB 1IQSA 2YTJA 2LJUA 1T39A 5KL5A 1ZBQA 1EH8A 2EMFA 1XMQE 5IWAE 3ADLA 1XMOE 2M1SA 3HPZA 5A6KA 5ADZA 2EN3A 2RS6A 1ZR9A 2YZTA 1EKZA 2K4VA 2LUQA 4N4RB 2EMIA 2V8QB 4AQYE 4KWYA 2F8BA 3HXLA 4WSPA 2LUPB 2EMGA 2EL6A 4Q28A 4F6NA 1A1KA 4F9BB 4BMJA 2VF1A 4JI3E 2JYAA 4DR7E
chains in the Genus database with same CATH topology
2V85A 1UHZA 4OOGC 2RTXA 4WPYA 2EZ6A 2MC6A 4WFTA 4B3TE 4I8OA 2UU9E 2VE7C 2L2NA 2LMZA 5T6JA 1T4OA 4JI2E 2KONA 4YHHE 2L6MA 4TUIA 1RC7A 5AE1A 4GEQB 2L3JA 4LF6E 1WXRA 3VYXA 2UXCE 4F9CB 2IHR1 2ZM6E 1XNQE 4DR2E 2B7TA 3F6HA 2VQEE 4DV2E 4JI0E 2NUGA 4DR6E 2RSMA 2JY9A 2B7VA 3LLHA 2V87A 4X66E 4OX9E 2V86A 5CFFE 4LF9E 4L8NA 1X48A 2LTRA 2KOUA 3ZOQB 2NUFA 3IWCA 1N33E 1GZ6A 2MDRA 1IBME 1HR0E 4JI4E 1FJGE 4JI5E 2UUCE 3J80C 3IWDA 1GQEA 4GKJE 2H36X 4DKKA 2VQFE 2DMYA 2N3HA 4R8OA 3F6GA 2KHXA 1T4NA 1J5EE 3HPSA 4P78A 1WHQA 3K6QA 1YYKA 5DNYA 4X62E 4JI8E 5AASA 1HNXE 1N34E 3ADIA 4DR4E 2L2KB 3HQ1A 3OMLA 1IBLE 4JV5E 4B3SE 1DI2A 1QU6A 2UXBE 3C4TA 1PKPA 3FIGA 2E1MA 2G7HA 5LMNE 4NXNE 2DIXA 2LTSA 3ADJA 2FTXB 2JVAA 1I94E 1HNZE 2N3GA 4TUGA 4LU9A 4X65E 2UXDE 4LFAE 3P1XA 5FLXC 2WZOA 4B3RE 1O0WA 2FGGA 2RS7A 3ADGA 2YT4A 2FV4B 4LF5E 2UUBE 5BR8E 4BBYA 4YY3E 3J7Yp 2LJHA 4DR3E 4KHPE 4DV0E 2LE2A 4P7DA 2JWOA 4LTYA 3DF6A 1UILA 2CPNA 3C4BA 2LRSA 3J81C 2V89A 2V83A 4LF4E 1YZ9A 2ODRD 3LMLA 2V88A 5LMUE 2NA2A 4X8WA 4DV4E 1HNWE 3T1HE 1ZBTA 3AV0A 3H09A 3VYYA 4K0KE 2M7QA 4DV3E 2MC5A 4F54A 4F9AB 2E5LE 2UUAE 1X47A 2ODRC 1T4LB 4JI1E 2JOBA 4BC9A 2L3CA 2L33A 4DV1E 1SR9A 1N36E 4BS9A 4M30A 4X64E 4DUZE 3RMPA 3JU0A 3JAMC 4JI6E 4BCAA 3DJWA 5A2QC 3JTZA 3OTOE 4M0VA 2DSYA 4DV6E 3T1YE 2LBSB 1WHNA 3HTXA 5LL6R 4GKKE 4J8ZA 4DV7E 4LFBE 4DUYE 1ZBQA 1XNRE 4LF7E 2JOXA 4M2ZA 1YYOA 2HHHE 2L2MA 5IWAE 1XMQE 2B9DA 4WYQB 4DMIA 4DR5E 2NUEA 3ADLA 1XMOE 4R03A 1IBKE 2DB2A 2M1SA 3HPZA 5ADZA 4JYAE 2JR1A 2RS6A 3AUZA 1X49A 3IWBA 2YZTA 1EKZA 4LF8E 2K4VA 5F3WA 2LUQA 3KWRA 2V8QB 3VK6A 2F4VE 4AQYE 2F8BA 3HXLA 4WSPA 2L8TA 4BC7A 2LUPB 4Q28A 4KZSA 1FKAE 4B3ME 4LFCE 1DQ3A 1N32E 1YYWA 1RQ0A 2M4IA 4JI7E 2B3TB 4DR1E 4L5NC 2EWLA 1J26A 4NXME 3J7AG 4F9BB 3MSWA 4BMJA 2VF1A 5AE2A 4DV5E 1STUA 5IT9C 2L92A 4JI3E 5AE3A 4DR7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OOG C;  1UHZ A;  2RTX A;  2EZ6 A;  4WFT A;  4B3T E;  2UU9 E;  2L2N A;  4JI2 E;  1T4O A;  4YHH E;  1RC7 A;  2L3J A;  4LF6 E;  3VYX A;  2UXC E;  2IHR 1;  2ZM6 E;  1XNQ E;  4DR2 E;  2B7T A;  2VQE E;  4DV2 E;  4JI0 E;  2NUG A;  4DR6 E;  2RSM A;  2JY9 A;  2B7V A;  3LLH A;  4X66 E;  4OX9 E;  5CFF E;  4LF9 E;  1X48 A;  2LTR A;  2NUF A;  1N33 E;  2MDR A;  1IBM E;  1HR0 E;  4JI4 E;  1FJG E;  4JI5 E;  2UUC E;  1GQE A;  4DKK A;  2VQF E;  2DMY A;  2N3H A;  2KHX A;  1T4N A;  1J5E E;  1WHQ A;  1YYK A;  4X62 E;  4JI8 E;  1HNX E;  1N34 E;  3ADI A;  4DR4 E;  2L2K B;  4JV5 E;  4B3S E;  1DI2 A;  1QU6 A;  2UXB E;  3C4T A;  1PKP A;  5LMN E;  4NXN E;  2DIX A;  2LTS A;  3ADJ A;  2JVA A;  1I94 E;  1HNZ E;  2UXD E;  2N3G A;  4X65 E;  4LFA E;  3P1X A;  4B3R E;  1O0W A;  3ADG A;  2RS7 A;  2YT4 A;  4LF5 E;  2UUB E;  5BR8 E;  3J7Y p;  4YY3 E;  2LJH A;  4DR3 E;  4KHP E;  4DV0 E;  1UIL A;  2CPN A;  3C4B A;  2LRS A;  1YZ9 A;  4LF4 E;  5LMU E;  2NA2 A;  4X8W A;  4DV4 E;  1HNW E;  3T1H E;  1ZBT A;  4K0K E;  3VYY A;  4DV3 E;  2E5L E;  4JI1 E;  2UUA E;  1X47 A;  1T4L B;  2L3C A;  2L33 A;  4DV1 E;  1N36 E;  4DUZ E;  4M30 A;  4X64 E;  4GKJ E;  4JI6 E;  3OTO E;  3T1Y E;  3HTX A;  4DV6 E;  2LBS B;  1WHN A;  4GKK E;  4DV7 E;  4LFB E;  4DUY E;  1XNR E;  4LF7 E;  4M2Z A;  1YYO A;  2HHH E;  2L2M A;  5IWA E;  1XMQ E;  4WYQ B;  2NUE A;  4DR5 E;  3ADL A;  1XMO E;  1IBK E;  2DB2 A;  4JYA E;  2RS6 A;  1X49 A;  4LF8 E;  1EKZ A;  2LUQ A;  2F4V E;  4AQY E;  1FKA E;  2LUP B;  4LFC E;  4B3M E;  1N32 E;  1YYW A;  1RQ0 A;  4JI7 E;  2B3T B;  4DR1 E;  1J26 A;  4NXM E;  4DV5 E;  4JI3 E;  1STU A;  1IBL E;  4DR7 E; 
#chains in the Genus database with same CATH topology
 2V85 A;  4OOG C;  5AC5 A;  5T6J A;  4YHH E;  2EOF A;  2EM8 A;  2ADR A;  2MDG A;  1WJP A;  4ZYE A;  1WXR A;  2LO3 A;  2ZM6 E;  3BBG A;  3F6H A;  2VQE E;  4JI0 E;  4R2S A;  5A6B D;  2I9I A;  2E72 A;  3LLH A;  2GPI A;  4X66 E;  2KOU A;  2HGH A;  1X5W A;  5IV8 B;  3EPK A;  2YWQ A;  2A25 A;  4JI4 E;  2EOS A;  4JI5 E;  2UUC E;  2ENC A;  2CT1 A;  4O5G A;  4P78 A;  2K7I A;  3EPL A;  5DNY A;  2LCE A;  1X3C A;  2BB8 A;  4B3S E;  1QU6 A;  1PKP A;  2E1M A;  2DIX A;  3ADJ A;  1NCS A;  2JVA A;  2YSP A;  4R2D A;  2N3G A;  4X65 E;  2D9H A;  2WZO A;  2EM2 A;  2YTP A;  2FGG A;  2RSI A;  1NEI A;  2FV4 B;  2EQ3 A;  3J7Y p;  4YY3 E;  2LJH A;  2EOJ A;  4DR3 E;  4F6M A;  4KHP E;  2LE2 A;  2JWO A;  1G2F C;  1P47 A;  5TSE A;  2ODR D;  1YUJ A;  2EN4 A;  5LMU E;  4X8W A;  1HNW E;  3T1H E;  4HTG A;  1KJK A;  4F54 A;  2E5L E;  4BC9 A;  2L3C A;  4DV1 E;  4BHC A;  1SR9 A;  5KL4 A;  4BS9 A;  4X64 E;  2EM4 A;  3RMP A;  1N36 E;  3JU0 A;  3JTZ A;  1GTK A;  2N8X A;  2EM0 A;  1X6E A;  2EPM X;  4GKK E;  4DV7 E;  4LFB E;  4DUY E;  3ECR A;  1YYO A;  4RHB B;  1IBK E;  4JYA E;  2JR1 A;  3AUZ A;  2EOX A;  4FK5 C;  3BF2 A;  5F3W A;  1YPN A;  3EPJ A;  4ZYD A;  2YSO A;  2EL4 A;  2L8T A;  4O24 A;  4BC7 A;  4LFC E;  4B3M E;  2RPC A;  4DR1 E;  4L5N C;  1LLM C;  4NXM E;  2ENH A;  2RQL A;  5AE2 A;  5IT9 C;  1IQO A;  1A1J A;  2RTX A;  4ZYH A;  4X9J A;  2NAB A;  2YTE A;  2L2N A;  2LMZ A;  4RH8 A;  2CTD A;  2WBT A;  1BBG A;  2EMA A;  2DLK A;  5AE1 A;  4GEQ B;  4NZV A;  2UXC E;  2YTG A;  2IHR 1;  1XNQ E;  2EOR A;  2NUG A;  3C6M A;  2RSM A;  2JY9 A;  2B7V A;  2EPR A;  4LF9 E;  1X48 A;  1PJQ A;  3TQM A;  1N33 E;  1GZ6 A;  2YPN A;  5A6A A;  1HR0 E;  1FJG E;  1PJT A;  2Q8U A;  4DKK A;  4R8O A;  3F6G A;  2KHX A;  1T4N A;  3MHH C;  1MGT A;  1N34 E;  4DR4 E;  2L2K B;  2ELZ A;  2DMI A;  2G7H A;  1PJS A;  2EMH A;  4NXN E;  2JPA A;  2FTX B;  1I94 E;  1G2D C;  1HNZ E;  2YTQ A;  3BID A;  1TF3 A;  4B3R E;  4WXD A;  2RS7 A;  1X6F A;  4LF5 E;  2JXP A;  2I13 A;  2UUB E;  1ZU1 A;  2DRP A;  2WBU A;  3DF6 A;  1UIL A;  2ENA A;  3C4B A;  1A1I A;  2LRS A;  2YTF A;  2EMB A;  2V89 A;  2V88 A;  4DV4 E;  3C6K A;  1AH5 A;  2EPP A;  2M7Q A;  4DV3 E;  1UN6 B;  2EOE A;  1RMD A;  3EPH A;  4GKJ E;  2EOQ A;  3JAM C;  4BCA A;  3DJW A;  2DSY A;  4DV6 E;  1WHN A;  2EMY A;  3EQ1 A;  2J7J A;  4J8Z A;  2EQ1 A;  1XNR E;  2JOX A;  1KYQ A;  2L2M A;  2MKN A;  4WYQ B;  2R76 A;  4DMI A;  2NUE A;  4R03 A;  2EN8 A;  4GZN C;  1X49 A;  3KWR A;  3THN A;  2F4V E;  3UK3 C;  2EM6 A;  2DGC A;  1N32 E;  2M4I A;  4JI7 E;  2B3T B;  2EN7 A;  2EM3 A;  3QG5 C;  2YTO A;  1J26 A;  1Z1B A;  3MSW A;  4DV5 E;  1STU A;  1IBL E;  5AE3 A;  1TF6 A;  4B3T E;  1SFE A;  4I8O A;  2UU9 E;  2EM9 A;  4O43 A;  2YTD A;  2EPN A;  1BB8 A;  2L6M A;  5KL3 A;  1A1F A;  3VYX A;  4F2J C;  2EM5 A;  1F2I G;  2ELY A;  2V87 A;  1A1L A;  1DGC A;  3M99 B;  4OX9 E;  2V86 A;  3ZOQ B;  2DLQ A;  2LTR A;  2EOM A;  2VRD A;  2EMC A;  1X6H A;  2NUF A;  3IWC A;  2EM7 A;  4WXC A;  2EN2 A;  3THO B;  3L00 A;  3IWD A;  1GQE A;  2H36 X;  2N3H A;  5KL7 A;  3HPS A;  4R2C A;  4R2Q A;  2EL5 A;  3ADI A;  1EH7 A;  2JP9 A;  3OML A;  4JV5 E;  4WX9 A;  1DI2 A;  1B69 A;  2EOZ A;  3C4T A;  4R2P A;  3FIG A;  2EP3 A;  1YUI A;  2LTS A;  1A1G A;  4LU9 A;  4LFA E;  5FLX C;  2EE8 A;  2YTI A;  5LLQ A;  5A6J A;  5BR8 E;  2EOH A;  2YU8 A;  2YRK A;  3KZY A;  4IJD A;  1YFH A;  4M9V C;  2EOY A;  2CSH A;  2CPN A;  1T38 A;  2EOI A;  2EQ0 A;  2V83 A;  1YZ9 A;  2WCC 3;  4R2E A;  2NA2 A;  2EPK X;  2EJ4 A;  4BHB A;  1UBD C;  3AV0 A;  2EN6 A;  1QNT A;  1BBO A;  2R1F A;  1X47 A;  1T4L B;  2HC5 A;  2L33 A;  2EPX A;  2EMZ A;  5A2Q C;  4Q35 B;  3HTX A;  2EMK A;  5LL6 R;  1MEY C;  4LF7 E;  4M2Z A;  1N3G A;  1YSA C;  2HHH E;  1JK2 A;  2B9D A;  4DR5 E;  2LT7 A;  2DB2 A;  4NHR A;  1IMU A;  2EPL X;  3KZZ A;  1ZAA C;  4R2R A;  3IWB A;  4LF8 E;  2EN1 A;  3VK6 A;  2EMX A;  2YTN A;  2EPA A;  1FKA E;  4KZS A;  4HEI A;  1DQ3 A;  4R2A A;  1YYW A;  1RQ0 A;  2HJJ A;  4ZYG A;  2EWL A;  3J7A G;  2EPU A;  2L92 A;  5A6B A;  1UHZ A;  2EZ6 A;  4WPY A;  2MC6 A;  4WFT A;  1TN9 A;  5A69 A;  2VE7 C;  4JI2 E;  1T4O A;  2KON A;  2WBS A;  1WRJ A;  1AAY A;  4TUI A;  1RC7 A;  2L3J A;  2GLI A;  4LF6 E;  2EOO A;  4F9C B;  5IXM B;  4DR2 E;  2B7T A;  4DV2 E;  1PDA A;  4DR6 E;  2EPZ A;  5CFF E;  4L8N A;  5AC4 A;  2M9A A;  3BGH A;  2MDR A;  1IBM E;  2YRM A;  1EH6 A;  3J80 C;  2VQF E;  2DMY A;  2LV2 A;  4MLV A;  3VHT B;  1J5E E;  1WHQ A;  2YRH A;  3K6Q A;  1YYK A;  4O4K A;  4X62 E;  4JI8 E;  5AAS A;  1HNX E;  3HQ1 A;  2LVH A;  5KL2 A;  2UXB E;  1A1H A;  2EPC A;  2GHF A;  5LMN E;  4MLQ A;  2UXD E;  4TUG A;  2EPO A;  3P1X A;  1O0W A;  3ADG A;  2YT4 A;  4WSG A;  2YU5 A;  4IS1 C;  4BBY A;  5KL6 A;  4DV0 E;  2EML A;  4P7D A;  2EMW A;  2MKD A;  4LTY A;  3J81 C;  4LF4 E;  3LML A;  1L4S A;  1ZBT A;  3MHS C;  3H09 A;  4K0K E;  3VYY A;  1JK1 A;  2PRT A;  2MC5 A;  4F9A B;  4JI1 E;  2UUA E;  2ODR C;  2JOB A;  4DUZ E;  4M30 A;  2BBG A;  4JI6 E;  3OTO E;  3T1Y E;  4M0V A;  2LBS B;  1IQS A;  2YTJ A;  2LJU A;  1T39 A;  5KL5 A;  1ZBQ A;  1EH8 A;  2EMF A;  1XMQ E;  5IWA E;  3ADL A;  1XMO E;  2M1S A;  3HPZ A;  5A6K A;  5ADZ A;  2EN3 A;  2RS6 A;  1ZR9 A;  2YZT A;  1EKZ A;  2K4V A;  2LUQ A;  4N4R B;  2EMI A;  2V8Q B;  4AQY E;  4KWY A;  2F8B A;  3HXL A;  4WSP A;  2LUP B;  2EMG A;  2EL6 A;  4Q28 A;  4F6N A;  1A1K A;  4F9B B;  4BMJ A;  2VF1 A;  4JI3 E;  2JYA A;  4DR7 E; 
#chains in the Genus database with same CATH homology
 2V85 A;  1UHZ A;  4OOG C;  2RTX A;  4WPY A;  2EZ6 A;  2MC6 A;  4WFT A;  4B3T E;  4I8O A;  2UU9 E;  2VE7 C;  2L2N A;  2LMZ A;  5T6J A;  1T4O A;  4JI2 E;  2KON A;  4YHH E;  2L6M A;  4TUI A;  1RC7 A;  5AE1 A;  4GEQ B;  2L3J A;  4LF6 E;  1WXR A;  3VYX A;  2UXC E;  4F9C B;  2IHR 1;  2ZM6 E;  1XNQ E;  4DR2 E;  2B7T A;  3F6H A;  2VQE E;  4DV2 E;  4JI0 E;  2NUG A;  4DR6 E;  2RSM A;  2JY9 A;  2B7V A;  3LLH A;  2V87 A;  4X66 E;  4OX9 E;  2V86 A;  5CFF E;  4LF9 E;  4L8N A;  1X48 A;  2LTR A;  2KOU A;  3ZOQ B;  2NUF A;  3IWC A;  1N33 E;  1GZ6 A;  2MDR A;  1IBM E;  1HR0 E;  4JI4 E;  1FJG E;  4JI5 E;  2UUC E;  3J80 C;  3IWD A;  1GQE A;  4GKJ E;  2H36 X;  4DKK A;  2VQF E;  2DMY A;  2N3H A;  4R8O A;  3F6G A;  2KHX A;  1T4N A;  1J5E E;  3HPS A;  4P78 A;  1WHQ A;  3K6Q A;  1YYK A;  5DNY A;  4X62 E;  4JI8 E;  5AAS A;  1HNX E;  1N34 E;  3ADI A;  4DR4 E;  2L2K B;  3HQ1 A;  3OML A;  1IBL E;  4JV5 E;  4B3S E;  1DI2 A;  1QU6 A;  2UXB E;  3C4T A;  1PKP A;  3FIG A;  2E1M A;  2G7H A;  5LMN E;  4NXN E;  2DIX A;  2LTS A;  3ADJ A;  2FTX B;  2JVA A;  1I94 E;  1HNZ E;  2N3G A;  4TUG A;  4LU9 A;  4X65 E;  2UXD E;  4LFA E;  3P1X A;  5FLX C;  2WZO A;  4B3R E;  1O0W A;  2FGG A;  2RS7 A;  3ADG A;  2YT4 A;  2FV4 B;  4LF5 E;  2UUB E;  5BR8 E;  4BBY A;  4YY3 E;  3J7Y p;  2LJH A;  4DR3 E;  4KHP E;  4DV0 E;  2LE2 A;  4P7D A;  2JWO A;  4LTY A;  3DF6 A;  1UIL A;  2CPN A;  3C4B A;  2LRS A;  3J81 C;  2V89 A;  2V83 A;  4LF4 E;  1YZ9 A;  2ODR D;  3LML A;  2V88 A;  5LMU E;  2NA2 A;  4X8W A;  4DV4 E;  1HNW E;  3T1H E;  1ZBT A;  3AV0 A;  3H09 A;  3VYY A;  4K0K E;  2M7Q A;  4DV3 E;  2MC5 A;  4F54 A;  4F9A B;  2E5L E;  2UUA E;  1X47 A;  2ODR C;  1T4L B;  4JI1 E;  2JOB A;  4BC9 A;  2L3C A;  2L33 A;  4DV1 E;  1SR9 A;  1N36 E;  4BS9 A;  4M30 A;  4X64 E;  4DUZ E;  3RMP A;  3JU0 A;  3JAM C;  4JI6 E;  4BCA A;  3DJW A;  5A2Q C;  3JTZ A;  3OTO E;  4M0V A;  2DSY A;  4DV6 E;  3T1Y E;  2LBS B;  1WHN A;  3HTX A;  5LL6 R;  4GKK E;  4J8Z A;  4DV7 E;  4LFB E;  4DUY E;  1ZBQ A;  1XNR E;  4LF7 E;  2JOX A;  4M2Z A;  1YYO A;  2HHH E;  2L2M A;  5IWA E;  1XMQ E;  2B9D A;  4WYQ B;  4DMI A;  4DR5 E;  2NUE A;  3ADL A;  1XMO E;  4R03 A;  1IBK E;  2DB2 A;  2M1S A;  3HPZ A;  5ADZ A;  4JYA E;  2JR1 A;  2RS6 A;  3AUZ A;  1X49 A;  3IWB A;  2YZT A;  1EKZ A;  4LF8 E;  2K4V A;  5F3W A;  2LUQ A;  3KWR A;  2V8Q B;  3VK6 A;  2F4V E;  4AQY E;  2F8B A;  3HXL A;  4WSP A;  2L8T A;  4BC7 A;  2LUP B;  4Q28 A;  4KZS A;  1FKA E;  4B3M E;  4LFC E;  1DQ3 A;  1N32 E;  1YYW A;  1RQ0 A;  2M4I A;  4JI7 E;  2B3T B;  4DR1 E;  4L5N C;  2EWL A;  1J26 A;  4NXM E;  3J7A G;  4F9B B;  3MSW A;  4BMJ A;  2VF1 A;  5AE2 A;  4DV5 E;  1STU A;  5IT9 C;  2L92 A;  4JI3 E;  5AE3 A;  4DR7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...