1WHQA

Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA helicase A
publication title Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 17
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whqA01
4B3TE 3LLHA 4OX9E 4DR2E 2RS7A 2L2NA 2L3JA 3OTOE 2UXCE 4JI4E 1YYWA 4K0KE 1XMOE 2RS6A 4X66E 2LTRA 2VQFE 1O0WA 2CPNA 4X65E 1YYKA 1X48A 1UHZA 2LRSA 4DUYE 4JI5E 4M2ZA 4JV5E 1PKPA 1X49A 1HNZE 1FJGE 1HNXE 1ZBTA 5LMNE 1YYOA 3P1XA 4DV4E 4NXNE 2B3TB 1J5EE 4KHPE 2UXBE 3ADJA 2DMYA 1HNWE 2EZ6A 2MDRA 1QU6A 4B3ME 1X47A 4DV2E 4LF6E 2JY9A 2UXDE 1HR0E 4X8WA 4JI6E 4DR7E 3J7Yp 1WHQA 3VYXA 1N34E 2LTSA 4JI7E 1DI2A 2ZM6E 2RTXA 2NUGA 1STUA 4JI2E 3C4BA 2B7TA 2F4VE 2UUCE 2LUPB 2UUAE 4YHHE 1WHNA 4M30A 4JI1E 4DV1E 1YZ9A 2NUEA 2DB2A 4DR1E 2UUBE 1N33E 2VQEE 2DIXA 4JI0E 4LF4E 4LF7E 2HHHE 1N32E 4DR6E 1J26A 4DR5E 4X62E 4JI3E 2IHR1 4GKKE 1EKZA 1XNRE 2E5LE 4B3RE 4DV7E 2L33A 2JVAA 3ADLA 4DR4E 4YY3E 4LF9E 3ADGA 4DUZE 3ADIA 2RSMA 2YT4A 2UU9E 5IWAE 4JYAE 1T4OA 1T4LB 4OOGC 4LFAE 1RC7A 4DV5E 1IBLE 2N3GA 4LF5E 4JI8E 2L3CA 4LFBE 4NXME 2LJHA 4DV6E 4GKJE 4WFTA 5LMUE 3VYYA 1IBME 4AQYE 4B3SE 3T1HE 4LF8E 4X64E 2LBSB 1I94E 1FKAE 2LUQA 5BR8E 4DV3E 1RQ0A 4DV0E 4LFCE 5CFFE 4DR3E 1XMQE 3T1YE 2NA2A 3HTXA 2B7VA 1N36E 1UILA 1T4NA 2N3HA 4DKKA 3C4TA 1GQEA 2KHXA 2L2MA 1IBKE 2L2KB 1XNQE 4WYQB 2NUFA
chains in the Genus database with same CATH superfamily
2J7JA 4B3TE 1PJQA 3LLHA 2EPMX 2K4VA 4HTGA 3AV0A 2UXCE 2JOBA 5A6BA 2LTRA 2VQFE 1O0WA 2EN3A 3QG5C 4BS9A 2LRSA 1T38A 1IMUA 1HNXE 3P1XA 4L5NC 2EOQA 1MGTA 1J5EE 4KHPE 2EMXA 2DMYA 2LV2A 4R2CA 4F6MA 5A6AA 2JPAA 1ZU1A 5IV8B 1TF3A 3HPZA 2UXDE 2EPXA 4R2SA 2RSIA 2ODRC 2JOXA 2EPLX 2MKDA 3EPLA 4JI6E 1WHQA 4F9BB 3IWDA 4F54A 4TUGA 1DI2A 4R03A 2YTPA 3C6MA 2YTGA 3KZZA 1EH7A 2YTNA 1STUA 3C4BA 1L4SA 4R2DA 2E1MA 1BB8A 4FK5C 2WBSA 2LUPB 4O43A 2YSPA 2EM4A 4YHHE 1WHNA 4RHBB 4JI1E 2YTFA 4DV1E 2JP9A 1YUIA 2NUEA 2EMBA 1N33E 2ADRA 1UBDC 4DR5E 2GPIA 3HQ1A 4GKKE 1YPNA 1GTKA 2E72A 4DR4E 5A6JA 4O4KA 4BC7A 2D9HA 2EMAA 2EOMA 3ADIA 1IQOA 2RSMA 2YT4A 2EN2A 1PJSA 4IS1C 1X6FA 1T4OA 2WBTA 4ZYGA 4DV5E 1RC7A 1IBLE 2I13A 2N3GA 2RPCA 2R76A 4DV6E 1WXRA 4WFTA 2EMLA 1IBME 3L00A 2EL5A 4AQYE 3VHTB 2LUQA 2EP3A 3EPHA 5BR8E 4DV3E 1MEYC 2G7HA 2EQ0A 4LFCE 1AH5A 5CFFE 2FTXB 1A1LA 5LLQA 2YTEA 2YTOA 2FGGA 2NA2A 3HTXA 2B7VA 2LCEA 1T4NA 3F6GA 2N3HA 3C4TA 2L2MA 1TN9A 2ENAA 2EORA 2EOFA 2YRKA 1XNQE 4WYQB 4DV0E 3H09A 1ZBQA 1UN6B 4DR2E 2RS7A 2L2NA 2V8QB 2LO3A 5T6JA 4K0KE 1XMOE 2RS6A 2YTDA 3M99B 5AE3A 4X65E 3KWRA 3BIDA 5A6KA 1UHZA 2H36X 1PKPA 1HNZE 2MC6A 1ZBTA 4NHRA 1A1KA 2B3TB 2EMYA 4R2EA 3J81C 2WBUA 2UXBE 2EL4A 2V83A 4L8NA 1QU6A 2V85A 2JXPA 1IQSA 1KYQA 2EE8A 4WX9A 5AASA 2EOOA 3J7AG 5AE1A 2DSYA 2DLKA 2EOZA 2EN8A 4X8WA 4R2RA 5AC4A 3J7Yp 4R2PA 2EN7A 4BCAA 3VYXA 4JI7E 1X3CA 2RTXA 2NUGA 5KL5A 2R1FA 4JI2E 2JYAA 3JAMC 1DGCA 4DMIA 2UUCE 2NABA 1A1HA 4BBYA 2RQLA 4NZVA 2VQEE 2DIXA 5AE2A 4LF4E 3HXLA 2MKNA 1F2IG 2EOXA 4JI3E 1A1GA 4MLQA 1EKZA 1B69A 2VF1A 2E5LE 3EQ1A 1AAYA 4DUZE 2YU8A 2ELZA 5IXMB 2EMIA 4OOGC 4LFAE 2FV4B 2L3CA 2K7IA 3UK3C 2VE7C 4NXME 2EM9A 2EMHA 5LMUE 2LE2A 3VYYA 2PRTA 2WCC3 2LT7A 1PJTA 1PDAA 2YSOA 2LBSB 1I94E 3DJWA 3DF6A 2EM8A 2EPKX 1X6HA 1WJPA 4F9AB 1Z1BA 2L92A 1UILA 2F8BA 4WSGA 4DKKA 4LU9A 5DNYA 2EQ1A 2KHXA 2LJUA 1IBKE 2L2KB 2EMCA 2EN1A 3EPJA 4OX9E 2L3JA 3OTOE 2GLIA 1YYWA 2EOYA 3K6QA 2YU5A 1GZ6A 4M9VC 1YYKA 1NCSA 3TQMA 4P78A 1T39A 2ENCA 1DQ3A 2EM2A 1X49A 2EPPA 2ELYA 5LMNE 1YYOA 3EPKA 4DV4E 4NXNE 1JK1A 3ZOQB 5KL3A 1X6EA 3KZYA 2ENHA 3MSWA 2CT1A 2EZ6A 4BHBA 2EM7A 2MDRA 4KZSA 4B3ME 1X47A 2EOJA 3BBGA 3THNA 4F9CB 4LF6E 2JY9A 3J80C 2VRDA 2M9AA 2NUFA 1ZAAC 5KL7A 4HEIA 4MLVA 1N34E 2LTSA 4I8OA 2EPOA 3BGHA 2ZM6E 2HC5A 2V86A 5FLXC 2LMZA 2EOSA 4WXCA 2B7TA 4BMJA 1SR9A 4LTYA 3MHSC 1TF6A 2DB2A 4DR1E 2UUBE 1A1JA 2HHHE 1N3GA 4X62E 1BBGA 4ZYEA 2IHR1 4O5GA 2EMFA 4WXDA 4R2QA 4B3RE 3ADLA 2EWLA 2L33A 4YY3E 2CTDA 2EMWA 2WZOA 4JYAE 1T4LB 2YTIA 4LF5E 4IJDA 1YSAC 2V87A 4ZYDA 2LJHA 2BBGA 5ADZA 2EMGA 1NEIA 4RH8A 3C6KA 3F6HA 2DRPA 2JWOA 2YRHA 4B3SE 3T1HE 1SFEA 1EH6A 2EPNA 5AC5A 1YFHA 1RQ0A 2YPNA 2MDGA 3BF2A 1RMDA 2BB8A 4F2JC 1XMQE 3T1YE 4KWYA 4J8ZA 1N36E 2B9DA 2EPCA 4WSPA 2EOHA 2ODRD 4Q35B 2LVHA 2EJ4A 4BC9A 4R2AA 2EMZA 2DGCA 4JI4E 2JR1A 2DMIA 4X66E 4O24A 4WPYA 2CPNA 2EMKA 1QNTA 5F3WA 1X48A 2HJJA 2YZTA 2N8XA 4DUYE 4JI5E 4M2ZA 4JV5E 2KONA 5KL2A 2KOUA 1FJGE 3MHHC 2L6MA 3THOB 2EM6A 2EM0A 2MC5A 1X5WA 2EM3A 3ADJA 1HNWE 1EH8A 5KL4A 1P47A 2EM5A 4N4RB 4DV2E 2L8TA 3ECRA 1A1FA 1HR0E 2EPZA 4DR7E 4R8OA 4X9JA 2YWQA 2M1SA 3LMLA 5A69A 1WRJA 2DLQA 2EN4A 4M0VA 2YRMA 2F4VE 5A6BD 1A1IA 2CSHA 2UUAE 3IWBA 1YZ9A 4M30A 3OMLA 2A25A 1LLMC 4ZYHA 4JI0E 5KL6A 4LF7E 2EPRA 1N32E 4DR6E 1J26A 2GHFA 4TUIA 5LL6R 5A2QC 1G2DC 1XNRE 4GZNC 5IT9C 4DV7E 2YTJA 2JVAA 3IWCA 4P7DA 4LF9E 2EL6A 3ADGA 2Q8UA 4GEQB 2V89A 2EN6A 2UU9E 5IWAE 2I9IA 4F6NA 2EPUA 1KJKA 4BHCA 1JK2A 4JI8E 4LFBE 1ZR9A 3FIGA 2M4IA 4GKJE 2M7QA 3HPSA 3RMPA 1YUJA 5TSEA 1BBOA 2EOIA 1G2FC 4X64E 1FKAE 2HGHA 4Q28A 2EQ3A 2V88A 4DR3E 2EOEA 3JTZA 3AUZA 1GQEA 3VK6A 2YTQA 3JU0A 4LF8E 2EPAA
chains in the Genus database with same CATH topology
3H09A 4BC9A 4B3TE 1ZBQA 3LLHA 4OX9E 2K4VA 2RS7A 2L2NA 3AV0A 2V8QB 2L3JA 3OTOE 2JOBA 4DR2E 5T6JA 4JI4E 1YYWA 4K0KE 2UXCE 2JR1A 1XMOE 2RS6A 3K6QA 4X66E 2LTRA 4WPYA 5AE3A 2VQFE 1O0WA 2CPNA 4X65E 3KWRA 1GZ6A 5F3WA 1YYKA 1X48A 4BS9A 2YZTA 4P78A 1UHZA 2H36X 2LRSA 4DUYE 4JI5E 4M2ZA 4JV5E 2KONA 1DQ3A 1PKPA 1X49A 1HNZE 2KOUA 2MC6A 1HNXE 1FJGE 1ZBTA 5LMNE 2L6MA 1YYOA 3P1XA 4DV4E 4NXNE 4L5NC 2MC5A 2B3TB 1J5EE 3ZOQB 4KHPE 3J81C 2UXBE 3ADJA 3MSWA 2DMYA 1HNWE 2V83A 2EZ6A 4L8NA 2MDRA 1QU6A 2V85A 4KZSA 4B3ME 1X47A 5AASA 4DV2E 2L8TA 4F9CB 4LF6E 2JY9A 3HPZA 2UXDE 3J7AG 5AE1A 3J80C 1HR0E 2ODRC 2DSYA 4X8WA 2JOXA 4JI6E 4DR7E 3J7Yp 4R8OA 4B3RE 1WHQA 4F9BB 4BCAA 3IWDA 3VYXA 2M1SA 4F54A 3LMLA 4TUGA 1N34E 2LTSA 4I8OA 4JI7E 1DI2A 2ZM6E 4R03A 2V86A 2RTXA 2NUGA 5FLXC 2LMZA 1STUA 4JI2E 3C4BA 2E1MA 3JAMC 2B7TA 4M0VA 4BMJA 4DMIA 2LUPB 2UUCE 2F4VE 2UUAE 4YHHE 1SR9A 1WHNA 3IWBA 4M30A 4DV1E 4JI1E 3OMLA 4LTYA 1YZ9A 4BBYA 2DB2A 4DR1E 2UUBE 2NUEA 1N33E 2VQEE 2DIXA 5AE2A 4JI0E 3HXLA 4LF4E 4LF7E 2HHHE 1N32E 4DR6E 1J26A 4DR5E 4X62E 4JI3E 4TUIA 5LL6R 2IHR1 3HQ1A 5A2QC 4GKKE 1EKZA 1XNRE 5IT9C 2VF1A 2E5LE 4DV7E 2EWLA 2JVAA 2L33A 3IWCA 4P7DA 4YY3E 3ADLA 4LF9E 3ADGA 4DUZE 4GEQB 4BC7A 3ADIA 2V89A 2RSMA 2WZOA 2YT4A 2UU9E 5IWAE 4JYAE 1T4OA 1T4LB 4OOGC 4LFAE 1RC7A 4DV5E 1IBLE 2FV4B 2N3GA 4LF5E 4JI8E 2L3CA 4LFBE 2V87A 4NXME 2VE7C 3FIGA 2M4IA 2LJHA 4DV6E 2M7QA 5ADZA 3HPSA 1WXRA 4WFTA 3RMPA 4GKJE 3F6HA 2LE2A 5LMUE 3VYYA 1IBME 4AQYE 2JWOA 4B3SE 3T1HE 4LF8E 4X64E 2LBSB 1I94E 1FKAE 2LUQA 5BR8E 4DV3E 1RQ0A 3DJWA 4DV0E 3DF6A 2G7HA 4Q28A 4LFCE 2V88A 2FTXB 5CFFE 4DR3E 4F9AB 3T1YE 1XMQE 2FGGA 2NA2A 4J8ZA 2B7VA 3HTXA 3JTZA 1N36E 4DR4E 2L92A 1UILA 2B9DA 1T4NA 2F8BA 3F6GA 2N3HA 4DKKA 4LU9A 3AUZA 1GQEA 3C4TA 2KHXA 4WSPA 3JU0A 2L2MA 3VK6A 5DNYA 2ODRD 2L2KB 1IBKE 1XNQE 4WYQB 2NUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T E;  3LLH A;  4OX9 E;  4DR2 E;  2RS7 A;  2L2N A;  2L3J A;  3OTO E;  2UXC E;  4JI4 E;  1YYW A;  4K0K E;  1XMO E;  2RS6 A;  4X66 E;  2LTR A;  2VQF E;  1O0W A;  2CPN A;  4X65 E;  1YYK A;  1X48 A;  1UHZ A;  2LRS A;  4DUY E;  4JI5 E;  4M2Z A;  4JV5 E;  1PKP A;  1X49 A;  1HNZ E;  1FJG E;  1HNX E;  1ZBT A;  5LMN E;  1YYO A;  3P1X A;  4DV4 E;  4NXN E;  2B3T B;  1J5E E;  4KHP E;  2UXB E;  3ADJ A;  2DMY A;  1HNW E;  2EZ6 A;  2MDR A;  1QU6 A;  4B3M E;  1X47 A;  4DV2 E;  4LF6 E;  2JY9 A;  2UXD E;  1HR0 E;  4X8W A;  4JI6 E;  4DR7 E;  3J7Y p;  1WHQ A;  3VYX A;  1N34 E;  2LTS A;  4JI7 E;  1DI2 A;  2ZM6 E;  2RTX A;  2NUG A;  1STU A;  4JI2 E;  3C4B A;  2B7T A;  2F4V E;  2UUC E;  2LUP B;  2UUA E;  4YHH E;  1WHN A;  4M30 A;  4JI1 E;  4DV1 E;  1YZ9 A;  2NUE A;  2DB2 A;  4DR1 E;  2UUB E;  1N33 E;  2VQE E;  2DIX A;  4JI0 E;  4LF4 E;  4LF7 E;  2HHH E;  1N32 E;  4DR6 E;  1J26 A;  4DR5 E;  4X62 E;  4JI3 E;  2IHR 1;  4GKK E;  1EKZ A;  1XNR E;  2E5L E;  4B3R E;  4DV7 E;  2L33 A;  2JVA A;  3ADL A;  4DR4 E;  4YY3 E;  4LF9 E;  3ADG A;  4DUZ E;  3ADI A;  2RSM A;  2YT4 A;  2UU9 E;  5IWA E;  4JYA E;  1T4O A;  1T4L B;  4OOG C;  4LFA E;  1RC7 A;  4DV5 E;  1IBL E;  2N3G A;  4LF5 E;  4JI8 E;  2L3C A;  4LFB E;  4NXM E;  2LJH A;  4DV6 E;  4GKJ E;  4WFT A;  5LMU E;  3VYY A;  1IBM E;  4AQY E;  4B3S E;  3T1H E;  4LF8 E;  4X64 E;  2LBS B;  1I94 E;  1FKA E;  2LUQ A;  5BR8 E;  4DV3 E;  1RQ0 A;  4DV0 E;  4LFC E;  5CFF E;  4DR3 E;  1XMQ E;  3T1Y E;  2NA2 A;  3HTX A;  2B7V A;  1N36 E;  1UIL A;  1T4N A;  2N3H A;  4DKK A;  3C4T A;  1GQE A;  2KHX A;  2L2M A;  1IBK E;  2L2K B;  1XNQ E;  4WYQ B;  2NUF A; 
#chains in the Genus database with same CATH topology
 2J7J A;  4B3T E;  1PJQ A;  3LLH A;  2EPM X;  2K4V A;  4HTG A;  3AV0 A;  2UXC E;  2JOB A;  5A6B A;  2LTR A;  2VQF E;  1O0W A;  2EN3 A;  3QG5 C;  4BS9 A;  2LRS A;  1T38 A;  1IMU A;  1HNX E;  3P1X A;  4L5N C;  2EOQ A;  1MGT A;  1J5E E;  4KHP E;  2EMX A;  2DMY A;  2LV2 A;  4R2C A;  4F6M A;  5A6A A;  2JPA A;  1ZU1 A;  5IV8 B;  1TF3 A;  3HPZ A;  2UXD E;  2EPX A;  4R2S A;  2RSI A;  2ODR C;  2JOX A;  2EPL X;  2MKD A;  3EPL A;  4JI6 E;  1WHQ A;  4F9B B;  3IWD A;  4F54 A;  4TUG A;  1DI2 A;  4R03 A;  2YTP A;  3C6M A;  2YTG A;  3KZZ A;  1EH7 A;  2YTN A;  1STU A;  3C4B A;  1L4S A;  4R2D A;  2E1M A;  1BB8 A;  4FK5 C;  2WBS A;  2LUP B;  4O43 A;  2YSP A;  2EM4 A;  4YHH E;  1WHN A;  4RHB B;  4JI1 E;  2YTF A;  4DV1 E;  2JP9 A;  1YUI A;  2NUE A;  2EMB A;  1N33 E;  2ADR A;  1UBD C;  4DR5 E;  2GPI A;  3HQ1 A;  4GKK E;  1YPN A;  1GTK A;  2E72 A;  4DR4 E;  5A6J A;  4O4K A;  4BC7 A;  2D9H A;  2EMA A;  2EOM A;  3ADI A;  1IQO A;  2RSM A;  2YT4 A;  2EN2 A;  1PJS A;  4IS1 C;  1X6F A;  1T4O A;  2WBT A;  4ZYG A;  4DV5 E;  1RC7 A;  1IBL E;  2I13 A;  2N3G A;  2RPC A;  2R76 A;  4DV6 E;  1WXR A;  4WFT A;  2EML A;  1IBM E;  3L00 A;  2EL5 A;  4AQY E;  3VHT B;  2LUQ A;  2EP3 A;  3EPH A;  5BR8 E;  4DV3 E;  1MEY C;  2G7H A;  2EQ0 A;  4LFC E;  1AH5 A;  5CFF E;  2FTX B;  1A1L A;  5LLQ A;  2YTE A;  2YTO A;  2FGG A;  2NA2 A;  3HTX A;  2B7V A;  2LCE A;  1T4N A;  3F6G A;  2N3H A;  3C4T A;  2L2M A;  1TN9 A;  2ENA A;  2EOR A;  2EOF A;  2YRK A;  1XNQ E;  4WYQ B;  4DV0 E;  3H09 A;  1ZBQ A;  1UN6 B;  4DR2 E;  2RS7 A;  2L2N A;  2V8Q B;  2LO3 A;  5T6J A;  4K0K E;  1XMO E;  2RS6 A;  2YTD A;  3M99 B;  5AE3 A;  4X65 E;  3KWR A;  3BID A;  5A6K A;  1UHZ A;  2H36 X;  1PKP A;  1HNZ E;  2MC6 A;  1ZBT A;  4NHR A;  1A1K A;  2B3T B;  2EMY A;  4R2E A;  3J81 C;  2WBU A;  2UXB E;  2EL4 A;  2V83 A;  4L8N A;  1QU6 A;  2V85 A;  2JXP A;  1IQS A;  1KYQ A;  2EE8 A;  4WX9 A;  5AAS A;  2EOO A;  3J7A G;  5AE1 A;  2DSY A;  2DLK A;  2EOZ A;  2EN8 A;  4X8W A;  4R2R A;  5AC4 A;  3J7Y p;  4R2P A;  2EN7 A;  4BCA A;  3VYX A;  4JI7 E;  1X3C A;  2RTX A;  2NUG A;  5KL5 A;  2R1F A;  4JI2 E;  2JYA A;  3JAM C;  1DGC A;  4DMI A;  2UUC E;  2NAB A;  1A1H A;  4BBY A;  2RQL A;  4NZV A;  2VQE E;  2DIX A;  5AE2 A;  4LF4 E;  3HXL A;  2MKN A;  1F2I G;  2EOX A;  4JI3 E;  1A1G A;  4MLQ A;  1EKZ A;  1B69 A;  2VF1 A;  2E5L E;  3EQ1 A;  1AAY A;  4DUZ E;  2YU8 A;  2ELZ A;  5IXM B;  2EMI A;  4OOG C;  4LFA E;  2FV4 B;  2L3C A;  2K7I A;  3UK3 C;  2VE7 C;  4NXM E;  2EM9 A;  2EMH A;  5LMU E;  2LE2 A;  3VYY A;  2PRT A;  2WCC 3;  2LT7 A;  1PJT A;  1PDA A;  2YSO A;  2LBS B;  1I94 E;  3DJW A;  3DF6 A;  2EM8 A;  2EPK X;  1X6H A;  1WJP A;  4F9A B;  1Z1B A;  2L92 A;  1UIL A;  2F8B A;  4WSG A;  4DKK A;  4LU9 A;  5DNY A;  2EQ1 A;  2KHX A;  2LJU A;  1IBK E;  2L2K B;  2EMC A;  2EN1 A;  3EPJ A;  4OX9 E;  2L3J A;  3OTO E;  2GLI A;  1YYW A;  2EOY A;  3K6Q A;  2YU5 A;  1GZ6 A;  4M9V C;  1YYK A;  1NCS A;  3TQM A;  4P78 A;  1T39 A;  2ENC A;  1DQ3 A;  2EM2 A;  1X49 A;  2EPP A;  2ELY A;  5LMN E;  1YYO A;  3EPK A;  4DV4 E;  4NXN E;  1JK1 A;  3ZOQ B;  5KL3 A;  1X6E A;  3KZY A;  2ENH A;  3MSW A;  2CT1 A;  2EZ6 A;  4BHB A;  2EM7 A;  2MDR A;  4KZS A;  4B3M E;  1X47 A;  2EOJ A;  3BBG A;  3THN A;  4F9C B;  4LF6 E;  2JY9 A;  3J80 C;  2VRD A;  2M9A A;  2NUF A;  1ZAA C;  5KL7 A;  4HEI A;  4MLV A;  1N34 E;  2LTS A;  4I8O A;  2EPO A;  3BGH A;  2ZM6 E;  2HC5 A;  2V86 A;  5FLX C;  2LMZ A;  2EOS A;  4WXC A;  2B7T A;  4BMJ A;  1SR9 A;  4LTY A;  3MHS C;  1TF6 A;  2DB2 A;  4DR1 E;  2UUB E;  1A1J A;  2HHH E;  1N3G A;  4X62 E;  1BBG A;  4ZYE A;  2IHR 1;  4O5G A;  2EMF A;  4WXD A;  4R2Q A;  4B3R E;  3ADL A;  2EWL A;  2L33 A;  4YY3 E;  2CTD A;  2EMW A;  2WZO A;  4JYA E;  1T4L B;  2YTI A;  4LF5 E;  4IJD A;  1YSA C;  2V87 A;  4ZYD A;  2LJH A;  2BBG A;  5ADZ A;  2EMG A;  1NEI A;  4RH8 A;  3C6K A;  3F6H A;  2DRP A;  2JWO A;  2YRH A;  4B3S E;  3T1H E;  1SFE A;  1EH6 A;  2EPN A;  5AC5 A;  1YFH A;  1RQ0 A;  2YPN A;  2MDG A;  3BF2 A;  1RMD A;  2BB8 A;  4F2J C;  1XMQ E;  3T1Y E;  4KWY A;  4J8Z A;  1N36 E;  2B9D A;  2EPC A;  4WSP A;  2EOH A;  2ODR D;  4Q35 B;  2LVH A;  2EJ4 A;  4BC9 A;  4R2A A;  2EMZ A;  2DGC A;  4JI4 E;  2JR1 A;  2DMI A;  4X66 E;  4O24 A;  4WPY A;  2CPN A;  2EMK A;  1QNT A;  5F3W A;  1X48 A;  2HJJ A;  2YZT A;  2N8X A;  4DUY E;  4JI5 E;  4M2Z A;  4JV5 E;  2KON A;  5KL2 A;  2KOU A;  1FJG E;  3MHH C;  2L6M A;  3THO B;  2EM6 A;  2EM0 A;  2MC5 A;  1X5W A;  2EM3 A;  3ADJ A;  1HNW E;  1EH8 A;  5KL4 A;  1P47 A;  2EM5 A;  4N4R B;  4DV2 E;  2L8T A;  3ECR A;  1A1F A;  1HR0 E;  2EPZ A;  4DR7 E;  4R8O A;  4X9J A;  2YWQ A;  2M1S A;  3LML A;  5A69 A;  1WRJ A;  2DLQ A;  2EN4 A;  4M0V A;  2YRM A;  2F4V E;  5A6B D;  1A1I A;  2CSH A;  2UUA E;  3IWB A;  1YZ9 A;  4M30 A;  3OML A;  2A25 A;  1LLM C;  4ZYH A;  4JI0 E;  5KL6 A;  4LF7 E;  2EPR A;  1N32 E;  4DR6 E;  1J26 A;  2GHF A;  4TUI A;  5LL6 R;  5A2Q C;  1G2D C;  1XNR E;  4GZN C;  5IT9 C;  4DV7 E;  2YTJ A;  2JVA A;  3IWC A;  4P7D A;  4LF9 E;  2EL6 A;  3ADG A;  2Q8U A;  4GEQ B;  2V89 A;  2EN6 A;  2UU9 E;  5IWA E;  2I9I A;  4F6N A;  2EPU A;  1KJK A;  4BHC A;  1JK2 A;  4JI8 E;  4LFB E;  1ZR9 A;  3FIG A;  2M4I A;  4GKJ E;  2M7Q A;  3HPS A;  3RMP A;  1YUJ A;  5TSE A;  1BBO A;  2EOI A;  1G2F C;  4X64 E;  1FKA E;  2HGH A;  4Q28 A;  2EQ3 A;  2V88 A;  4DR3 E;  2EOE A;  3JTZ A;  3AUZ A;  1GQE A;  3VK6 A;  2YTQ A;  3JU0 A;  4LF8 E;  2EPA A; 
#chains in the Genus database with same CATH homology
 3H09 A;  4BC9 A;  4B3T E;  1ZBQ A;  3LLH A;  4OX9 E;  2K4V A;  2RS7 A;  2L2N A;  3AV0 A;  2V8Q B;  2L3J A;  3OTO E;  2JOB A;  4DR2 E;  5T6J A;  4JI4 E;  1YYW A;  4K0K E;  2UXC E;  2JR1 A;  1XMO E;  2RS6 A;  3K6Q A;  4X66 E;  2LTR A;  4WPY A;  5AE3 A;  2VQF E;  1O0W A;  2CPN A;  4X65 E;  3KWR A;  1GZ6 A;  5F3W A;  1YYK A;  1X48 A;  4BS9 A;  2YZT A;  4P78 A;  1UHZ A;  2H36 X;  2LRS A;  4DUY E;  4JI5 E;  4M2Z A;  4JV5 E;  2KON A;  1DQ3 A;  1PKP A;  1X49 A;  1HNZ E;  2KOU A;  2MC6 A;  1HNX E;  1FJG E;  1ZBT A;  5LMN E;  2L6M A;  1YYO A;  3P1X A;  4DV4 E;  4NXN E;  4L5N C;  2MC5 A;  2B3T B;  1J5E E;  3ZOQ B;  4KHP E;  3J81 C;  2UXB E;  3ADJ A;  3MSW A;  2DMY A;  1HNW E;  2V83 A;  2EZ6 A;  4L8N A;  2MDR A;  1QU6 A;  2V85 A;  4KZS A;  4B3M E;  1X47 A;  5AAS A;  4DV2 E;  2L8T A;  4F9C B;  4LF6 E;  2JY9 A;  3HPZ A;  2UXD E;  3J7A G;  5AE1 A;  3J80 C;  1HR0 E;  2ODR C;  2DSY A;  4X8W A;  2JOX A;  4JI6 E;  4DR7 E;  3J7Y p;  4R8O A;  4B3R E;  1WHQ A;  4F9B B;  4BCA A;  3IWD A;  3VYX A;  2M1S A;  4F54 A;  3LML A;  4TUG A;  1N34 E;  2LTS A;  4I8O A;  4JI7 E;  1DI2 A;  2ZM6 E;  4R03 A;  2V86 A;  2RTX A;  2NUG A;  5FLX C;  2LMZ A;  1STU A;  4JI2 E;  3C4B A;  2E1M A;  3JAM C;  2B7T A;  4M0V A;  4BMJ A;  4DMI A;  2LUP B;  2UUC E;  2F4V E;  2UUA E;  4YHH E;  1SR9 A;  1WHN A;  3IWB A;  4M30 A;  4DV1 E;  4JI1 E;  3OML A;  4LTY A;  1YZ9 A;  4BBY A;  2DB2 A;  4DR1 E;  2UUB E;  2NUE A;  1N33 E;  2VQE E;  2DIX A;  5AE2 A;  4JI0 E;  3HXL A;  4LF4 E;  4LF7 E;  2HHH E;  1N32 E;  4DR6 E;  1J26 A;  4DR5 E;  4X62 E;  4JI3 E;  4TUI A;  5LL6 R;  2IHR 1;  3HQ1 A;  5A2Q C;  4GKK E;  1EKZ A;  1XNR E;  5IT9 C;  2VF1 A;  2E5L E;  4DV7 E;  2EWL A;  2JVA A;  2L33 A;  3IWC A;  4P7D A;  4YY3 E;  3ADL A;  4LF9 E;  3ADG A;  4DUZ E;  4GEQ B;  4BC7 A;  3ADI A;  2V89 A;  2RSM A;  2WZO A;  2YT4 A;  2UU9 E;  5IWA E;  4JYA E;  1T4O A;  1T4L B;  4OOG C;  4LFA E;  1RC7 A;  4DV5 E;  1IBL E;  2FV4 B;  2N3G A;  4LF5 E;  4JI8 E;  2L3C A;  4LFB E;  2V87 A;  4NXM E;  2VE7 C;  3FIG A;  2M4I A;  2LJH A;  4DV6 E;  2M7Q A;  5ADZ A;  3HPS A;  1WXR A;  4WFT A;  3RMP A;  4GKJ E;  3F6H A;  2LE2 A;  5LMU E;  3VYY A;  1IBM E;  4AQY E;  2JWO A;  4B3S E;  3T1H E;  4LF8 E;  4X64 E;  2LBS B;  1I94 E;  1FKA E;  2LUQ A;  5BR8 E;  4DV3 E;  1RQ0 A;  3DJW A;  4DV0 E;  3DF6 A;  2G7H A;  4Q28 A;  4LFC E;  2V88 A;  2FTX B;  5CFF E;  4DR3 E;  4F9A B;  3T1Y E;  1XMQ E;  2FGG A;  2NA2 A;  4J8Z A;  2B7V A;  3HTX A;  3JTZ A;  1N36 E;  4DR4 E;  2L92 A;  1UIL A;  2B9D A;  1T4N A;  2F8B A;  3F6G A;  2N3H A;  4DKK A;  4LU9 A;  3AUZ A;  1GQE A;  3C4T A;  2KHX A;  4WSP A;  3JU0 A;  2L2M A;  3VK6 A;  5DNY A;  2ODR D;  2L2K B;  1IBK E;  1XNQ E;  4WYQ B;  2NUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...