1WHQA

Solution structure of the n-terminal dsrbd from hypothetical protein bab28848
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGIKNFLYAWCGKRKMTPAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQSNAARDFVNYLVRINEVKSEEVPAVGIVPPPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA helicase A
publication title Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 17
structure length 99
sequence length 99
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1whqA01
1YYOA 3OTOE 1UILA 4JV5E 2LBSB 1XNRE 1XMQE 4M30A 2RS6A 4YY3E 1PKPA 1ZBTA 1EKZA 2F4VE 4DV0E 5CFFE 4DR3E 1J5EE 1IBME 5BR8E 4DV2E 1WHQA 4DKKA 1HNZE 3ADGA 4DV5E 1IBKE 2YT4A 4X62E 4JI2E 4B3ME 1T4OA 4DUZE 4DV3E 4JI1E 1X47A 2LRSA 4AQYE 1XMOE 1YYWA 4GKKE 1XNQE 2LUQA 2LUPB 4LF5E 4B3RE 2L2KB 4DV1E 4B3TE 1HR0E 4JI6E 2N3HA 4M2ZA 2JY9A 2L3JA 1DI2A 3VYXA 4X64E 2B3TB 3C4BA 2UXCE 2B7TA 4K0KE 1RQ0A 2EZ6A 4LFAE 1QU6A 4LF7E 4X66E 1WHNA 2CPNA 1HNXE 1N32E 4WYQB 4NXNE 1J26A 2N3GA 4DV7E 4LF4E 1N33E 4JI7E 1GQEA 4YHHE 2UUBE 2UUCE 3T1YE 4OOGC 4JI4E 2UUAE 3P1XA 2LTSA 4DR2E 3C4TA 2B7VA 2NA2A 2L33A 3T1HE 4LF8E 1YYKA 4LFBE 4DR6E 4NXME 2L3CA 2RSMA 2L2NA 1IBLE 4DR7E 4KHPE 1X48A 1FJGE 4DR1E 4B3SE 3ADLA 2UXDE 2DIXA 1N36E 4DV6E 1HNWE 1T4LB 2UXBE 2VQEE 4DUYE 1STUA 2DMYA 4JI3E 2ZM6E 4LF9E 2HHHE 4X65E 3ADIA 1RC7A 2LJHA 1O0WA 4DR5E 4JI5E 4JYAE 4JI8E 1T4NA 2IHR1 2E5LE 2RTXA 4LF6E 3VYYA 4DV4E 1X49A 2NUGA 3J7Yp 5LMNE 5LMUE 2L2MA 2NUEA 4DR4E 1FKAE 1YZ9A 2JVAA 2KHXA 1UHZA 5IWAE 4OX9E 2UU9E 3LLHA 4JI0E 3HTXA 1N34E 4X8WA 2VQFE 2NUFA 2RS7A 4GKJE 4WFTA 2LTRA 2MDRA 2DB2A 4LFCE 1I94E 3ADJA
chains in the Genus database with same CATH superfamily
2YTNA 2EM6A 5A6AA 4L5NC 4KZSA 2EM5A 1XNRE 2EMXA 5T6JA 5A69A 1PJTA 2EOSA 2ENAA 5CFFE 1HNZE 4DKKA 4NHRA 2Q8UA 2GHFA 3F6HA 4JI2E 4R2AA 4DV3E 1X47A 2EN1A 2LRSA 2YTGA 4AQYE 2EOIA 2FV4B 1UBDC 2WBUA 5IT9C 4LF5E 4DV1E 4JI6E 4Q35B 2CSHA 1JK1A 2N3HA 2EMKA 2V8QB 4WPYA 1DI2A 2LO3A 3C4BA 2EPAA 4K0KE 5KL2A 3FIGA 4LFAE 4BC9A 1NEIA 2V83A 4X66E 4N4RB 3DJWA 1HNXE 5KL4A 1ZAAC 1BBGA 4NXNE 1NCSA 1J26A 2EOXA 4JI7E 3J80C 2EPCA 5KL3A 1WXRA 2F8BA 2V86A 1KJKA 4TUIA 1T39A 4DR2E 3BIDA 4BS9A 5AE3A 1Z1BA 2EL4A 2YTFA 2EPXA 4LF8E 4R8OA 4LFBE 4DR6E 1IBLE 1PJQA 2D9HA 1LLMC 2EPNA 3JU0A 3ADLA 2DIXA 4DV6E 2UXBE 2DMYA 3HQ1A 3HXLA 2NABA 2HHHE 4X65E 4BMJA 2EN2A 2ENHA 2EM2A 2LJHA 2WCC3 1RC7A 3C6KA 4JI5E 1T4NA 4R2RA 2RTXA 4GZNC 1YFHA 5ADZA 2EPMX 1A1KA 2ENCA 4DMIA 2V88A 4F9AB 2RQLA 2JVAA 2M1SA 3EPLA 4HEIA 2DMIA 4RHBB 2NUFA 2MDGA 1IQOA 4F54A 2LTRA 3KZYA 3ADJA 4IJDA 2ODRC 3EPHA 3THOB 2VRDA 4F2JC 2HJJA 1P47A 1ZR9A 1UILA 2EOYA 4WXDA 4IS1C 2LBSB 1TF6A 1XMQE 5AC5A 2ELYA 2JOXA 4DR3E 5AASA 1IBME 2VE7C 3HPZA 1BBOA 2JPAA 4X62E 2V89A 4B3ME 1T4OA 2N8XA 2EMCA 4DUZE 4JI1E 3AV0A 4GEQB 4MLQA 1XMOE 4LU9A 2LJUA 2LUPB 2EN3A 2L2KB 1HR0E 2EM7A 1BB8A 3VYXA 4X64E 2YTPA 3MSWA 1B69A 2B9DA 2UXCE 2B7TA 1RQ0A 3BF2A 3TQMA 2EOZA 2CT1A 1SR9A 2YTDA 1WHNA 2YTOA 1G2DC 2HC5A 3AUZA 4WYQB 2N3GA 4DV7E 5A6JA 4YHHE 2EM0A 2EOEA 3QG5C 1G2FC 3F6GA 4OOGC 2EOHA 2UUAE 5LL6R 2RPCA 3BGHA 2EPRA 2R76A 3C4TA 3M99B 2L33A 2GLIA 4F6MA 1X6HA 4M0VA 2RSMA 2L2NA 1YUIA 3JTZA 4ZYGA 4KHPE 1X48A 1FJGE 2H36X 1EH6A 2UXDE 2EWLA 5FLXC 3EQ1A 2EM9A 2K7IA 1T4LB 2EMAA 2VQEE 4DUYE 1STUA 4R03A 1X6EA 4F9CB 2M9AA 4JI8E 2IHR1 4WSGA 3EPJA 2LE2A 5LLQA 3IWDA 2EMHA 1RMDA 1X49A 2NUGA 3J7AG 2EQ3A 1FKAE 1YZ9A 1UHZA 3THNA 4O43A 4WX9A 3LLHA 2V87A 3MHHC 1N34E 1MEYC 2RS7A 4GKJE 2L92A 2YSPA 2KONA 4LFCE 2BB8A 4L8NA 2EPKX 2EPZA 3BBGA 1YYOA 4JV5E 2RS6A 1YUJA 2EPUA 1PKPA 2LCEA 2JP9A 4KWYA 2EM3A 1PDAA 1A1LA 2F4VE 4Q28A 2R1FA 1J5EE 4DV2E 1WHQA 1DGCA 3ADGA 2GPIA 2L8TA 4DV5E 2RSIA 1JK2A 1IBKE 1QNTA 1GTKA 4R2CA 2ELZA 2EMZA 2JYAA 4ZYEA 4GKKE 2DSYA 2G7HA 2EM8A 4B3TE 2YTEA 5KL6A 1L4SA 1WJPA 4M2ZA 1WRJA 2BBGA 2EPOA 2KOUA 4P7DA 2JOBA 2EMFA 2EMGA 2FGGA 5KL5A 4HTGA 4J8ZA 1EH8A 5A6BA 5AC4A 1QU6A 1PJSA 4LF7E 1F2IG 1N32E 1GQEA 2YRHA 4MLVA 1MGTA 2UUBE 2UUCE 3T1YE 1GZ6A 5IV8B 2LTSA 4ZYHA 1X3CA 2B7VA 2YZTA 2NA2A 1IMUA 2FTXB 2EOJA 3T1HE 3C6MA 3IWCA 2EN7A 1KYQA 2WZOA 2LMZA 2ODRD 4DR1E 2EQ0A 2M7QA 3L00A 1X6FA 1N36E 1HNWE 1A1GA 2EMIA 2EN6A 4F6NA 2EQ1A 5IXMB 2ZM6E 2DGCA 4LF9E 4F9BB 2I9IA 4P78A 4RH8A 3ADIA 1O0WA 2EPLX 3J81C 4JYAE 3LMLA 2E5LE 5A6KA 4LF6E 3RMPA 2MC6A 4R2DA 3VYYA 2HGHA 2YPNA 3K6QA 5LMNE 2NUEA 4DR4E 1AAYA 2K4VA 2DRPA 2MKDA 4X9JA 4OX9E 2UU9E 2LV2A 2WBSA 1AH5A 3H09A 2EMWA 4O24A 1A1JA 1X5WA 1YSAC 1IQSA 4WSPA 2MDRA 2JWOA 2JXPA 1A1IA 2YTQA 1T38A 2CTDA 5KL7A 3EPKA 3OTOE 2YU5A 2MKNA 3KZZA 4M30A 5DNYA 4YY3E 1ZBTA 2YU8A 3VK6A 1EKZA 1TN9A 2EL5A 4DV0E 2E1MA 2A25A 5BR8E 2I13A 1A1FA 2EL6A 2EOQA 2YT4A 2YTJA 2L6MA 2V85A 4ZYDA 3KWRA 1YYWA 1UN6B 1A1HA 2EP3A 2JR1A 1YPNA 2LVHA 2LUQA 4BBYA 1XNQE 2EMLA 4B3RE 4BHCA 2EPPA 2JY9A 2L3JA 4TUGA 2DLQA 3ZOQB 2B3TB 3ECRA 2YRKA 4I8OA 5TSEA 2EZ6A 4LTYA 2M4IA 1SFEA 2CPNA 5AE2A 5F3WA 4M9VC 4LF4E 1N33E 2EMYA 4FK5C 1TF3A 4O4KA 4WXCA 3MHSC 4BCAA 3JAMC 2EORA 4JI4E 3OMLA 3P1XA 5A2QC 2EOOA 2YWQA 2LT7A 2EN4A 4R2QA 2EM4A 1YYKA 2VF1A 4R2PA 4NXME 2L3CA 4O5GA 4NZVA 4DR7E 3DF6A 1ZBQA 1DQ3A 4B3SE 2MC5A 4BHBA 2ADRA 5A6BD 2PRTA 4JI3E 3VHTB 1N3GA 2WBTA 2J7JA 2EOFA 1EH7A 2EN8A 4R2SA 4DR5E 5AE1A 2YTIA 4DV4E 2YRMA 3J7Yp 4R2EA 5LMUE 2EJ4A 2DLKA 2L2MA 2EMBA 2KHXA 5IWAE 2EE8A 2E72A 3HPSA 2EOMA 3IWBA 4JI0E 3HTXA 4X8WA 1ZU1A 2VQFE 3UK3C 4WFTA 2DB2A 1I94E 4BC7A 2YSOA
chains in the Genus database with same CATH topology
2ODRC 4L8NA 1YYOA 3OTOE 1UILA 4L5NC 4JV5E 4KZSA 2LBSB 1XNRE 1XMQE 4M30A 2RS6A 5DNYA 4YY3E 1PKPA 5T6JA 1ZBTA 3VK6A 1EKZA 2F4VE 2JOXA 4Q28A 4DV0E 5CFFE 2E1MA 4DR3E 5AASA 1J5EE 1IBME 5BR8E 2VE7C 4DV2E 1WHQA 4DKKA 1HNZE 3ADGA 2L8TA 3HPZA 4DV5E 1IBKE 2YT4A 4X62E 3F6HA 2L6MA 2V85A 4JI2E 2V89A 4B3ME 1T4OA 4DUZE 4DV3E 4JI1E 1X47A 3AV0A 3KWRA 2LRSA 4GEQB 4AQYE 1XMOE 1YYWA 2FV4B 4LU9A 2JR1A 5IT9C 4GKKE 1XNQE 2LUQA 4BBYA 2LUPB 4LF5E 4B3RE 2DSYA 2G7HA 2L2KB 4DV1E 4B3TE 1HR0E 4JI6E 2N3HA 4M2ZA 2JY9A 2V8QB 2KOUA 2L3JA 4P7DA 4WPYA 1DI2A 4TUGA 3VYXA 4X64E 2JOBA 3MSWA 3ZOQB 2B9DA 2B3TB 3C4BA 2FGGA 2UXCE 2B7TA 4K0KE 1RQ0A 3FIGA 4J8ZA 4I8OA 2EZ6A 4LFAE 4BC9A 1QU6A 2V83A 4LTYA 4LF7E 1SR9A 2M4IA 4X66E 3DJWA 1WHNA 2CPNA 1HNXE 5AE2A 1N32E 3AUZA 4WYQB 5F3WA 4NXNE 2N3GA 4DV7E 4LF4E 1N33E 1J26A 4JI7E 1GQEA 3J80C 4YHHE 2UUBE 1WXRA 2UUCE 2F8BA 2V86A 4BCAA 1GZ6A 3F6GA 4OOGC 3JAMC 3T1YE 4JI4E 2UUAE 3OMLA 3P1XA 2LTSA 4TUIA 5A2QC 5LL6R 4DR2E 3C4TA 2B7VA 2YZTA 4BS9A 2NA2A 5AE3A 2L33A 2FTXB 3T1HE 2VF1A 4R8OA 4LF8E 3IWCA 1YYKA 4DR6E 4LFBE 4M0VA 2L3CA 4NXME 2RSMA 2L2NA 1IBLE 4DR7E 2WZOA 3JTZA 4KHPE 3DF6A 1X48A 2LMZA 1ZBQA 2ODRD 1FJGE 4DR1E 1DQ3A 2H36X 3JU0A 4B3SE 3ADLA 2M7QA 2UXDE 2EWLA 5FLXC 2DIXA 2MC5A 1N36E 4DV6E 1HNWE 1T4LB 2UXBE 2VQEE 4DUYE 1STUA 4LFCE 2DMYA 4JI3E 4R03A 2ZM6E 3HQ1A 3HXLA 4LF9E 4F9BB 4F9CB 2HHHE 4P78A 4X65E 4BMJA 3ADIA 1RC7A 2LJHA 1O0WA 4DR5E 4JI5E 3J81C 4JYAE 3LMLA 1T4NA 2IHR1 4JI8E 5AE1A 2RTXA 2E5LE 4LF6E 3RMPA 2MC6A 2LE2A 5ADZA 3IWDA 3VYYA 4DV4E 1X49A 3K6QA 3J7Yp 2NUGA 4DMIA 5LMNE 5LMUE 3J7AG 2L2MA 2V88A 2NUEA 4DR4E 1FKAE 4F9AB 2K4VA 1YZ9A 2JVAA 2KHXA 1UHZA 2M1SA 5IWAE 4OX9E 3HPSA 3LLHA 3IWBA 2UU9E 4JI0E 3H09A 3HTXA 2V87A 1N34E 4X8WA 2VQFE 2NUFA 2RS7A 4GKJE 4WFTA 4WSPA 4F54A 2L92A 2LTRA 2MDRA 2DB2A 2KONA 2JWOA 1I94E 3ADJA 4BC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYO A;  3OTO E;  1UIL A;  4JV5 E;  2LBS B;  1XNR E;  1XMQ E;  4M30 A;  2RS6 A;  4YY3 E;  1PKP A;  1ZBT A;  1EKZ A;  2F4V E;  4DV0 E;  5CFF E;  4DR3 E;  1J5E E;  1IBM E;  5BR8 E;  4DV2 E;  1WHQ A;  4DKK A;  1HNZ E;  3ADG A;  4DV5 E;  1IBK E;  2YT4 A;  4X62 E;  4JI2 E;  4B3M E;  1T4O A;  4DUZ E;  4DV3 E;  4JI1 E;  1X47 A;  2LRS A;  4AQY E;  1XMO E;  1YYW A;  4GKK E;  1XNQ E;  2LUQ A;  2LUP B;  4LF5 E;  4B3R E;  2L2K B;  4DV1 E;  4B3T E;  1HR0 E;  4JI6 E;  2N3H A;  4M2Z A;  2JY9 A;  2L3J A;  1DI2 A;  3VYX A;  4X64 E;  2B3T B;  3C4B A;  2UXC E;  2B7T A;  4K0K E;  1RQ0 A;  2EZ6 A;  4LFA E;  1QU6 A;  4LF7 E;  4X66 E;  1WHN A;  2CPN A;  1HNX E;  1N32 E;  4WYQ B;  4NXN E;  1J26 A;  2N3G A;  4DV7 E;  4LF4 E;  1N33 E;  4JI7 E;  1GQE A;  4YHH E;  2UUB E;  2UUC E;  3T1Y E;  4OOG C;  4JI4 E;  2UUA E;  3P1X A;  2LTS A;  4DR2 E;  3C4T A;  2B7V A;  2NA2 A;  2L33 A;  3T1H E;  4LF8 E;  1YYK A;  4LFB E;  4DR6 E;  4NXM E;  2L3C A;  2RSM A;  2L2N A;  1IBL E;  4DR7 E;  4KHP E;  1X48 A;  1FJG E;  4DR1 E;  4B3S E;  3ADL A;  2UXD E;  2DIX A;  1N36 E;  4DV6 E;  1HNW E;  1T4L B;  2UXB E;  2VQE E;  4DUY E;  1STU A;  2DMY A;  4JI3 E;  2ZM6 E;  4LF9 E;  2HHH E;  4X65 E;  3ADI A;  1RC7 A;  2LJH A;  1O0W A;  4DR5 E;  4JI5 E;  4JYA E;  4JI8 E;  1T4N A;  2IHR 1;  2E5L E;  2RTX A;  4LF6 E;  3VYY A;  4DV4 E;  1X49 A;  2NUG A;  3J7Y p;  5LMN E;  5LMU E;  2L2M A;  2NUE A;  4DR4 E;  1FKA E;  1YZ9 A;  2JVA A;  2KHX A;  1UHZ A;  5IWA E;  4OX9 E;  2UU9 E;  3LLH A;  4JI0 E;  3HTX A;  1N34 E;  4X8W A;  2VQF E;  2NUF A;  2RS7 A;  4GKJ E;  4WFT A;  2LTR A;  2MDR A;  2DB2 A;  4LFC E;  1I94 E;  3ADJ A; 
#chains in the Genus database with same CATH topology
 2YTN A;  2EM6 A;  5A6A A;  4L5N C;  4KZS A;  2EM5 A;  1XNR E;  2EMX A;  5T6J A;  5A69 A;  1PJT A;  2EOS A;  2ENA A;  5CFF E;  1HNZ E;  4DKK A;  4NHR A;  2Q8U A;  2GHF A;  3F6H A;  4JI2 E;  4R2A A;  4DV3 E;  1X47 A;  2EN1 A;  2LRS A;  2YTG A;  4AQY E;  2EOI A;  2FV4 B;  1UBD C;  2WBU A;  5IT9 C;  4LF5 E;  4DV1 E;  4JI6 E;  4Q35 B;  2CSH A;  1JK1 A;  2N3H A;  2EMK A;  2V8Q B;  4WPY A;  1DI2 A;  2LO3 A;  3C4B A;  2EPA A;  4K0K E;  5KL2 A;  3FIG A;  4LFA E;  4BC9 A;  1NEI A;  2V83 A;  4X66 E;  4N4R B;  3DJW A;  1HNX E;  5KL4 A;  1ZAA C;  1BBG A;  4NXN E;  1NCS A;  1J26 A;  2EOX A;  4JI7 E;  3J80 C;  2EPC A;  5KL3 A;  1WXR A;  2F8B A;  2V86 A;  1KJK A;  4TUI A;  1T39 A;  4DR2 E;  3BID A;  4BS9 A;  5AE3 A;  1Z1B A;  2EL4 A;  2YTF A;  2EPX A;  4LF8 E;  4R8O A;  4LFB E;  4DR6 E;  1IBL E;  1PJQ A;  2D9H A;  1LLM C;  2EPN A;  3JU0 A;  3ADL A;  2DIX A;  4DV6 E;  2UXB E;  2DMY A;  3HQ1 A;  3HXL A;  2NAB A;  2HHH E;  4X65 E;  4BMJ A;  2EN2 A;  2ENH A;  2EM2 A;  2LJH A;  2WCC 3;  1RC7 A;  3C6K A;  4JI5 E;  1T4N A;  4R2R A;  2RTX A;  4GZN C;  1YFH A;  5ADZ A;  2EPM X;  1A1K A;  2ENC A;  4DMI A;  2V88 A;  4F9A B;  2RQL A;  2JVA A;  2M1S A;  3EPL A;  4HEI A;  2DMI A;  4RHB B;  2NUF A;  2MDG A;  1IQO A;  4F54 A;  2LTR A;  3KZY A;  3ADJ A;  4IJD A;  2ODR C;  3EPH A;  3THO B;  2VRD A;  4F2J C;  2HJJ A;  1P47 A;  1ZR9 A;  1UIL A;  2EOY A;  4WXD A;  4IS1 C;  2LBS B;  1TF6 A;  1XMQ E;  5AC5 A;  2ELY A;  2JOX A;  4DR3 E;  5AAS A;  1IBM E;  2VE7 C;  3HPZ A;  1BBO A;  2JPA A;  4X62 E;  2V89 A;  4B3M E;  1T4O A;  2N8X A;  2EMC A;  4DUZ E;  4JI1 E;  3AV0 A;  4GEQ B;  4MLQ A;  1XMO E;  4LU9 A;  2LJU A;  2LUP B;  2EN3 A;  2L2K B;  1HR0 E;  2EM7 A;  1BB8 A;  3VYX A;  4X64 E;  2YTP A;  3MSW A;  1B69 A;  2B9D A;  2UXC E;  2B7T A;  1RQ0 A;  3BF2 A;  3TQM A;  2EOZ A;  2CT1 A;  1SR9 A;  2YTD A;  1WHN A;  2YTO A;  1G2D C;  2HC5 A;  3AUZ A;  4WYQ B;  2N3G A;  4DV7 E;  5A6J A;  4YHH E;  2EM0 A;  2EOE A;  3QG5 C;  1G2F C;  3F6G A;  4OOG C;  2EOH A;  2UUA E;  5LL6 R;  2RPC A;  3BGH A;  2EPR A;  2R76 A;  3C4T A;  3M99 B;  2L33 A;  2GLI A;  4F6M A;  1X6H A;  4M0V A;  2RSM A;  2L2N A;  1YUI A;  3JTZ A;  4ZYG A;  4KHP E;  1X48 A;  1FJG E;  2H36 X;  1EH6 A;  2UXD E;  2EWL A;  5FLX C;  3EQ1 A;  2EM9 A;  2K7I A;  1T4L B;  2EMA A;  2VQE E;  4DUY E;  1STU A;  4R03 A;  1X6E A;  4F9C B;  2M9A A;  4JI8 E;  2IHR 1;  4WSG A;  3EPJ A;  2LE2 A;  5LLQ A;  3IWD A;  2EMH A;  1RMD A;  1X49 A;  2NUG A;  3J7A G;  2EQ3 A;  1FKA E;  1YZ9 A;  1UHZ A;  3THN A;  4O43 A;  4WX9 A;  3LLH A;  2V87 A;  3MHH C;  1N34 E;  1MEY C;  2RS7 A;  4GKJ E;  2L92 A;  2YSP A;  2KON A;  4LFC E;  2BB8 A;  4L8N A;  2EPK X;  2EPZ A;  3BBG A;  1YYO A;  4JV5 E;  2RS6 A;  1YUJ A;  2EPU A;  1PKP A;  2LCE A;  2JP9 A;  4KWY A;  2EM3 A;  1PDA A;  1A1L A;  2F4V E;  4Q28 A;  2R1F A;  1J5E E;  4DV2 E;  1WHQ A;  1DGC A;  3ADG A;  2GPI A;  2L8T A;  4DV5 E;  2RSI A;  1JK2 A;  1IBK E;  1QNT A;  1GTK A;  4R2C A;  2ELZ A;  2EMZ A;  2JYA A;  4ZYE A;  4GKK E;  2DSY A;  2G7H A;  2EM8 A;  4B3T E;  2YTE A;  5KL6 A;  1L4S A;  1WJP A;  4M2Z A;  1WRJ A;  2BBG A;  2EPO A;  2KOU A;  4P7D A;  2JOB A;  2EMF A;  2EMG A;  2FGG A;  5KL5 A;  4HTG A;  4J8Z A;  1EH8 A;  5A6B A;  5AC4 A;  1QU6 A;  1PJS A;  4LF7 E;  1F2I G;  1N32 E;  1GQE A;  2YRH A;  4MLV A;  1MGT A;  2UUB E;  2UUC E;  3T1Y E;  1GZ6 A;  5IV8 B;  2LTS A;  4ZYH A;  1X3C A;  2B7V A;  2YZT A;  2NA2 A;  1IMU A;  2FTX B;  2EOJ A;  3T1H E;  3C6M A;  3IWC A;  2EN7 A;  1KYQ A;  2WZO A;  2LMZ A;  2ODR D;  4DR1 E;  2EQ0 A;  2M7Q A;  3L00 A;  1X6F A;  1N36 E;  1HNW E;  1A1G A;  2EMI A;  2EN6 A;  4F6N A;  2EQ1 A;  5IXM B;  2ZM6 E;  2DGC A;  4LF9 E;  4F9B B;  2I9I A;  4P78 A;  4RH8 A;  3ADI A;  1O0W A;  2EPL X;  3J81 C;  4JYA E;  3LML A;  2E5L E;  5A6K A;  4LF6 E;  3RMP A;  2MC6 A;  4R2D A;  3VYY A;  2HGH A;  2YPN A;  3K6Q A;  5LMN E;  2NUE A;  4DR4 E;  1AAY A;  2K4V A;  2DRP A;  2MKD A;  4X9J A;  4OX9 E;  2UU9 E;  2LV2 A;  2WBS A;  1AH5 A;  3H09 A;  2EMW A;  4O24 A;  1A1J A;  1X5W A;  1YSA C;  1IQS A;  4WSP A;  2MDR A;  2JWO A;  2JXP A;  1A1I A;  2YTQ A;  1T38 A;  2CTD A;  5KL7 A;  3EPK A;  3OTO E;  2YU5 A;  2MKN A;  3KZZ A;  4M30 A;  5DNY A;  4YY3 E;  1ZBT A;  2YU8 A;  3VK6 A;  1EKZ A;  1TN9 A;  2EL5 A;  4DV0 E;  2E1M A;  2A25 A;  5BR8 E;  2I13 A;  1A1F A;  2EL6 A;  2EOQ A;  2YT4 A;  2YTJ A;  2L6M A;  2V85 A;  4ZYD A;  3KWR A;  1YYW A;  1UN6 B;  1A1H A;  2EP3 A;  2JR1 A;  1YPN A;  2LVH A;  2LUQ A;  4BBY A;  1XNQ E;  2EML A;  4B3R E;  4BHC A;  2EPP A;  2JY9 A;  2L3J A;  4TUG A;  2DLQ A;  3ZOQ B;  2B3T B;  3ECR A;  2YRK A;  4I8O A;  5TSE A;  2EZ6 A;  4LTY A;  2M4I A;  1SFE A;  2CPN A;  5AE2 A;  5F3W A;  4M9V C;  4LF4 E;  1N33 E;  2EMY A;  4FK5 C;  1TF3 A;  4O4K A;  4WXC A;  3MHS C;  4BCA A;  3JAM C;  2EOR A;  4JI4 E;  3OML A;  3P1X A;  5A2Q C;  2EOO A;  2YWQ A;  2LT7 A;  2EN4 A;  4R2Q A;  2EM4 A;  1YYK A;  2VF1 A;  4R2P A;  4NXM E;  2L3C A;  4O5G A;  4NZV A;  4DR7 E;  3DF6 A;  1ZBQ A;  1DQ3 A;  4B3S E;  2MC5 A;  4BHB A;  2ADR A;  5A6B D;  2PRT A;  4JI3 E;  3VHT B;  1N3G A;  2WBT A;  2J7J A;  2EOF A;  1EH7 A;  2EN8 A;  4R2S A;  4DR5 E;  5AE1 A;  2YTI A;  4DV4 E;  2YRM A;  3J7Y p;  4R2E A;  5LMU E;  2EJ4 A;  2DLK A;  2L2M A;  2EMB A;  2KHX A;  5IWA E;  2EE8 A;  2E72 A;  3HPS A;  2EOM A;  3IWB A;  4JI0 E;  3HTX A;  4X8W A;  1ZU1 A;  2VQF E;  3UK3 C;  4WFT A;  2DB2 A;  1I94 E;  4BC7 A;  2YSO A; 
#chains in the Genus database with same CATH homology
 2ODR C;  4L8N A;  1YYO A;  3OTO E;  1UIL A;  4L5N C;  4JV5 E;  4KZS A;  2LBS B;  1XNR E;  1XMQ E;  4M30 A;  2RS6 A;  5DNY A;  4YY3 E;  1PKP A;  5T6J A;  1ZBT A;  3VK6 A;  1EKZ A;  2F4V E;  2JOX A;  4Q28 A;  4DV0 E;  5CFF E;  2E1M A;  4DR3 E;  5AAS A;  1J5E E;  1IBM E;  5BR8 E;  2VE7 C;  4DV2 E;  1WHQ A;  4DKK A;  1HNZ E;  3ADG A;  2L8T A;  3HPZ A;  4DV5 E;  1IBK E;  2YT4 A;  4X62 E;  3F6H A;  2L6M A;  2V85 A;  4JI2 E;  2V89 A;  4B3M E;  1T4O A;  4DUZ E;  4DV3 E;  4JI1 E;  1X47 A;  3AV0 A;  3KWR A;  2LRS A;  4GEQ B;  4AQY E;  1XMO E;  1YYW A;  2FV4 B;  4LU9 A;  2JR1 A;  5IT9 C;  4GKK E;  1XNQ E;  2LUQ A;  4BBY A;  2LUP B;  4LF5 E;  4B3R E;  2DSY A;  2G7H A;  2L2K B;  4DV1 E;  4B3T E;  1HR0 E;  4JI6 E;  2N3H A;  4M2Z A;  2JY9 A;  2V8Q B;  2KOU A;  2L3J A;  4P7D A;  4WPY A;  1DI2 A;  4TUG A;  3VYX A;  4X64 E;  2JOB A;  3MSW A;  3ZOQ B;  2B9D A;  2B3T B;  3C4B A;  2FGG A;  2UXC E;  2B7T A;  4K0K E;  1RQ0 A;  3FIG A;  4J8Z A;  4I8O A;  2EZ6 A;  4LFA E;  4BC9 A;  1QU6 A;  2V83 A;  4LTY A;  4LF7 E;  1SR9 A;  2M4I A;  4X66 E;  3DJW A;  1WHN A;  2CPN A;  1HNX E;  5AE2 A;  1N32 E;  3AUZ A;  4WYQ B;  5F3W A;  4NXN E;  2N3G A;  4DV7 E;  4LF4 E;  1N33 E;  1J26 A;  4JI7 E;  1GQE A;  3J80 C;  4YHH E;  2UUB E;  1WXR A;  2UUC E;  2F8B A;  2V86 A;  4BCA A;  1GZ6 A;  3F6G A;  4OOG C;  3JAM C;  3T1Y E;  4JI4 E;  2UUA E;  3OML A;  3P1X A;  2LTS A;  4TUI A;  5A2Q C;  5LL6 R;  4DR2 E;  3C4T A;  2B7V A;  2YZT A;  4BS9 A;  2NA2 A;  5AE3 A;  2L33 A;  2FTX B;  3T1H E;  2VF1 A;  4R8O A;  4LF8 E;  3IWC A;  1YYK A;  4DR6 E;  4LFB E;  4M0V A;  2L3C A;  4NXM E;  2RSM A;  2L2N A;  1IBL E;  4DR7 E;  2WZO A;  3JTZ A;  4KHP E;  3DF6 A;  1X48 A;  2LMZ A;  1ZBQ A;  2ODR D;  1FJG E;  4DR1 E;  1DQ3 A;  2H36 X;  3JU0 A;  4B3S E;  3ADL A;  2M7Q A;  2UXD E;  2EWL A;  5FLX C;  2DIX A;  2MC5 A;  1N36 E;  4DV6 E;  1HNW E;  1T4L B;  2UXB E;  2VQE E;  4DUY E;  1STU A;  4LFC E;  2DMY A;  4JI3 E;  4R03 A;  2ZM6 E;  3HQ1 A;  3HXL A;  4LF9 E;  4F9B B;  4F9C B;  2HHH E;  4P78 A;  4X65 E;  4BMJ A;  3ADI A;  1RC7 A;  2LJH A;  1O0W A;  4DR5 E;  4JI5 E;  3J81 C;  4JYA E;  3LML A;  1T4N A;  2IHR 1;  4JI8 E;  5AE1 A;  2RTX A;  2E5L E;  4LF6 E;  3RMP A;  2MC6 A;  2LE2 A;  5ADZ A;  3IWD A;  3VYY A;  4DV4 E;  1X49 A;  3K6Q A;  3J7Y p;  2NUG A;  4DMI A;  5LMN E;  5LMU E;  3J7A G;  2L2M A;  2V88 A;  2NUE A;  4DR4 E;  1FKA E;  4F9A B;  2K4V A;  1YZ9 A;  2JVA A;  2KHX A;  1UHZ A;  2M1S A;  5IWA E;  4OX9 E;  3HPS A;  3LLH A;  3IWB A;  2UU9 E;  4JI0 E;  3H09 A;  3HTX A;  2V87 A;  1N34 E;  4X8W A;  2VQF E;  2NUF A;  2RS7 A;  4GKJ E;  4WFT A;  4WSP A;  4F54 A;  2L92 A;  2LTR A;  2MDR A;  2DB2 A;  2KON A;  2JWO A;  1I94 E;  3ADJ A;  4BC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...