1WHQA

Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords RNA helicase A
total genus 17
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whqA01
4DR1E 1HNWE 4JI3E 2NA2A 1XMOE 1EKZA 2L2KB 1X48A 4WYQB 1HNXE 4OX9E 4GKKE 4LF8E 2RTXA 4DV6E 1XNRE 2DB2A 1FKAE 3C4BA 1YYOA 1UILA 3T1YE 4M30A 4K0KE 4JV5E 2L33A 1J26A 2VQEE 4DR3E 2EZ6A 4DR6E 4X8WA 5BR8E 2LUPB 1WHNA 1N34E 4B3RE 4DV2E 3ADJA 3T1HE 2N3HA 2E5LE 4JI0E 2L2MA 3P1XA 3J7Yp 4WFTA 1N36E 4DR5E 1IBME 4B3TE 3ADGA 2KHXA 1N33E 2UXBE 2JVAA 2LBSB 4DR2E 4KHPE 4DV3E 3ADLA 2ZM6E 4LF5E 1PKPA 1T4LB 1J5EE 2DIXA 4OOGC 4B3ME 4JI8E 4X62E 2MDRA 1HNZE 4AQYE 1N32E 1IBKE 5LMUE 5IWAE 2UUCE 2B3TB 3VYXA 4JYAE 1X47A 1IBLE 2DMYA 1ZBTA 2HHHE 2NUGA 2VQFE 4NXNE 2LJHA 1QU6A 1RQ0A 4JI4E 4X65E 4LFAE 2LRSA 2CPNA 2L3JA 1GQEA 2RSMA 4LF6E 4YHHE 2NUEA 2L2NA 2UXDE 2UUAE 1HR0E 4YY3E 1T4NA 2UU9E 4LFBE 2JY9A 1RC7A 2LTRA 4LFCE 4DR7E 2UUBE 3LLHA 4DR4E 4DV4E 2LUQA 4DV7E 4LF4E 4JI7E 1X49A 2B7VA 2NUFA 2B7TA 4JI1E 4X64E 1T4OA 1WHQA 4X66E 3C4TA 4M2ZA 3ADIA 4DV1E 4DV0E 4JI2E 1XMQE 1O0WA 2LTSA 3OTOE 4B3SE 2F4VE 1UHZA 2N3GA 1YZ9A 5LMNE 2YT4A 5CFFE 4DUZE 4LF7E 4GKJE 4DUYE 4JI6E 4JI5E 2IHR1 4LF9E 1YYKA 2RS6A 2L3CA 3HTXA 1XNQE 4DKKA 1STUA 4NXME 1I94E 1YYWA 2RS7A 2UXCE 3VYYA 1FJGE 1DI2A 4DV5E
chains in the Genus database with same CATH superfamily
5LLQA 4DR1E 4MLVA 5A2QC 1HNWE 2LCEA 1A1LA 4WYQB 1RMDA 4ZYDA 4GKKE 4LF8E 3VHTB 2YRMA 1FKAE 1YPNA 2EM2A 2EMXA 4K0KE 4JV5E 2ELZA 2L33A 2EOSA 2EM7A 2V8QB 2YRHA 1GTKA 2K4VA 5BR8E 2LV2A 1WHNA 1DGCA 4WPYA 4WXCA 2EQ0A 2N3HA 3K6QA 2E5LE 2E1MA 2EQ3A 2V83A 3J7Yp 4B3TE 1TN9A 1PJSA 2VE7C 1YSAC 1WRJA 2LVHA 4N4RB 2JVAA 2LBSB 2EN4A 3EPJA 2ZM6E 5KL2A 1T4LB 4R2CA 1WXRA 4JI8E 1X6FA 2RSIA 2YWQA 4BHBA 2MDRA 2DGCA 1HNZE 4AQYE 1IBKE 2M9AA 3BBGA 4R2EA 5KL3A 2YTFA 3VYXA 3C6KA 1TF6A 2HHHE 4R2QA 4NXNE 2NUGA 2JP9A 2V88A 1PDAA 2EN6A 1RQ0A 4JI4E 5A69A 2JOBA 4X65E 4O5GA 1ZBQA 2LE2A 1ZR9A 2MKNA 1YUJA 2EOQA 2L2NA 2UXDE 1BB8A 5A6KA 2UUAE 3C6MA 3HPZA 5AE1A 2R76A 3JU0A 2JY9A 2LTRA 3JTZA 1NEIA 2EMGA 4DR4E 4DV4E 4LF4E 4JI7E 4JI1E 2B7TA 4X64E 1X6EA 4L5NC 2EN1A 2EOZA 4JI2E 5AC5A 4DMIA 2VRDA 2DRPA 2F4VE 1UHZA 2EOHA 2EPLX 2GPIA 3IWCA 2HJJA 2YU5A 5CFFE 1A1JA 1A1KA 3BIDA 2M4IA 2IHR1 4JI5E 2R1FA 3HQ1A 3FIGA 2L3CA 2K7IA 1I94E 3VYYA 2WBUA 1FJGE 2EQ1A 1N3GA 2YTJA 4JI3E 2NA2A 2WBSA 1YUIA 2WZOA 1X48A 1HNXE 3ZOQB 1WJPA 4DV6E 2DB2A 3C4BA 1YYOA 2EN7A 1QNTA 4X9JA 4R2RA 2EZ6A 5F3WA 2MDGA 2D9HA 2EMBA 4WXDA 3L00A 2EOXA 2N8XA 2L2MA 1BBGA 1KJKA 4WFTA 5AC4A 2Q8UA 2EMCA 5A6BA 3ADGA 3BGHA 2EMLA 2FTXB 2YTNA 4DV3E 2L8TA 2EWLA 2F8BA 2EM4A 2H36X 1PKPA 4J8ZA 2DIXA 2EPCA 2LT7A 1Z1BA 1A1GA 2FGGA 2EM3A 2JOXA 2EMKA 3IWBA 2UUCE 1L4SA 2BB8A 2EM6A 2YU8A 4HEIA 1IBLE 3KZZA 1ZBTA 2JWOA 2EPAA 5KL6A 1B69A 4F54A 5KL4A 2M1SA 1PJTA 2WCC3 2LRSA 5IV8B 2CPNA 2YTQA 4YHHE 2NUEA 3HXLA 1P47A 2ENAA 1NCSA 2LJUA 2EPUA 1T4NA 1RC7A 3EPLA 4O24A 4DR7E 4MLQA 3J7AG 2UUBE 3LLHA 4P78A 1DQ3A 4DV7E 4BS9A 2EMWA 1X49A 3BF2A 4X66E 1A1FA 4M2ZA 3MHHC 4NHRA 1XMQE 5A6JA 2EN3A 2EMHA 1O0WA 2B9DA 5ADZA 5FLXC 2EPNA 2N3GA 4F2JC 5LMNE 4BC7A 4LF7E 4BBYA 1SFEA 4DUYE 1IQOA 1G2FC 4LF9E 2RS6A 1JK2A 1XNQE 3HTXA 4DKKA 1STUA 2EMYA 4F6NA 1YYWA 2RS7A 2UXCE 3MHSC 2EL4A 3UK3C 2I9IA 4Q35B 1XMOE 1EKZA 2EPZA 4WX9A 1A1HA 3HPSA 3DF6A 4R2PA 4O43A 1XNRE 1AH5A 4IS1C 1UILA 2VF1A 2EMIA 1J26A 2VQEE 4DR3E 4DR6E 3TQMA 4X8WA 2EN8A 2LUPB 4B3RE 3ADJA 2EPRA 2J7JA 2YTIA 2YTPA 4IJDA 3AUZA 1IBME 4ZYHA 1N33E 2ELYA 3J81C 4KHPE 4DR2E 3EPKA 3JAMC 3ADLA 4LF5E 4L8NA 4Q28A 5DNYA 1SR9A 2JR1A 2EM9A 3J80C 1G2DC 4X62E 1X3CA 2DLKA 1UBDC 1N32E 3RMPA 3ECRA 5IWAE 4M9VC 2JYAA 2YSPA 2L92A 4GEQB 2EM5A 2EOOA 4JYAE 2V89A 3MSWA 1X47A 2EOMA 2DMYA 4WSGA 4KWYA 2LJHA 2YZTA 2EOYA 2EL6A 1QU6A 5KL7A 2YTOA 2ENCA 1GQEA 2RSMA 2EP3A 1AAYA 4LF6E 2EOEA 3F6HA 2YSOA 2ODRC 1HR0E 4YY3E 2YTDA 3THNA 2YTEA 2UU9E 4F9AB 3IWDA 4WSPA 2ADRA 4LFCE 1A1IA 2EE8A 2LUQA 2BBGA 2NABA 4TUGA 4ZYGA 1BBOA 1WHQA 2A25A 2YRKA 3KWRA 5KL5A 3ADIA 2EPMX 4DV0E 2ENHA 2DLQA 1PJQA 2EM8A 2LTSA 4NZVA 4R03A 2KONA 2EMAA 2LMZA 4B3SE 2MC6A 2JXPA 4R2AA 2YT4A 1EH7A 2EPPA 2PRTA 4BC9A 5A6BD 3QG5C 4RHBB 4GKJE 1YYKA 2CTDA 2GLIA 1T39A 2EMZA 3AV0A 1DI2A 3F6GA 1ZU1A 2EPOA 2L2KB 1JK1A 4OX9E 4KZSA 5AASA 2RTXA 4HTGA 2EL5A 2EJ4A 3T1YE 2EMFA 4M0VA 4M30A 2E72A 3EQ1A 2M7QA 2EM0A 4FK5C 4R2DA 1N34E 2V86A 4DV2E 3T1HE 3M99B 4BMJA 4JI0E 3VK6A 3P1XA 1N36E 4DR5E 3EPHA 2KOUA 1YFHA 2KHXA 4R8OA 2UXBE 1EH8A 1IQSA 2CSHA 4I8OA 2HC5A 4BHCA 3KZYA 2I13A 2RQLA 5AE3A 1J5EE 4B3ME 4OOGC 5LL6R 1MEYC 2HGHA 2YTGA 1IMUA 2WBTA 5LMUE 3DJWA 2B3TB 4F9BB 2EPKX 4TUIA 3OMLA 4P7DA 1LLMC 2RPCA 2GHFA 5IXMB 1TF3A 2VQFE 1X6HA 4LU9A 1X5WA 4RH8A 2EOJA 4O4KA 5TSEA 2JPAA 5AE2A 4LFAE 2ODRD 2L6MA 2L3JA 2EOIA 1ZAAC 2DMIA 2V85A 4F9CB 1F2IG 3H09A 5A6AA 4F6MA 2DSYA 2EOFA 4LTYA 4LFBE 1EH6A 2YPNA 2EN2A 1MGTA 5IT9C 4BCAA 2B7VA 1T38A 2NUFA 2MKDA 1T4OA 3C4TA 2LO3A 4DV1E 3LMLA 2CT1A 3OTOE 2G7HA 2V87A 2EPXA 4ZYEA 1YZ9A 2EORA 1GZ6A 4GZNC 4DUZE 1KYQA 4JI6E 5T6JA 2MC5A 3THOB 4R2SA 2FV4B 1UN6B 4NXME 4DV5E
chains in the Genus database with same CATH topology
4DR1E 1HNWE 5A2QC 3F6GA 2NA2A 1XMOE 4JI3E 1EKZA 2WZOA 2L2KB 1X48A 4WYQB 3HPSA 1HNXE 4OX9E 3DF6A 4KZSA 3ZOQB 5AASA 4LF8E 2RTXA 4DV6E 1XNRE 4GKKE 2DB2A 1FKAE 3C4BA 1YYOA 1UILA 3T1YE 2VF1A 4M0VA 4M30A 4K0KE 4JV5E 2L33A 2M7QA 2V8QB 1J26A 2VQEE 4DR3E 2EZ6A 2K4VA 4DR6E 4X8WA 5BR8E 5F3WA 2LUPB 1WHNA 2V86A 4WPYA 1N34E 4B3RE 4DV2E 3ADJA 3T1HE 2N3HA 3K6QA 4BMJA 2E1MA 2E5LE 4JI0E 2V83A 3VK6A 2L2MA 3P1XA 3J7Yp 3AUZA 4WFTA 1N36E 4DR5E 1IBME 4B3TE 2KOUA 3ADGA 2KHXA 4R8OA 1N33E 2VE7C 2FTXB 2UXBE 3J81C 2JVAA 2LBSB 4DR2E 4I8OA 4DV3E 4KHPE 2L8TA 3JAMC 2EWLA 2F8BA 3ADLA 2ZM6E 4LF5E 2H36X 4L8NA 1PKPA 4Q28A 5AE3A 4J8ZA 2DIXA 1SR9A 4OOGC 5DNYA 1WXRA 1T4LB 1J5EE 5LL6R 2JR1A 4B3ME 4JI8E 3J80C 4X62E 4DV5E 2MDRA 2FGGA 1HNZE 2JOXA 4AQYE 1N32E 3IWBA 3RMPA 5LMUE 5IWAE 1IBKE 2UUCE 3DJWA 2B3TB 2L92A 4GEQB 4F9BB 3VYXA 4JYAE 2V89A 3MSWA 1X47A 4TUIA 3OMLA 4P7DA 1IBLE 2DMYA 1ZBTA 2JWOA 2HHHE 4F54A 2NUGA 2VQFE 4LU9A 4NXNE 2LJHA 2YZTA 2V88A 2M1SA 4DR4E 1QU6A 1RQ0A 4JI4E 5AE2A 2JOBA 4X65E 4LFAE 2LRSA 1ZBQA 2LE2A 2ODRD 2CPNA 2L6MA 2L3JA 1GQEA 2RSMA 4LF6E 4YHHE 2V85A 2L2NA 3F6HA 3HXLA 4F9CB 2NUEA 2UXDE 3H09A 2UUAE 2ODRC 2DSYA 1HR0E 4YY3E 3HPZA 4LTYA 5AE1A 1T4NA 2UU9E 4LFBE 3JU0A 2JY9A 1RC7A 4F9AB 2LTRA 3IWDA 4WSPA 3JTZA 4LFCE 4DR7E 3J7AG 2UUBE 3LLHA 4P78A 4DV4E 1DQ3A 2LUQA 4DV7E 4JI7E 4BS9A 4BCAA 5IT9C 4LF4E 1X49A 2B7VA 2NUFA 2B7TA 4JI1E 4X64E 4TUGA 1T4OA 1WHQA 3KWRA 3C4TA 4L5NC 4X66E 4M2ZA 3ADIA 4DV1E 4DV0E 4JI2E 1XMQE 4DMIA 3LMLA 1O0WA 2B9DA 5ADZA 2LTSA 4R03A 2G7HA 2KONA 2LMZA 5FLXC 2V87A 1UHZA 2MC6A 3OTOE 4B3SE 2N3GA 2F4VE 1YZ9A 5LMNE 1GZ6A 3IWCA 2YT4A 5CFFE 4BC9A 4DUZE 4BC7A 4LF7E 4BBYA 4GKJE 4DUYE 5T6JA 4JI6E 2M4IA 2IHR1 2MC5A 4JI5E 2RS6A 4LF9E 3HQ1A 1YYKA 3FIGA 2L3CA 2FV4B 3HTXA 1XNQE 4DKKA 1STUA 4NXME 1I94E 1YYWA 2RS7A 2UXCE 3VYYA 1FJGE 1DI2A 3AV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 E;  1HNW E;  4JI3 E;  2NA2 A;  1XMO E;  1EKZ A;  2L2K B;  1X48 A;  4WYQ B;  1HNX E;  4OX9 E;  4GKK E;  4LF8 E;  2RTX A;  4DV6 E;  1XNR E;  2DB2 A;  1FKA E;  3C4B A;  1YYO A;  1UIL A;  3T1Y E;  4M30 A;  4K0K E;  4JV5 E;  2L33 A;  1J26 A;  2VQE E;  4DR3 E;  2EZ6 A;  4DR6 E;  4X8W A;  5BR8 E;  2LUP B;  1WHN A;  1N34 E;  4B3R E;  4DV2 E;  3ADJ A;  3T1H E;  2N3H A;  2E5L E;  4JI0 E;  2L2M A;  3P1X A;  3J7Y p;  4WFT A;  1N36 E;  4DR5 E;  1IBM E;  4B3T E;  3ADG A;  2KHX A;  1N33 E;  2UXB E;  2JVA A;  2LBS B;  4DR2 E;  4KHP E;  4DV3 E;  3ADL A;  2ZM6 E;  4LF5 E;  1PKP A;  1T4L B;  1J5E E;  2DIX A;  4OOG C;  4B3M E;  4JI8 E;  4X62 E;  2MDR A;  1HNZ E;  4AQY E;  1N32 E;  1IBK E;  5LMU E;  5IWA E;  2UUC E;  2B3T B;  3VYX A;  4JYA E;  1X47 A;  1IBL E;  2DMY A;  1ZBT A;  2HHH E;  2NUG A;  2VQF E;  4NXN E;  2LJH A;  1QU6 A;  1RQ0 A;  4JI4 E;  4X65 E;  4LFA E;  2LRS A;  2CPN A;  2L3J A;  1GQE A;  2RSM A;  4LF6 E;  4YHH E;  2NUE A;  2L2N A;  2UXD E;  2UUA E;  1HR0 E;  4YY3 E;  1T4N A;  2UU9 E;  4LFB E;  2JY9 A;  1RC7 A;  2LTR A;  4LFC E;  4DR7 E;  2UUB E;  3LLH A;  4DR4 E;  4DV4 E;  2LUQ A;  4DV7 E;  4LF4 E;  4JI7 E;  1X49 A;  2B7V A;  2NUF A;  2B7T A;  4JI1 E;  4X64 E;  1T4O A;  1WHQ A;  4X66 E;  3C4T A;  4M2Z A;  3ADI A;  4DV1 E;  4DV0 E;  4JI2 E;  1XMQ E;  1O0W A;  2LTS A;  3OTO E;  4B3S E;  2F4V E;  1UHZ A;  2N3G A;  1YZ9 A;  5LMN E;  2YT4 A;  5CFF E;  4DUZ E;  4LF7 E;  4GKJ E;  4DUY E;  4JI6 E;  4JI5 E;  2IHR 1;  4LF9 E;  1YYK A;  2RS6 A;  2L3C A;  3HTX A;  1XNQ E;  4DKK A;  1STU A;  4NXM E;  1I94 E;  1YYW A;  2RS7 A;  2UXC E;  3VYY A;  1FJG E;  1DI2 A;  4DV5 E; 
#chains in the Genus database with same CATH topology
 5LLQ A;  4DR1 E;  4MLV A;  5A2Q C;  1HNW E;  2LCE A;  1A1L A;  4WYQ B;  1RMD A;  4ZYD A;  4GKK E;  4LF8 E;  3VHT B;  2YRM A;  1FKA E;  1YPN A;  2EM2 A;  2EMX A;  4K0K E;  4JV5 E;  2ELZ A;  2L33 A;  2EOS A;  2EM7 A;  2V8Q B;  2YRH A;  1GTK A;  2K4V A;  5BR8 E;  2LV2 A;  1WHN A;  1DGC A;  4WPY A;  4WXC A;  2EQ0 A;  2N3H A;  3K6Q A;  2E5L E;  2E1M A;  2EQ3 A;  2V83 A;  3J7Y p;  4B3T E;  1TN9 A;  1PJS A;  2VE7 C;  1YSA C;  1WRJ A;  2LVH A;  4N4R B;  2JVA A;  2LBS B;  2EN4 A;  3EPJ A;  2ZM6 E;  5KL2 A;  1T4L B;  4R2C A;  1WXR A;  4JI8 E;  1X6F A;  2RSI A;  2YWQ A;  4BHB A;  2MDR A;  2DGC A;  1HNZ E;  4AQY E;  1IBK E;  2M9A A;  3BBG A;  4R2E A;  5KL3 A;  2YTF A;  3VYX A;  3C6K A;  1TF6 A;  2HHH E;  4R2Q A;  4NXN E;  2NUG A;  2JP9 A;  2V88 A;  1PDA A;  2EN6 A;  1RQ0 A;  4JI4 E;  5A69 A;  2JOB A;  4X65 E;  4O5G A;  1ZBQ A;  2LE2 A;  1ZR9 A;  2MKN A;  1YUJ A;  2EOQ A;  2L2N A;  2UXD E;  1BB8 A;  5A6K A;  2UUA E;  3C6M A;  3HPZ A;  5AE1 A;  2R76 A;  3JU0 A;  2JY9 A;  2LTR A;  3JTZ A;  1NEI A;  2EMG A;  4DR4 E;  4DV4 E;  4LF4 E;  4JI7 E;  4JI1 E;  2B7T A;  4X64 E;  1X6E A;  4L5N C;  2EN1 A;  2EOZ A;  4JI2 E;  5AC5 A;  4DMI A;  2VRD A;  2DRP A;  2F4V E;  1UHZ A;  2EOH A;  2EPL X;  2GPI A;  3IWC A;  2HJJ A;  2YU5 A;  5CFF E;  1A1J A;  1A1K A;  3BID A;  2M4I A;  2IHR 1;  4JI5 E;  2R1F A;  3HQ1 A;  3FIG A;  2L3C A;  2K7I A;  1I94 E;  3VYY A;  2WBU A;  1FJG E;  2EQ1 A;  1N3G A;  2YTJ A;  4JI3 E;  2NA2 A;  2WBS A;  1YUI A;  2WZO A;  1X48 A;  1HNX E;  3ZOQ B;  1WJP A;  4DV6 E;  2DB2 A;  3C4B A;  1YYO A;  2EN7 A;  1QNT A;  4X9J A;  4R2R A;  2EZ6 A;  5F3W A;  2MDG A;  2D9H A;  2EMB A;  4WXD A;  3L00 A;  2EOX A;  2N8X A;  2L2M A;  1BBG A;  1KJK A;  4WFT A;  5AC4 A;  2Q8U A;  2EMC A;  5A6B A;  3ADG A;  3BGH A;  2EML A;  2FTX B;  2YTN A;  4DV3 E;  2L8T A;  2EWL A;  2F8B A;  2EM4 A;  2H36 X;  1PKP A;  4J8Z A;  2DIX A;  2EPC A;  2LT7 A;  1Z1B A;  1A1G A;  2FGG A;  2EM3 A;  2JOX A;  2EMK A;  3IWB A;  2UUC E;  1L4S A;  2BB8 A;  2EM6 A;  2YU8 A;  4HEI A;  1IBL E;  3KZZ A;  1ZBT A;  2JWO A;  2EPA A;  5KL6 A;  1B69 A;  4F54 A;  5KL4 A;  2M1S A;  1PJT A;  2WCC 3;  2LRS A;  5IV8 B;  2CPN A;  2YTQ A;  4YHH E;  2NUE A;  3HXL A;  1P47 A;  2ENA A;  1NCS A;  2LJU A;  2EPU A;  1T4N A;  1RC7 A;  3EPL A;  4O24 A;  4DR7 E;  4MLQ A;  3J7A G;  2UUB E;  3LLH A;  4P78 A;  1DQ3 A;  4DV7 E;  4BS9 A;  2EMW A;  1X49 A;  3BF2 A;  4X66 E;  1A1F A;  4M2Z A;  3MHH C;  4NHR A;  1XMQ E;  5A6J A;  2EN3 A;  2EMH A;  1O0W A;  2B9D A;  5ADZ A;  5FLX C;  2EPN A;  2N3G A;  4F2J C;  5LMN E;  4BC7 A;  4LF7 E;  4BBY A;  1SFE A;  4DUY E;  1IQO A;  1G2F C;  4LF9 E;  2RS6 A;  1JK2 A;  1XNQ E;  3HTX A;  4DKK A;  1STU A;  2EMY A;  4F6N A;  1YYW A;  2RS7 A;  2UXC E;  3MHS C;  2EL4 A;  3UK3 C;  2I9I A;  4Q35 B;  1XMO E;  1EKZ A;  2EPZ A;  4WX9 A;  1A1H A;  3HPS A;  3DF6 A;  4R2P A;  4O43 A;  1XNR E;  1AH5 A;  4IS1 C;  1UIL A;  2VF1 A;  2EMI A;  1J26 A;  2VQE E;  4DR3 E;  4DR6 E;  3TQM A;  4X8W A;  2EN8 A;  2LUP B;  4B3R E;  3ADJ A;  2EPR A;  2J7J A;  2YTI A;  2YTP A;  4IJD A;  3AUZ A;  1IBM E;  4ZYH A;  1N33 E;  2ELY A;  3J81 C;  4KHP E;  4DR2 E;  3EPK A;  3JAM C;  3ADL A;  4LF5 E;  4L8N A;  4Q28 A;  5DNY A;  1SR9 A;  2JR1 A;  2EM9 A;  3J80 C;  1G2D C;  4X62 E;  1X3C A;  2DLK A;  1UBD C;  1N32 E;  3RMP A;  3ECR A;  5IWA E;  4M9V C;  2JYA A;  2YSP A;  2L92 A;  4GEQ B;  2EM5 A;  2EOO A;  4JYA E;  2V89 A;  3MSW A;  1X47 A;  2EOM A;  2DMY A;  4WSG A;  4KWY A;  2LJH A;  2YZT A;  2EOY A;  2EL6 A;  1QU6 A;  5KL7 A;  2YTO A;  2ENC A;  1GQE A;  2RSM A;  2EP3 A;  1AAY A;  4LF6 E;  2EOE A;  3F6H A;  2YSO A;  2ODR C;  1HR0 E;  4YY3 E;  2YTD A;  3THN A;  2YTE A;  2UU9 E;  4F9A B;  3IWD A;  4WSP A;  2ADR A;  4LFC E;  1A1I A;  2EE8 A;  2LUQ A;  2BBG A;  2NAB A;  4TUG A;  4ZYG A;  1BBO A;  1WHQ A;  2A25 A;  2YRK A;  3KWR A;  5KL5 A;  3ADI A;  2EPM X;  4DV0 E;  2ENH A;  2DLQ A;  1PJQ A;  2EM8 A;  2LTS A;  4NZV A;  4R03 A;  2KON A;  2EMA A;  2LMZ A;  4B3S E;  2MC6 A;  2JXP A;  4R2A A;  2YT4 A;  1EH7 A;  2EPP A;  2PRT A;  4BC9 A;  5A6B D;  3QG5 C;  4RHB B;  4GKJ E;  1YYK A;  2CTD A;  2GLI A;  1T39 A;  2EMZ A;  3AV0 A;  1DI2 A;  3F6G A;  1ZU1 A;  2EPO A;  2L2K B;  1JK1 A;  4OX9 E;  4KZS A;  5AAS A;  2RTX A;  4HTG A;  2EL5 A;  2EJ4 A;  3T1Y E;  2EMF A;  4M0V A;  4M30 A;  2E72 A;  3EQ1 A;  2M7Q A;  2EM0 A;  4FK5 C;  4R2D A;  1N34 E;  2V86 A;  4DV2 E;  3T1H E;  3M99 B;  4BMJ A;  4JI0 E;  3VK6 A;  3P1X A;  1N36 E;  4DR5 E;  3EPH A;  2KOU A;  1YFH A;  2KHX A;  4R8O A;  2UXB E;  1EH8 A;  1IQS A;  2CSH A;  4I8O A;  2HC5 A;  4BHC A;  3KZY A;  2I13 A;  2RQL A;  5AE3 A;  1J5E E;  4B3M E;  4OOG C;  5LL6 R;  1MEY C;  2HGH A;  2YTG A;  1IMU A;  2WBT A;  5LMU E;  3DJW A;  2B3T B;  4F9B B;  2EPK X;  4TUI A;  3OML A;  4P7D A;  1LLM C;  2RPC A;  2GHF A;  5IXM B;  1TF3 A;  2VQF E;  1X6H A;  4LU9 A;  1X5W A;  4RH8 A;  2EOJ A;  4O4K A;  5TSE A;  2JPA A;  5AE2 A;  4LFA E;  2ODR D;  2L6M A;  2L3J A;  2EOI A;  1ZAA C;  2DMI A;  2V85 A;  4F9C B;  1F2I G;  3H09 A;  5A6A A;  4F6M A;  2DSY A;  2EOF A;  4LTY A;  4LFB E;  1EH6 A;  2YPN A;  2EN2 A;  1MGT A;  5IT9 C;  4BCA A;  2B7V A;  1T38 A;  2NUF A;  2MKD A;  1T4O A;  3C4T A;  2LO3 A;  4DV1 E;  3LML A;  2CT1 A;  3OTO E;  2G7H A;  2V87 A;  2EPX A;  4ZYE A;  1YZ9 A;  2EOR A;  1GZ6 A;  4GZN C;  4DUZ E;  1KYQ A;  4JI6 E;  5T6J A;  2MC5 A;  3THO B;  4R2S A;  2FV4 B;  1UN6 B;  4NXM E;  4DV5 E; 
#chains in the Genus database with same CATH homology
 4DR1 E;  1HNW E;  5A2Q C;  3F6G A;  2NA2 A;  1XMO E;  4JI3 E;  1EKZ A;  2WZO A;  2L2K B;  1X48 A;  4WYQ B;  3HPS A;  1HNX E;  4OX9 E;  3DF6 A;  4KZS A;  3ZOQ B;  5AAS A;  4LF8 E;  2RTX A;  4DV6 E;  1XNR E;  4GKK E;  2DB2 A;  1FKA E;  3C4B A;  1YYO A;  1UIL A;  3T1Y E;  2VF1 A;  4M0V A;  4M30 A;  4K0K E;  4JV5 E;  2L33 A;  2M7Q A;  2V8Q B;  1J26 A;  2VQE E;  4DR3 E;  2EZ6 A;  2K4V A;  4DR6 E;  4X8W A;  5BR8 E;  5F3W A;  2LUP B;  1WHN A;  2V86 A;  4WPY A;  1N34 E;  4B3R E;  4DV2 E;  3ADJ A;  3T1H E;  2N3H A;  3K6Q A;  4BMJ A;  2E1M A;  2E5L E;  4JI0 E;  2V83 A;  3VK6 A;  2L2M A;  3P1X A;  3J7Y p;  3AUZ A;  4WFT A;  1N36 E;  4DR5 E;  1IBM E;  4B3T E;  2KOU A;  3ADG A;  2KHX A;  4R8O A;  1N33 E;  2VE7 C;  2FTX B;  2UXB E;  3J81 C;  2JVA A;  2LBS B;  4DR2 E;  4I8O A;  4DV3 E;  4KHP E;  2L8T A;  3JAM C;  2EWL A;  2F8B A;  3ADL A;  2ZM6 E;  4LF5 E;  2H36 X;  4L8N A;  1PKP A;  4Q28 A;  5AE3 A;  4J8Z A;  2DIX A;  1SR9 A;  4OOG C;  5DNY A;  1WXR A;  1T4L B;  1J5E E;  5LL6 R;  2JR1 A;  4B3M E;  4JI8 E;  3J80 C;  4X62 E;  4DV5 E;  2MDR A;  2FGG A;  1HNZ E;  2JOX A;  4AQY E;  1N32 E;  3IWB A;  3RMP A;  5LMU E;  5IWA E;  1IBK E;  2UUC E;  3DJW A;  2B3T B;  2L92 A;  4GEQ B;  4F9B B;  3VYX A;  4JYA E;  2V89 A;  3MSW A;  1X47 A;  4TUI A;  3OML A;  4P7D A;  1IBL E;  2DMY A;  1ZBT A;  2JWO A;  2HHH E;  4F54 A;  2NUG A;  2VQF E;  4LU9 A;  4NXN E;  2LJH A;  2YZT A;  2V88 A;  2M1S A;  4DR4 E;  1QU6 A;  1RQ0 A;  4JI4 E;  5AE2 A;  2JOB A;  4X65 E;  4LFA E;  2LRS A;  1ZBQ A;  2LE2 A;  2ODR D;  2CPN A;  2L6M A;  2L3J A;  1GQE A;  2RSM A;  4LF6 E;  4YHH E;  2V85 A;  2L2N A;  3F6H A;  3HXL A;  4F9C B;  2NUE A;  2UXD E;  3H09 A;  2UUA E;  2ODR C;  2DSY A;  1HR0 E;  4YY3 E;  3HPZ A;  4LTY A;  5AE1 A;  1T4N A;  2UU9 E;  4LFB E;  3JU0 A;  2JY9 A;  1RC7 A;  4F9A B;  2LTR A;  3IWD A;  4WSP A;  3JTZ A;  4LFC E;  4DR7 E;  3J7A G;  2UUB E;  3LLH A;  4P78 A;  4DV4 E;  1DQ3 A;  2LUQ A;  4DV7 E;  4JI7 E;  4BS9 A;  4BCA A;  5IT9 C;  4LF4 E;  1X49 A;  2B7V A;  2NUF A;  2B7T A;  4JI1 E;  4X64 E;  4TUG A;  1T4O A;  1WHQ A;  3KWR A;  3C4T A;  4L5N C;  4X66 E;  4M2Z A;  3ADI A;  4DV1 E;  4DV0 E;  4JI2 E;  1XMQ E;  4DMI A;  3LML A;  1O0W A;  2B9D A;  5ADZ A;  2LTS A;  4R03 A;  2G7H A;  2KON A;  2LMZ A;  5FLX C;  2V87 A;  1UHZ A;  2MC6 A;  3OTO E;  4B3S E;  2N3G A;  2F4V E;  1YZ9 A;  5LMN E;  1GZ6 A;  3IWC A;  2YT4 A;  5CFF E;  4BC9 A;  4DUZ E;  4BC7 A;  4LF7 E;  4BBY A;  4GKJ E;  4DUY E;  5T6J A;  4JI6 E;  2M4I A;  2IHR 1;  2MC5 A;  4JI5 E;  2RS6 A;  4LF9 E;  3HQ1 A;  1YYK A;  3FIG A;  2L3C A;  2FV4 B;  3HTX A;  1XNQ E;  4DKK A;  1STU A;  4NXM E;  1I94 E;  1YYW A;  2RS7 A;  2UXC E;  3VYY A;  1FJG E;  1DI2 A;  3AV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...