1WHQA

Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA helicase A
publication title Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
rcsb
source organism Mus musculus
total genus 17
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whqA01
2B7VA 1J26A 1EKZA 3T1HE 1N34E 2DIXA 4JI0E 1HNWE 1X47A 1PKPA 4DV6E 3VYYA 5IWAE 2LJHA 1RC7A 2NUEA 2B3TB 2L2MA 1T4LB 1IBME 2LUPB 1IBLE 4JI5E 4DV4E 2EZ6A 1X49A 3OTOE 2NUGA 4WYQB 2LUQA 1HNXE 3P1XA 1J5EE 1ZBTA 2N3HA 3C4BA 1FKAE 4LF4E 4LF7E 1FJGE 4DR3E 4X64E 3J7Yp 2DB2A 2RS6A 3T1YE 4YHHE 2LBSB 2LTRA 4X65E 2N3GA 4OOGC 2LTSA 4KHPE 4JV5E 2CPNA 1QU6A 3ADLA 3ADIA 1YYOA 2KHXA 3ADJA 2B7TA 1XNRE 3VYXA 3C4TA 5CFFE 4DV2E 3LLHA 1YYKA 2RSMA 4X8WA 2UU9E 4LF8E 1RQ0A 2IHR1 4GKJE 2DMYA 4JI8E 4DR2E 4DR4E 1N33E 4JI6E 4JI3E 4DUYE 2UUAE 4X62E 4NXME 4DR6E 1WHNA 4M30A 1N36E 4WFTA 1HR0E 1N32E 2ZM6E 3HTXA 4OX9E 2VQFE 4LF5E 4GKKE 2UUBE 4JI2E 4DKKA 2MDRA 4DV7E 2NA2A 1UILA 2RTXA 1O0WA 4DV5E 2E5LE 4B3TE 4JI1E 2YT4A 4AQYE 1HNZE 4DR5E 2UXDE 4JI7E 1T4OA 1I94E 4LF6E 2HHHE 4NXNE 4X66E 5LMUE 2NUFA 1T4NA 2L2KB 4JYAE 1X48A 2L2NA 4DR7E 1XMQE 2UXBE 5BR8E 4JI4E 2RS7A 4M2ZA 4DV0E 2LRSA 4DV3E 4YY3E 1DI2A 1WHQA 1IBKE 2L3CA 2VQEE 4LFAE 2UXCE 5LMNE 4LFCE 1YYWA 2L33A 2UUCE 4LFBE 4B3RE 1XNQE 4B3ME 2F4VE 1UHZA 2JVAA 4DUZE 4K0KE 1STUA 4DR1E 4B3SE 1GQEA 2L3JA 3ADGA 4LF9E 1YZ9A 4DV1E 2JY9A 1XMOE
chains in the Genus database with same CATH superfamily
2YSPA 2EL6A 2YSOA 1G2FC 3T1HE 4JI0E 2EPKX 1DQ3A 1X47A 2FGGA 4R2CA 3RMPA 2EPAA 3K6QA 4KZSA 3AUZA 2LVHA 2CSHA 2YTOA 2EN2A 1WXRA 3F6HA 4F54A 2EPXA 2GLIA 4WSPA 3MSWA 1X49A 5IXMB 2EZ6A 1A1KA 4ZYHA 2EPRA 3HXLA 1X6HA 2JOXA 2EM8A 1TF6A 4DMIA 3J7Yp 2R76A 3T1YE 2EOZA 4O43A 2H36X 4OOGC 2CPNA 1QU6A 3ADLA 2EN3A 4BC9A 2N8XA 2EP3A 1X5WA 1X6FA 2V87A 2DMIA 4BC7A 2EOYA 2EN6A 2VE7C 2UU9E 4LF8E 2EMWA 4R2SA 3F6GA 4JI6E 4DUYE 1WHNA 1N32E 2ZM6E 4LU9A 1RMDA 5AE1A 4LF5E 1PJQA 3L00A 2MDRA 1ZAAC 4BHCA 2MKNA 1A1GA 1UILA 2WZOA 2RTXA 3KWRA 1O0WA 2YU5A 2YPNA 1T38A 2EM5A 1YUJA 2M7QA 4JI1E 2YU8A 4MLQA 2EQ1A 1HNZE 5ADZA 5KL2A 1I94E 4LF6E 2V85A 4X66E 5LMUE 2R1FA 1SFEA 4HTGA 4GEQB 4DR7E 3BGHA 4JI4E 2V86A 5IT9C 2LRSA 2EMXA 4KWYA 1DI2A 2JPAA 2E1MA 2DLQA 2L3CA 2VQEE 2ENAA 2JP9A 4R2PA 1T39A 4R8OA 4WSGA 2EL5A 4LFBE 1MEYC 4B3RE 2EM7A 4F9CB 4B3ME 2EM2A 2EOHA 2EM3A 1IQSA 4J8ZA 2LO3A 1UBDC 4K0KE 2LE2A 1IQOA 2MKDA 3HQ1A 2L3JA 4WXDA 2EOOA 2B9DA 1TN9A 2YWQA 1IMUA 2B7VA 1ZR9A 1J26A 1N34E 4M0VA 4DV6E 3VYYA 5TSEA 2DGCA 4L5NC 1IBME 4IJDA 2ODRD 4JI5E 2EWLA 2NUGA 2YTNA 2EMYA 2LUQA 3BIDA 3P1XA 3ZOQB 1ZBTA 2WBUA 1B69A 1YFHA 2BBGA 2RQLA 4JV5E 4KHPE 3ECRA 1F2IG 3C6KA 1EH7A 2KHXA 3DJWA 1XNRE 3C4TA 4Q28A 2BB8A 2HJJA 5KL3A 1RQ0A 2IHR1 4GKJE 4JI8E 1MGTA 4ZYEA 2CTDA 4O5GA 1N33E 4JI3E 4NXME 2RPCA 2ENHA 2L8TA 4WFTA 2EMHA 2EMIA 3HTXA 3JU0A 2LJUA 2LMZA 2EOEA 4GKKE 4F9AB 5A6BA 2YRMA 4BBYA 1LLMC 2GPIA 3THOB 2EMFA 2NA2A 1N3GA 4RH8A 4BHBA 2EM6A 2EMAA 2E5LE 4B3TE 1GTKA 4DR5E 1G2DC 4JI7E 1T4OA 3DF6A 2I9IA 1DGCA 2EPUA 2EMKA 2L2KB 4JYAE 2YTFA 5BR8E 3EPKA 2EN7A 1YPNA 2L6MA 3IWDA 3HPZA 2RSIA 4YY3E 4R2EA 4O4KA 2D9HA 4MLVA 3EPHA 1JK2A 1BBGA 3FIGA 2UUCE 3J80C 2J7JA 1KJKA 2V83A 4FK5C 3HPSA 1EH6A 2MDGA 2F4VE 1A1IA 1UHZA 2JVAA 4P7DA 2LCEA 4DUZE 4ZYDA 2HGHA 1NEIA 4NHRA 1GQEA 4WX9A 3KZYA 4DV1E 2JY9A 3EPJA 5AC4A 3BF2A 4O24A 2DIXA 2YTIA 2EMLA 2YTQA 1PKPA 1X3CA 2EMCA 5IWAE 1RC7A 2EORA 2B3TB 2EPLX 2NUEA 2L2MA 2ENCA 2K4VA 1IBLE 4DV4E 3OTOE 2JYAA 4TUGA 1GZ6A 2YTDA 2JWOA 1BBOA 2V8QB 4R03A 1FKAE 1YUIA 3OMLA 3VK6A 3H09A 3J81C 4DR3E 4X64E 2DB2A 2LBSB 4X65E 3J7AG 5KL5A 5LL6R 3TQMA 4R2QA 3MHSC 3ADIA 5A6AA 1YYOA 3ADJA 3VYXA 1AAYA 2EN4A 1A1FA 5CFFE 2L92A 5KL6A 4DV2E 3LLHA 2JOBA 4N4RB 4X8WA 1TF3A 4IS1C 2DMYA 4DR2E 4DR4E 2EM4A 1ZBQA 2YTPA 2EM9A 4X62E 2UUAE 4M30A 1N36E 1HR0E 4L8NA 4OX9E 1NCSA 2EOIA 2VQFE 5FLXC 1WJPA 2MC6A 4JI2E 4DKKA 4DV7E 1BB8A 3UK3C 2EPCA 5KL4A 4Q35B 2UXDE 4RHBB 2G7HA 4ZYGA 1EH8A 2WCC3 5A2QC 2EMZA 2LT7A 2EOXA 2KONA 4HEIA 5A6KA 2UXBE 2HC5A 4DV0E 2JR1A 5AASA 2Q8UA 2DSYA 2ODRC 4DV3E 2DLKA 2EPMX 2F8BA 2EM0A 3THNA 4LFAE 2UXCE 4LFCE 1YYWA 3IWCA 5KL7A 4F6NA 4X9JA 1XNQE 2EOQA 2EL4A 2EQ3A 3IWBA 2MC5A 1ZU1A 2EPOA 2FTXB 4WXCA 3KZZA 2EPZA 1YZ9A 2EE8A 1A1LA 3BBGA 2EN8A 1EKZA 2EOMA 2EQ0A 2M4IA 1WRJA 5A6BD 1HNWE 2LJHA 4BS9A 2K7IA 1T4LB 2YRHA 4LTYA 2EOFA 2EOSA 2LUPB 2EN1A 4NZVA 1P47A 2WBTA 2M1SA 4WYQB 1HNXE 1J5EE 2N3HA 2YTGA 3C4BA 1KYQA 4LF4E 4LF7E 1FJGE 4R2RA 2E72A 2RS6A 4YHHE 2LTRA 1PDAA 2N3GA 2EJ4A 2YTEA 1AH5A 2LTSA 3QG5C 4TUIA 4R2AA 1JK1A 2B7TA 2LV2A 1YYKA 2RSMA 1SR9A 4F9BB 1PJSA 4I8OA 5F3WA 1QNTA 5A6JA 2EMBA 5AE2A 4DR6E 1A1JA 2YRKA 3EQ1A 2WBSA 1X6EA 5AE3A 2YZTA 3EPLA 2I13A 2ADRA 2UUBE 2EPNA 5T6JA 3JTZA 4BMJA 5AC5A 2A25A 3M99B 5DNYA 2KOUA 4DV5E 4P78A 2YT4A 4AQYE 5LLQA 2V88A 1Z1BA 2HHHE 4NXNE 1YSAC 2NUFA 1T4NA 4WPYA 1X48A 2L2NA 3MHHC 5IV8B 1XMQE 2YTJA 3AV0A 4M2ZA 2NABA 2RS7A 1PJTA 2DRPA 2FV4B 4BCAA 5A69A 4GZNC 4F2JC 1WHQA 1IBKE 4M9VC 2EPPA 1A1HA 3C6MA 5LMNE 2GHFA 4R2DA 1UN6B 2M9AA 2JXPA 2L33A 4F6MA 2PRTA 2VF1A 3VHTB 2V89A 1STUA 4DR1E 4B3SE 1L4SA 2VRDA 2ELZA 2EMGA 3ADGA 4LF9E 3LMLA 2EOJA 2CT1A 3JAMC 2ELYA 1XMOE
chains in the Genus database with same CATH topology
2B7VA 1J26A 1EKZA 3T1HE 1N34E 2M4IA 2DIXA 4JI0E 1HNWE 1X47A 1DQ3A 1PKPA 2FGGA 4M0VA 4DV6E 3VYYA 5IWAE 2LJHA 4BS9A 3RMPA 2B3TB 1RC7A 2NUEA 2L2MA 3K6QA 4KZSA 3AUZA 4L5NC 4LTYA 2K4VA 1T4LB 1IBME 1WXRA 2LUPB 3F6HA 4F54A 2ODRD 1IBLE 4DV4E 4JI5E 4WSPA 2EWLA 1X49A 3MSWA 3OTOE 2EZ6A 4WYQB 2M1SA 2NUGA 2LUQA 1HNXE 3P1XA 1GZ6A 3ZOQB 4TUGA 2JWOA 3HXLA 1ZBTA 2N3HA 2V8QB 3C4BA 4R03A 1J5EE 1FKAE 2JOXA 3OMLA 3VK6A 4LF4E 4LF7E 3H09A 1FJGE 4DMIA 3J81C 4DR3E 4X64E 2DB2A 3J7Yp 2RS6A 4DR6E 3T1YE 4YHHE 2LBSB 2LTRA 4X65E 3J7AG 2N3GA 2H36X 5LL6R 4OOGC 2LTSA 4KHPE 4JV5E 2CPNA 1QU6A 4TUIA 3ADLA 4BC9A 1YYOA 3ADIA 2KHXA 3ADJA 2B7TA 3DJWA 1XNRE 3VYXA 3C4TA 4Q28A 5CFFE 2L92A 2V87A 4BC7A 4DV2E 3LLHA 2JOBA 1YYKA 2RSMA 1SR9A 2VE7C 4F9BB 4X8WA 2UU9E 4LF8E 1RQ0A 2IHR1 4I8OA 4GKJE 3F6GA 2DMYA 4JI8E 4DR2E 5F3WA 4DR4E 1N33E 4JI6E 1ZBQA 4DUYE 2UUAE 4X62E 4JI3E 5AE2A 4NXME 2L8TA 1WHNA 4M30A 1N36E 4WFTA 1HR0E 1N32E 2ZM6E 3HTXA 4L8NA 4OX9E 3JU0A 4LU9A 2LMZA 5AE3A 2VQFE 2YZTA 5AE1A 4LF5E 4F9AB 4GKKE 5FLXC 2UUBE 2MC6A 4JI2E 4BBYA 4DKKA 2MDRA 5T6JA 4DV7E 3JTZA 4BMJA 2NA2A 1UILA 2WZOA 2RTXA 3KWRA 5DNYA 1O0WA 2KOUA 4DV5E 4P78A 2E5LE 4B3TE 2M7QA 4JI1E 2YT4A 4AQYE 1HNZE 4DR5E 2UXDE 4JI7E 5ADZA 2G7HA 1T4OA 2V88A 1I94E 4LF6E 3DF6A 2HHHE 4NXNE 2V85A 4X66E 5A2QC 5LMUE 2NUFA 1T4NA 4WPYA 2L2KB 1X48A 2L2NA 4JYAE 2KONA 4GEQB 4DR7E 1XMQE 2UXBE 3AV0A 5BR8E 2RS7A 4JI4E 3IWDA 2L6MA 4M2ZA 2V86A 4DV0E 2LRSA 5IT9C 2JR1A 2FV4B 3HPZA 4BCAA 5AASA 2DSYA 2ODRC 4DV3E 4YY3E 1DI2A 2F8BA 2E1MA 1WHQA 1IBKE 2L3CA 2VQEE 4LFAE 2UXCE 5LMNE 4LFCE 1YYWA 3IWCA 4R8OA 3FIGA 2L33A 2UUCE 4LFBE 4B3RE 3J80C 1XNQE 2V83A 3HPSA 4F9CB 4B3ME 2F4VE 3IWBA 1UHZA 2JVAA 4P7DA 2VF1A 2MC5A 4DUZE 4J8ZA 4K0KE 2LE2A 2V89A 1STUA 4DR1E 3HQ1A 2FTXB 4B3SE 1GQEA 2L3JA 3ADGA 4LF9E 1YZ9A 3LMLA 3JAMC 4DV1E 2B9DA 2JY9A 1XMOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7V A;  1J26 A;  1EKZ A;  3T1H E;  1N34 E;  2DIX A;  4JI0 E;  1HNW E;  1X47 A;  1PKP A;  4DV6 E;  3VYY A;  5IWA E;  2LJH A;  1RC7 A;  2NUE A;  2B3T B;  2L2M A;  1T4L B;  1IBM E;  2LUP B;  1IBL E;  4JI5 E;  4DV4 E;  2EZ6 A;  1X49 A;  3OTO E;  2NUG A;  4WYQ B;  2LUQ A;  1HNX E;  3P1X A;  1J5E E;  1ZBT A;  2N3H A;  3C4B A;  1FKA E;  4LF4 E;  4LF7 E;  1FJG E;  4DR3 E;  4X64 E;  3J7Y p;  2DB2 A;  2RS6 A;  3T1Y E;  4YHH E;  2LBS B;  2LTR A;  4X65 E;  2N3G A;  4OOG C;  2LTS A;  4KHP E;  4JV5 E;  2CPN A;  1QU6 A;  3ADL A;  3ADI A;  1YYO A;  2KHX A;  3ADJ A;  2B7T A;  1XNR E;  3VYX A;  3C4T A;  5CFF E;  4DV2 E;  3LLH A;  1YYK A;  2RSM A;  4X8W A;  2UU9 E;  4LF8 E;  1RQ0 A;  2IHR 1;  4GKJ E;  2DMY A;  4JI8 E;  4DR2 E;  4DR4 E;  1N33 E;  4JI6 E;  4JI3 E;  4DUY E;  2UUA E;  4X62 E;  4NXM E;  4DR6 E;  1WHN A;  4M30 A;  1N36 E;  4WFT A;  1HR0 E;  1N32 E;  2ZM6 E;  3HTX A;  4OX9 E;  2VQF E;  4LF5 E;  4GKK E;  2UUB E;  4JI2 E;  4DKK A;  2MDR A;  4DV7 E;  2NA2 A;  1UIL A;  2RTX A;  1O0W A;  4DV5 E;  2E5L E;  4B3T E;  4JI1 E;  2YT4 A;  4AQY E;  1HNZ E;  4DR5 E;  2UXD E;  4JI7 E;  1T4O A;  1I94 E;  4LF6 E;  2HHH E;  4NXN E;  4X66 E;  5LMU E;  2NUF A;  1T4N A;  2L2K B;  4JYA E;  1X48 A;  2L2N A;  4DR7 E;  1XMQ E;  2UXB E;  5BR8 E;  4JI4 E;  2RS7 A;  4M2Z A;  4DV0 E;  2LRS A;  4DV3 E;  4YY3 E;  1DI2 A;  1WHQ A;  1IBK E;  2L3C A;  2VQE E;  4LFA E;  2UXC E;  5LMN E;  4LFC E;  1YYW A;  2L33 A;  2UUC E;  4LFB E;  4B3R E;  1XNQ E;  4B3M E;  2F4V E;  1UHZ A;  2JVA A;  4DUZ E;  4K0K E;  1STU A;  4DR1 E;  4B3S E;  1GQE A;  2L3J A;  3ADG A;  4LF9 E;  1YZ9 A;  4DV1 E;  2JY9 A;  1XMO E; 
#chains in the Genus database with same CATH topology
 2YSP A;  2EL6 A;  2YSO A;  1G2F C;  3T1H E;  4JI0 E;  2EPK X;  1DQ3 A;  1X47 A;  2FGG A;  4R2C A;  3RMP A;  2EPA A;  3K6Q A;  4KZS A;  3AUZ A;  2LVH A;  2CSH A;  2YTO A;  2EN2 A;  1WXR A;  3F6H A;  4F54 A;  2EPX A;  2GLI A;  4WSP A;  3MSW A;  1X49 A;  5IXM B;  2EZ6 A;  1A1K A;  4ZYH A;  2EPR A;  3HXL A;  1X6H A;  2JOX A;  2EM8 A;  1TF6 A;  4DMI A;  3J7Y p;  2R76 A;  3T1Y E;  2EOZ A;  4O43 A;  2H36 X;  4OOG C;  2CPN A;  1QU6 A;  3ADL A;  2EN3 A;  4BC9 A;  2N8X A;  2EP3 A;  1X5W A;  1X6F A;  2V87 A;  2DMI A;  4BC7 A;  2EOY A;  2EN6 A;  2VE7 C;  2UU9 E;  4LF8 E;  2EMW A;  4R2S A;  3F6G A;  4JI6 E;  4DUY E;  1WHN A;  1N32 E;  2ZM6 E;  4LU9 A;  1RMD A;  5AE1 A;  4LF5 E;  1PJQ A;  3L00 A;  2MDR A;  1ZAA C;  4BHC A;  2MKN A;  1A1G A;  1UIL A;  2WZO A;  2RTX A;  3KWR A;  1O0W A;  2YU5 A;  2YPN A;  1T38 A;  2EM5 A;  1YUJ A;  2M7Q A;  4JI1 E;  2YU8 A;  4MLQ A;  2EQ1 A;  1HNZ E;  5ADZ A;  5KL2 A;  1I94 E;  4LF6 E;  2V85 A;  4X66 E;  5LMU E;  2R1F A;  1SFE A;  4HTG A;  4GEQ B;  4DR7 E;  3BGH A;  4JI4 E;  2V86 A;  5IT9 C;  2LRS A;  2EMX A;  4KWY A;  1DI2 A;  2JPA A;  2E1M A;  2DLQ A;  2L3C A;  2VQE E;  2ENA A;  2JP9 A;  4R2P A;  1T39 A;  4R8O A;  4WSG A;  2EL5 A;  4LFB E;  1MEY C;  4B3R E;  2EM7 A;  4F9C B;  4B3M E;  2EM2 A;  2EOH A;  2EM3 A;  1IQS A;  4J8Z A;  2LO3 A;  1UBD C;  4K0K E;  2LE2 A;  1IQO A;  2MKD A;  3HQ1 A;  2L3J A;  4WXD A;  2EOO A;  2B9D A;  1TN9 A;  2YWQ A;  1IMU A;  2B7V A;  1ZR9 A;  1J26 A;  1N34 E;  4M0V A;  4DV6 E;  3VYY A;  5TSE A;  2DGC A;  4L5N C;  1IBM E;  4IJD A;  2ODR D;  4JI5 E;  2EWL A;  2NUG A;  2YTN A;  2EMY A;  2LUQ A;  3BID A;  3P1X A;  3ZOQ B;  1ZBT A;  2WBU A;  1B69 A;  1YFH A;  2BBG A;  2RQL A;  4JV5 E;  4KHP E;  3ECR A;  1F2I G;  3C6K A;  1EH7 A;  2KHX A;  3DJW A;  1XNR E;  3C4T A;  4Q28 A;  2BB8 A;  2HJJ A;  5KL3 A;  1RQ0 A;  2IHR 1;  4GKJ E;  4JI8 E;  1MGT A;  4ZYE A;  2CTD A;  4O5G A;  1N33 E;  4JI3 E;  4NXM E;  2RPC A;  2ENH A;  2L8T A;  4WFT A;  2EMH A;  2EMI A;  3HTX A;  3JU0 A;  2LJU A;  2LMZ A;  2EOE A;  4GKK E;  4F9A B;  5A6B A;  2YRM A;  4BBY A;  1LLM C;  2GPI A;  3THO B;  2EMF A;  2NA2 A;  1N3G A;  4RH8 A;  4BHB A;  2EM6 A;  2EMA A;  2E5L E;  4B3T E;  1GTK A;  4DR5 E;  1G2D C;  4JI7 E;  1T4O A;  3DF6 A;  2I9I A;  1DGC A;  2EPU A;  2EMK A;  2L2K B;  4JYA E;  2YTF A;  5BR8 E;  3EPK A;  2EN7 A;  1YPN A;  2L6M A;  3IWD A;  3HPZ A;  2RSI A;  4YY3 E;  4R2E A;  4O4K A;  2D9H A;  4MLV A;  3EPH A;  1JK2 A;  1BBG A;  3FIG A;  2UUC E;  3J80 C;  2J7J A;  1KJK A;  2V83 A;  4FK5 C;  3HPS A;  1EH6 A;  2MDG A;  2F4V E;  1A1I A;  1UHZ A;  2JVA A;  4P7D A;  2LCE A;  4DUZ E;  4ZYD A;  2HGH A;  1NEI A;  4NHR A;  1GQE A;  4WX9 A;  3KZY A;  4DV1 E;  2JY9 A;  3EPJ A;  5AC4 A;  3BF2 A;  4O24 A;  2DIX A;  2YTI A;  2EML A;  2YTQ A;  1PKP A;  1X3C A;  2EMC A;  5IWA E;  1RC7 A;  2EOR A;  2B3T B;  2EPL X;  2NUE A;  2L2M A;  2ENC A;  2K4V A;  1IBL E;  4DV4 E;  3OTO E;  2JYA A;  4TUG A;  1GZ6 A;  2YTD A;  2JWO A;  1BBO A;  2V8Q B;  4R03 A;  1FKA E;  1YUI A;  3OML A;  3VK6 A;  3H09 A;  3J81 C;  4DR3 E;  4X64 E;  2DB2 A;  2LBS B;  4X65 E;  3J7A G;  5KL5 A;  5LL6 R;  3TQM A;  4R2Q A;  3MHS C;  3ADI A;  5A6A A;  1YYO A;  3ADJ A;  3VYX A;  1AAY A;  2EN4 A;  1A1F A;  5CFF E;  2L92 A;  5KL6 A;  4DV2 E;  3LLH A;  2JOB A;  4N4R B;  4X8W A;  1TF3 A;  4IS1 C;  2DMY A;  4DR2 E;  4DR4 E;  2EM4 A;  1ZBQ A;  2YTP A;  2EM9 A;  4X62 E;  2UUA E;  4M30 A;  1N36 E;  1HR0 E;  4L8N A;  4OX9 E;  1NCS A;  2EOI A;  2VQF E;  5FLX C;  1WJP A;  2MC6 A;  4JI2 E;  4DKK A;  4DV7 E;  1BB8 A;  3UK3 C;  2EPC A;  5KL4 A;  4Q35 B;  2UXD E;  4RHB B;  2G7H A;  4ZYG A;  1EH8 A;  2WCC 3;  5A2Q C;  2EMZ A;  2LT7 A;  2EOX A;  2KON A;  4HEI A;  5A6K A;  2UXB E;  2HC5 A;  4DV0 E;  2JR1 A;  5AAS A;  2Q8U A;  2DSY A;  2ODR C;  4DV3 E;  2DLK A;  2EPM X;  2F8B A;  2EM0 A;  3THN A;  4LFA E;  2UXC E;  4LFC E;  1YYW A;  3IWC A;  5KL7 A;  4F6N A;  4X9J A;  1XNQ E;  2EOQ A;  2EL4 A;  2EQ3 A;  3IWB A;  2MC5 A;  1ZU1 A;  2EPO A;  2FTX B;  4WXC A;  3KZZ A;  2EPZ A;  1YZ9 A;  2EE8 A;  1A1L A;  3BBG A;  2EN8 A;  1EKZ A;  2EOM A;  2EQ0 A;  2M4I A;  1WRJ A;  5A6B D;  1HNW E;  2LJH A;  4BS9 A;  2K7I A;  1T4L B;  2YRH A;  4LTY A;  2EOF A;  2EOS A;  2LUP B;  2EN1 A;  4NZV A;  1P47 A;  2WBT A;  2M1S A;  4WYQ B;  1HNX E;  1J5E E;  2N3H A;  2YTG A;  3C4B A;  1KYQ A;  4LF4 E;  4LF7 E;  1FJG E;  4R2R A;  2E72 A;  2RS6 A;  4YHH E;  2LTR A;  1PDA A;  2N3G A;  2EJ4 A;  2YTE A;  1AH5 A;  2LTS A;  3QG5 C;  4TUI A;  4R2A A;  1JK1 A;  2B7T A;  2LV2 A;  1YYK A;  2RSM A;  1SR9 A;  4F9B B;  1PJS A;  4I8O A;  5F3W A;  1QNT A;  5A6J A;  2EMB A;  5AE2 A;  4DR6 E;  1A1J A;  2YRK A;  3EQ1 A;  2WBS A;  1X6E A;  5AE3 A;  2YZT A;  3EPL A;  2I13 A;  2ADR A;  2UUB E;  2EPN A;  5T6J A;  3JTZ A;  4BMJ A;  5AC5 A;  2A25 A;  3M99 B;  5DNY A;  2KOU A;  4DV5 E;  4P78 A;  2YT4 A;  4AQY E;  5LLQ A;  2V88 A;  1Z1B A;  2HHH E;  4NXN E;  1YSA C;  2NUF A;  1T4N A;  4WPY A;  1X48 A;  2L2N A;  3MHH C;  5IV8 B;  1XMQ E;  2YTJ A;  3AV0 A;  4M2Z A;  2NAB A;  2RS7 A;  1PJT A;  2DRP A;  2FV4 B;  4BCA A;  5A69 A;  4GZN C;  4F2J C;  1WHQ A;  1IBK E;  4M9V C;  2EPP A;  1A1H A;  3C6M A;  5LMN E;  2GHF A;  4R2D A;  1UN6 B;  2M9A A;  2JXP A;  2L33 A;  4F6M A;  2PRT A;  2VF1 A;  3VHT B;  2V89 A;  1STU A;  4DR1 E;  4B3S E;  1L4S A;  2VRD A;  2ELZ A;  2EMG A;  3ADG A;  4LF9 E;  3LML A;  2EOJ A;  2CT1 A;  3JAM C;  2ELY A;  1XMO E; 
#chains in the Genus database with same CATH homology
 2B7V A;  1J26 A;  1EKZ A;  3T1H E;  1N34 E;  2M4I A;  2DIX A;  4JI0 E;  1HNW E;  1X47 A;  1DQ3 A;  1PKP A;  2FGG A;  4M0V A;  4DV6 E;  3VYY A;  5IWA E;  2LJH A;  4BS9 A;  3RMP A;  2B3T B;  1RC7 A;  2NUE A;  2L2M A;  3K6Q A;  4KZS A;  3AUZ A;  4L5N C;  4LTY A;  2K4V A;  1T4L B;  1IBM E;  1WXR A;  2LUP B;  3F6H A;  4F54 A;  2ODR D;  1IBL E;  4DV4 E;  4JI5 E;  4WSP A;  2EWL A;  1X49 A;  3MSW A;  3OTO E;  2EZ6 A;  4WYQ B;  2M1S A;  2NUG A;  2LUQ A;  1HNX E;  3P1X A;  1GZ6 A;  3ZOQ B;  4TUG A;  2JWO A;  3HXL A;  1ZBT A;  2N3H A;  2V8Q B;  3C4B A;  4R03 A;  1J5E E;  1FKA E;  2JOX A;  3OML A;  3VK6 A;  4LF4 E;  4LF7 E;  3H09 A;  1FJG E;  4DMI A;  3J81 C;  4DR3 E;  4X64 E;  2DB2 A;  3J7Y p;  2RS6 A;  4DR6 E;  3T1Y E;  4YHH E;  2LBS B;  2LTR A;  4X65 E;  3J7A G;  2N3G A;  2H36 X;  5LL6 R;  4OOG C;  2LTS A;  4KHP E;  4JV5 E;  2CPN A;  1QU6 A;  4TUI A;  3ADL A;  4BC9 A;  1YYO A;  3ADI A;  2KHX A;  3ADJ A;  2B7T A;  3DJW A;  1XNR E;  3VYX A;  3C4T A;  4Q28 A;  5CFF E;  2L92 A;  2V87 A;  4BC7 A;  4DV2 E;  3LLH A;  2JOB A;  1YYK A;  2RSM A;  1SR9 A;  2VE7 C;  4F9B B;  4X8W A;  2UU9 E;  4LF8 E;  1RQ0 A;  2IHR 1;  4I8O A;  4GKJ E;  3F6G A;  2DMY A;  4JI8 E;  4DR2 E;  5F3W A;  4DR4 E;  1N33 E;  4JI6 E;  1ZBQ A;  4DUY E;  2UUA E;  4X62 E;  4JI3 E;  5AE2 A;  4NXM E;  2L8T A;  1WHN A;  4M30 A;  1N36 E;  4WFT A;  1HR0 E;  1N32 E;  2ZM6 E;  3HTX A;  4L8N A;  4OX9 E;  3JU0 A;  4LU9 A;  2LMZ A;  5AE3 A;  2VQF E;  2YZT A;  5AE1 A;  4LF5 E;  4F9A B;  4GKK E;  5FLX C;  2UUB E;  2MC6 A;  4JI2 E;  4BBY A;  4DKK A;  2MDR A;  5T6J A;  4DV7 E;  3JTZ A;  4BMJ A;  2NA2 A;  1UIL A;  2WZO A;  2RTX A;  3KWR A;  5DNY A;  1O0W A;  2KOU A;  4DV5 E;  4P78 A;  2E5L E;  4B3T E;  2M7Q A;  4JI1 E;  2YT4 A;  4AQY E;  1HNZ E;  4DR5 E;  2UXD E;  4JI7 E;  5ADZ A;  2G7H A;  1T4O A;  2V88 A;  1I94 E;  4LF6 E;  3DF6 A;  2HHH E;  4NXN E;  2V85 A;  4X66 E;  5A2Q C;  5LMU E;  2NUF A;  1T4N A;  4WPY A;  2L2K B;  1X48 A;  2L2N A;  4JYA E;  2KON A;  4GEQ B;  4DR7 E;  1XMQ E;  2UXB E;  3AV0 A;  5BR8 E;  2RS7 A;  4JI4 E;  3IWD A;  2L6M A;  4M2Z A;  2V86 A;  4DV0 E;  2LRS A;  5IT9 C;  2JR1 A;  2FV4 B;  3HPZ A;  4BCA A;  5AAS A;  2DSY A;  2ODR C;  4DV3 E;  4YY3 E;  1DI2 A;  2F8B A;  2E1M A;  1WHQ A;  1IBK E;  2L3C A;  2VQE E;  4LFA E;  2UXC E;  5LMN E;  4LFC E;  1YYW A;  3IWC A;  4R8O A;  3FIG A;  2L33 A;  2UUC E;  4LFB E;  4B3R E;  3J80 C;  1XNQ E;  2V83 A;  3HPS A;  4F9C B;  4B3M E;  2F4V E;  3IWB A;  1UHZ A;  2JVA A;  4P7D A;  2VF1 A;  2MC5 A;  4DUZ E;  4J8Z A;  4K0K E;  2LE2 A;  2V89 A;  1STU A;  4DR1 E;  3HQ1 A;  2FTX B;  4B3S E;  1GQE A;  2L3J A;  3ADG A;  4LF9 E;  1YZ9 A;  3LML A;  3JAM C;  4DV1 E;  2B9D A;  2JY9 A;  1XMO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...