2EE8A

Solution structure of three zf-c2h2 domains from mouse protein odd-skipped-related 2 splicing isoform 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
GSSGSSGGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQTSSPTAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of three zf-C2H2 domains from mouse protein odd-skipped-related 2 splicing isoform 2
rcsb
source organism Mus musculus
molecule tags Gene regulation
molecule keywords Protein odd-skipped-related 2
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ee8A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ee8A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ee8A01
2DLKA 4IJDA 4IS1C 1YSAC 1G2FC 2WBUA 1BB8A 5KL3A 2ENAA 2EM9A 4F2JC 5KL7A 2J7JA 5KL2A 1TF3A 2YRKA 1MEYC 4M9VC 2EMXA 2YTFA 1JK2A 2M9AA 4F6NA 2EMYA 2EMZA 2JP9A 4R2AA 2EMCA 2EOFA 2MDGA 2EN2A 1WJPA 2EN6A 2EM3A 2NABA 2R1FA 3MHHC 2EMAA 2EPCA 2EPAA 2EOYA 2JPAA 2D9HA 2EN7A 1ZU1A 2WCC3 2EMGA 4F6MA 1G2DC 4R2EA 2YRMA 2EOQA 1P47A 1A1HA 2ADRA 2EMKA 1X3CA 2EL6A 1X6FA 2EOHA 2RPCA 2YTEA 2CT1A 2ENHA 2WBSA 2EMFA 2EOZA 4R2SA 2CSHA 2EQ3A 2LVHA 3VHTB 3MHSC 2YTDA 4R2CA 2EM8A 1BBOA 1YUIA 2EPPA 2EOEA 2EL5A 1LLMC 4FK5C 1Z1BA 2EPZA 2EM5A 1AAYA 3UK3C 2YTPA 2EOJA 2BB8A 2EOMA 2EPUA 2VRDA 2EMHA 2YTJA 2EOXA 1A1KA 3EPLA 2YTIA 2EJ4A 2EMBA 2EORA 2EOSA 2EPXA 2EMWA 1YUJA 2EN1A 2DMIA 2YRHA 4R2DA 1TN9A 1X6HA 2LCEA 2LO3A 2LV2A 4R2RA 3EPHA 1KJKA 1TF6A 2EM4A 4R2QA 2GHFA 2DLQA 2YTNA 4WSGA 1A1GA 1A1FA 2EOOA 2E72A 2EM6A 2RSIA 1B69A 2YU5A 2EN3A 3EPKA 2EM0A 4R2PA 1NCSA 2YTGA 4X9JA 2YSPA 2EOIA 2LT7A 1A1LA 2EN4A 2EE8A 2EMIA 1X6EA 1X5WA 2EQ1A 1UBDC 5KL5A 1UN6B 3M99B 2WBTA 2CTDA 2EPRA 2MKNA 1ZR9A 3EPJA 2EL4A 2ELYA 2YTOA 1ZAAC 2YSOA 5KL6A 2EP3A 1JK1A 2EM2A 2I13A 1DGCA 1A1IA 2EN8A 2EM7A 2YU8A 2ELZA 2HGHA 1RMDA 2YTQA 2PRTA 5KL4A 2GLIA 1A1JA 2EMLA 2DRPA 2DGCA 2EQ0A 2ENCA 1F2IG 4GZNC 2A25A 2MKDA
chains in the Genus database with same CATH superfamily
1YSAC 2WBUA 1BB8A 5KL3A 2ENAA 3IWDA 1PJTA 2RS6A 2NA2A 1PJSA 1UILA 5KL2A 1TF3A 4R03A 4BBYA 1MEYC 4X65E 2R76A 4N4RB 4OOGC 5IWAE 1FJGE 1AH5A 2JP9A 3DJWA 4X8WA 2MDGA 4JI0E 1EKZA 4BMJA 4HTGA 2MC5A 4JYAE 2EMAA 2NUFA 2EPAA 2D9HA 2GPIA 2B9DA 4I8OA 4B3RE 4MLVA 5AE1A 1P47A 2EOQA 4JI4E 2EMKA 2V89A 2YTEA 2KOUA 2L92A 2F8BA 1EH8A 3VYYA 4DV1E 4R2SA 2CSHA 3MHSC 2YTDA 2EM8A 3LLHA 1N3GA 4F54A 1AAYA 2K7IA 4JV5E 2BB8A 1QNTA 5LMUE 3P1XA 3C6MA 2L2MA 2EN1A 2DMIA 2M4IA 4R2RA 2LE2A 3EPHA 1KJKA 1SR9A 1YYWA 3J80C 4M2ZA 1ZBQA 2K4VA 2GHFA 4WXDA 1J26A 2DLQA 2YTNA 4DR5E 2EM6A 4DV3E 3OTOE 2EM0A 4X9JA 5T6JA 3IWBA 2YSPA 4WPYA 1A1LA 2LT7A 2EN4A 2EE8A 3DF6A 4LF4E 5KL5A 1T4OA 5A6BD 3EPJA 2EL4A 2YTOA 4Q28A 4DV5E 3HPSA 1JK1A 5LMNE 2I13A 3BBGA 1QU6A 5AASA 4MLQA 1UHZA 2EN8A 4L5NC 2VQEE 2UUBE 3FIGA 1HNZE 2G7HA 2F4VE 2ELZA 1MGTA 3J7AG 4BC9A 4X62E 4BHCA 2PRTA 2VE7C 1WHNA 2GLIA 1GTKA 4K0KE 2DGCA 1XMOE 2EQ0A 2ENCA 3C6KA 1T4NA 4WFTA 2B3TB 2V87A 2UXBE 1IQSA 2LMZA 3BGHA 4LF5E 3BF2A 2UUAE 2YRKA 2MC6A 3KWRA 1T4LB 4YY3E 2UXCE 4F6NA 4DV2E 2EOFA 2EM3A 2R1FA 4BC7A 1EH6A 3MHHC 1N36E 2EPCA 4NZVA 4LFCE 4M30A 2HJJA 3F6GA 2LUPB 3JU0A 4F9CB 4LFBE 2EN7A 2LBSB 1SFEA 5F3WA 4NXNE 4LTYA 5AC4A 2EMGA 1G2DC 4R2EA 4JI2E 2RPCA 4TUIA 3BIDA 1NEIA 4RH8A 1GZ6A 4BHBA 2EOZA 1YZ9A 3KZYA 5AE2A 3VHTB 4LFAE 4NHRA 4WYQB 4R2CA 4O4KA 4JI5E 1YFHA 2EM5A 2JR1A 3ADIA 2EPOA 5BR8E 2EMHA 1IBLE 2EOXA 2I9IA 3EPLA 2N8XA 2EOSA 2EPXA 1YUJA 2LJHA 2LCEA 2JWOA 4BS9A 2HHHE 2EOOA 2M7QA 5A2QC 2YU5A 1ZBTA 4JI1E 1NCSA 2YTGA 2V8QB 4KHPE 3KZZA 2HC5A 3L00A 3RMPA 1RC7A 1STUA 2WBTA 2EPRA 3T1YE 2ELYA 1ZAAC 2LTRA 2M1SA 3ZOQB 4ZYHA 2YU8A 4JI3E 3C4TA 2HGHA 4DR4E 2UU9E 4GEQB 4DR6E 2UXDE 4DMIA 2FV4B 4DUYE 5IT9C 4F9AB 1F2IG 4GZNC 2MKDA 2DLKA 4IS1C 2YZTA 4DKKA 2RS7A 4HEIA 5AE3A 4DR2E 1HR0E 3QG5C 3LMLA 4F2JC 5KL7A 2J7JA 4F9BB 2DIXA 2H36X 4M9VC 3EQ1A 2M9AA 2EZ6A 2B7TA 2EMZA 2JY9A 4R2AA 1RQ0A 2EMCA 2EN6A 2E5LE 2DB2A 5IV8B 4WSPA 5LLQA 2JPAA 2EPKX 3IWCA 2N3GA 2WZOA 3THNA 3JTZA 5A69A 4O5GA 2L3CA 1ZU1A 3ADGA 4AQYE 2EPMX 2UUCE 4O43A 1A1HA 3AUZA 2ADRA 5CFFE 4O24A 4DV7E 2E1MA 2ENHA 1DI2A 3HPZA 3HTXA 2IHR1 1O0WA 4DR1E 2LVHA 1BBOA 1YUIA 2VF1A 4LF7E 3HQ1A 4FK5C 5A6BA 1BBGA 2FTXB 2YTPA 2EOMA 2VRDA 3OMLA 1IBKE 2YTJA 4X66E 5DNYA 2EJ4A 2EMBA 4J8ZA 1WRJA 1WHQA 2EMWA 4P7DA 3THOB 2YRHA 4Q35B 4R2DA 1TN9A 2LV2A 2LO3A 2JOXA 1XNRE 2YT4A 2DSYA 4LU9A 2EM4A 4ZYGA 4R2QA 5FLXC 1A1FA 4WX9A 1FKAE 2NUEA 5LL6R 3K6QA 2RSIA 3VYXA 4OX9E 3EPKA 2ODRC 2JOBA 2RTXA 4R2PA 1N34E 2EWLA 1YYOA 1X49A 3AV0A 2ZM6E 3JAMC 3MSWA 3F6HA 1EH7A 4DR3E 2L8TA 1X6EA 1X5WA 1N33E 2EQ1A 1UBDC 1UN6B 3M99B 1X48A 1PJQA 4ZYDA 2RSMA 2ODRD 1DGCA 3J81C 2L2NA 2L6MA 1HNWE 1RMDA 5KL4A 4JI7E 2LRSA 4WXCA 2N3HA 3ADLA 4P78A 2A25A 5AC5A 2CPNA 5ADZA 4IJDA 4DUZE 1XNQE 1IQOA 1G2FC 2EPNA 2JVAA 3TQMA 3HXLA 5IXMB 2EM9A 2YWQA 2VQFE 2RQLA 1T39A 2EMXA 2BBGA 2YTFA 1JK2A 2EMYA 4YHHE 2LUQA 1I94E 1J5EE 2EN2A 1WJPA 2NABA 3J7Yp 1WXRA 3H09A 4X64E 2EOYA 2L33A 3VK6A 4B3SE 2WCC3 4BCAA 4DV0E 4F6MA 2YRMA 2LTSA 2EPLX 1X3CA 4NXME 2EL6A 1X6FA 2EOHA 2WBSA 4LF8E 2CT1A 1DQ3A 2EMFA 2L2KB 1IBME 2EQ3A 2FGGA 2Q8UA 2EPPA 2EOEA 2EL5A 1LLMC 1Z1BA 2EPZA 3UK3C 1X47A 2MDRA 2EOJA 4LF6E 1N32E 2DMYA 2EPUA 2V88A 1L4SA 4R8OA 1A1KA 1GQEA 5A6JA 2YTIA 2EORA 1XMQE 1X6HA 1TF6A 5A6AA 1IMUA 4WSGA 2V86A 1A1GA 3C4BA 4DR7E 4M0VA 2NUGA 2E72A 4RHBB 4DV6E 1B69A 2EN3A 4GKKE 1PKPA 2LJUA 4L8NA 3T1HE 2KHXA 2EOIA 4ZYEA 4LF9E 2JXPA 4DV4E 2EMIA 1HNXE 2V83A 2JYAA 2CTDA 2MKNA 1ZR9A 2YSOA 5KL6A 2EP3A 2EM2A 4TUGA 1T38A 2L3JA 4B3TE 4KWYA 4KZSA 1A1IA 2EM7A 5A6KA 3ADJA 4JI6E 3ECRA 1YYKA 2YTQA 4JI8E 4GKJE 2KONA 2YPNA 1A1JA 2EMLA 2DRPA 2V85A 1KYQA 4B3ME 1PDAA 1YPNA 2B7VA 5TSEA
chains in the Genus database with same CATH topology
2DLKA 4IJDA 4IS1C 1YSAC 1G2FC 2WBUA 1BB8A 5KL3A 2ENAA 2EM9A 4F2JC 5KL7A 2J7JA 5KL2A 1TF3A 2YRKA 1MEYC 4M9VC 2EMXA 2YTFA 1JK2A 2M9AA 4F6NA 2EMYA 2EMZA 2JP9A 4R2AA 2EMCA 2EOFA 2MDGA 2EN2A 1WJPA 2EN6A 2EM3A 2NABA 2R1FA 3MHHC 2EMAA 2EPCA 2EPAA 2EOYA 2JPAA 2D9HA 2EN7A 1ZU1A 2WCC3 2EMGA 4F6MA 1G2DC 4R2EA 2YRMA 2EOQA 1P47A 1A1HA 2ADRA 2EMKA 1X3CA 2EL6A 1X6FA 2EOHA 2RPCA 2YTEA 2CT1A 2ENHA 2WBSA 2EMFA 2EOZA 4R2SA 2CSHA 2EQ3A 2LVHA 3VHTB 3MHSC 2YTDA 4R2CA 2EM8A 1BBOA 1YUIA 2EPPA 2EOEA 2EL5A 1LLMC 4FK5C 1Z1BA 2EPZA 2EM5A 1AAYA 3UK3C 2YTPA 2EOJA 2BB8A 2EOMA 2EPUA 2VRDA 2EMHA 2YTJA 2EOXA 1A1KA 3EPLA 2YTIA 2EJ4A 2EMBA 2EORA 2EOSA 2EPXA 2EMWA 1YUJA 2EN1A 2DMIA 2YRHA 4R2DA 1TN9A 1X6HA 2LCEA 2LO3A 2LV2A 4R2RA 3EPHA 1KJKA 1TF6A 2EM4A 4R2QA 2GHFA 2DLQA 2YTNA 4WSGA 1A1GA 1A1FA 2EOOA 2E72A 2EM6A 2RSIA 1B69A 2YU5A 2EN3A 3EPKA 2EM0A 4R2PA 1NCSA 2YTGA 4X9JA 2YSPA 2EOIA 2LT7A 1A1LA 2EN4A 2EE8A 2EMIA 1X6EA 1X5WA 2EQ1A 1UBDC 5KL5A 1UN6B 3M99B 2WBTA 2CTDA 2EPRA 2MKNA 1ZR9A 3EPJA 2EL4A 2ELYA 2YTOA 1ZAAC 2YSOA 5KL6A 2EP3A 1JK1A 2EM2A 2I13A 1DGCA 1A1IA 2EN8A 2EM7A 2YU8A 2ELZA 2HGHA 1RMDA 2YTQA 2PRTA 5KL4A 2GLIA 1A1JA 2EMLA 2DRPA 2DGCA 2EQ0A 2ENCA 1F2IG 4GZNC 2A25A 2MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLK A;  4IJD A;  4IS1 C;  1YSA C;  1G2F C;  2WBU A;  1BB8 A;  5KL3 A;  2ENA A;  2EM9 A;  4F2J C;  5KL7 A;  2J7J A;  5KL2 A;  1TF3 A;  2YRK A;  1MEY C;  4M9V C;  2EMX A;  2YTF A;  1JK2 A;  2M9A A;  4F6N A;  2EMY A;  2EMZ A;  2JP9 A;  4R2A A;  2EMC A;  2EOF A;  2MDG A;  2EN2 A;  1WJP A;  2EN6 A;  2EM3 A;  2NAB A;  2R1F A;  3MHH C;  2EMA A;  2EPC A;  2EPA A;  2EOY A;  2JPA A;  2D9H A;  2EN7 A;  1ZU1 A;  2WCC 3;  2EMG A;  4F6M A;  1G2D C;  4R2E A;  2YRM A;  2EOQ A;  1P47 A;  1A1H A;  2ADR A;  2EMK A;  1X3C A;  2EL6 A;  1X6F A;  2EOH A;  2RPC A;  2YTE A;  2CT1 A;  2ENH A;  2WBS A;  2EMF A;  2EOZ A;  4R2S A;  2CSH A;  2EQ3 A;  2LVH A;  3VHT B;  3MHS C;  2YTD A;  4R2C A;  2EM8 A;  1BBO A;  1YUI A;  2EPP A;  2EOE A;  2EL5 A;  1LLM C;  4FK5 C;  1Z1B A;  2EPZ A;  2EM5 A;  1AAY A;  3UK3 C;  2YTP A;  2EOJ A;  2BB8 A;  2EOM A;  2EPU A;  2VRD A;  2EMH A;  2YTJ A;  2EOX A;  1A1K A;  3EPL A;  2YTI A;  2EJ4 A;  2EMB A;  2EOR A;  2EOS A;  2EPX A;  2EMW A;  1YUJ A;  2EN1 A;  2DMI A;  2YRH A;  4R2D A;  1TN9 A;  1X6H A;  2LCE A;  2LO3 A;  2LV2 A;  4R2R A;  3EPH A;  1KJK A;  1TF6 A;  2EM4 A;  4R2Q A;  2GHF A;  2DLQ A;  2YTN A;  4WSG A;  1A1G A;  1A1F A;  2EOO A;  2E72 A;  2EM6 A;  2RSI A;  1B69 A;  2YU5 A;  2EN3 A;  3EPK A;  2EM0 A;  4R2P A;  1NCS A;  2YTG A;  4X9J A;  2YSP A;  2EOI A;  2LT7 A;  1A1L A;  2EN4 A;  2EE8 A;  2EMI A;  1X6E A;  1X5W A;  2EQ1 A;  1UBD C;  5KL5 A;  1UN6 B;  3M99 B;  2WBT A;  2CTD A;  2EPR A;  2MKN A;  1ZR9 A;  3EPJ A;  2EL4 A;  2ELY A;  2YTO A;  1ZAA C;  2YSO A;  5KL6 A;  2EP3 A;  1JK1 A;  2EM2 A;  2I13 A;  1DGC A;  1A1I A;  2EN8 A;  2EM7 A;  2YU8 A;  2ELZ A;  2HGH A;  1RMD A;  2YTQ A;  2PRT A;  5KL4 A;  2GLI A;  1A1J A;  2EML A;  2DRP A;  2DGC A;  2EQ0 A;  2ENC A;  1F2I G;  4GZN C;  2A25 A;  2MKD A; 
#chains in the Genus database with same CATH topology
 1YSA C;  2WBU A;  1BB8 A;  5KL3 A;  2ENA A;  3IWD A;  1PJT A;  2RS6 A;  2NA2 A;  1PJS A;  1UIL A;  5KL2 A;  1TF3 A;  4R03 A;  4BBY A;  1MEY C;  4X65 E;  2R76 A;  4N4R B;  4OOG C;  5IWA E;  1FJG E;  1AH5 A;  2JP9 A;  3DJW A;  4X8W A;  2MDG A;  4JI0 E;  1EKZ A;  4BMJ A;  4HTG A;  2MC5 A;  4JYA E;  2EMA A;  2NUF A;  2EPA A;  2D9H A;  2GPI A;  2B9D A;  4I8O A;  4B3R E;  4MLV A;  5AE1 A;  1P47 A;  2EOQ A;  4JI4 E;  2EMK A;  2V89 A;  2YTE A;  2KOU A;  2L92 A;  2F8B A;  1EH8 A;  3VYY A;  4DV1 E;  4R2S A;  2CSH A;  3MHS C;  2YTD A;  2EM8 A;  3LLH A;  1N3G A;  4F54 A;  1AAY A;  2K7I A;  4JV5 E;  2BB8 A;  1QNT A;  5LMU E;  3P1X A;  3C6M A;  2L2M A;  2EN1 A;  2DMI A;  2M4I A;  4R2R A;  2LE2 A;  3EPH A;  1KJK A;  1SR9 A;  1YYW A;  3J80 C;  4M2Z A;  1ZBQ A;  2K4V A;  2GHF A;  4WXD A;  1J26 A;  2DLQ A;  2YTN A;  4DR5 E;  2EM6 A;  4DV3 E;  3OTO E;  2EM0 A;  4X9J A;  5T6J A;  3IWB A;  2YSP A;  4WPY A;  1A1L A;  2LT7 A;  2EN4 A;  2EE8 A;  3DF6 A;  4LF4 E;  5KL5 A;  1T4O A;  5A6B D;  3EPJ A;  2EL4 A;  2YTO A;  4Q28 A;  4DV5 E;  3HPS A;  1JK1 A;  5LMN E;  2I13 A;  3BBG A;  1QU6 A;  5AAS A;  4MLQ A;  1UHZ A;  2EN8 A;  4L5N C;  2VQE E;  2UUB E;  3FIG A;  1HNZ E;  2G7H A;  2F4V E;  2ELZ A;  1MGT A;  3J7A G;  4BC9 A;  4X62 E;  4BHC A;  2PRT A;  2VE7 C;  1WHN A;  2GLI A;  1GTK A;  4K0K E;  2DGC A;  1XMO E;  2EQ0 A;  2ENC A;  3C6K A;  1T4N A;  4WFT A;  2B3T B;  2V87 A;  2UXB E;  1IQS A;  2LMZ A;  3BGH A;  4LF5 E;  3BF2 A;  2UUA E;  2YRK A;  2MC6 A;  3KWR A;  1T4L B;  4YY3 E;  2UXC E;  4F6N A;  4DV2 E;  2EOF A;  2EM3 A;  2R1F A;  4BC7 A;  1EH6 A;  3MHH C;  1N36 E;  2EPC A;  4NZV A;  4LFC E;  4M30 A;  2HJJ A;  3F6G A;  2LUP B;  3JU0 A;  4F9C B;  4LFB E;  2EN7 A;  2LBS B;  1SFE A;  5F3W A;  4NXN E;  4LTY A;  5AC4 A;  2EMG A;  1G2D C;  4R2E A;  4JI2 E;  2RPC A;  4TUI A;  3BID A;  1NEI A;  4RH8 A;  1GZ6 A;  4BHB A;  2EOZ A;  1YZ9 A;  3KZY A;  5AE2 A;  3VHT B;  4LFA E;  4NHR A;  4WYQ B;  4R2C A;  4O4K A;  4JI5 E;  1YFH A;  2EM5 A;  2JR1 A;  3ADI A;  2EPO A;  5BR8 E;  2EMH A;  1IBL E;  2EOX A;  2I9I A;  3EPL A;  2N8X A;  2EOS A;  2EPX A;  1YUJ A;  2LJH A;  2LCE A;  2JWO A;  4BS9 A;  2HHH E;  2EOO A;  2M7Q A;  5A2Q C;  2YU5 A;  1ZBT A;  4JI1 E;  1NCS A;  2YTG A;  2V8Q B;  4KHP E;  3KZZ A;  2HC5 A;  3L00 A;  3RMP A;  1RC7 A;  1STU A;  2WBT A;  2EPR A;  3T1Y E;  2ELY A;  1ZAA C;  2LTR A;  2M1S A;  3ZOQ B;  4ZYH A;  2YU8 A;  4JI3 E;  3C4T A;  2HGH A;  4DR4 E;  2UU9 E;  4GEQ B;  4DR6 E;  2UXD E;  4DMI A;  2FV4 B;  4DUY E;  5IT9 C;  4F9A B;  1F2I G;  4GZN C;  2MKD A;  2DLK A;  4IS1 C;  2YZT A;  4DKK A;  2RS7 A;  4HEI A;  5AE3 A;  4DR2 E;  1HR0 E;  3QG5 C;  3LML A;  4F2J C;  5KL7 A;  2J7J A;  4F9B B;  2DIX A;  2H36 X;  4M9V C;  3EQ1 A;  2M9A A;  2EZ6 A;  2B7T A;  2EMZ A;  2JY9 A;  4R2A A;  1RQ0 A;  2EMC A;  2EN6 A;  2E5L E;  2DB2 A;  5IV8 B;  4WSP A;  5LLQ A;  2JPA A;  2EPK X;  3IWC A;  2N3G A;  2WZO A;  3THN A;  3JTZ A;  5A69 A;  4O5G A;  2L3C A;  1ZU1 A;  3ADG A;  4AQY E;  2EPM X;  2UUC E;  4O43 A;  1A1H A;  3AUZ A;  2ADR A;  5CFF E;  4O24 A;  4DV7 E;  2E1M A;  2ENH A;  1DI2 A;  3HPZ A;  3HTX A;  2IHR 1;  1O0W A;  4DR1 E;  2LVH A;  1BBO A;  1YUI A;  2VF1 A;  4LF7 E;  3HQ1 A;  4FK5 C;  5A6B A;  1BBG A;  2FTX B;  2YTP A;  2EOM A;  2VRD A;  3OML A;  1IBK E;  2YTJ A;  4X66 E;  5DNY A;  2EJ4 A;  2EMB A;  4J8Z A;  1WRJ A;  1WHQ A;  2EMW A;  4P7D A;  3THO B;  2YRH A;  4Q35 B;  4R2D A;  1TN9 A;  2LV2 A;  2LO3 A;  2JOX A;  1XNR E;  2YT4 A;  2DSY A;  4LU9 A;  2EM4 A;  4ZYG A;  4R2Q A;  5FLX C;  1A1F A;  4WX9 A;  1FKA E;  2NUE A;  5LL6 R;  3K6Q A;  2RSI A;  3VYX A;  4OX9 E;  3EPK A;  2ODR C;  2JOB A;  2RTX A;  4R2P A;  1N34 E;  2EWL A;  1YYO A;  1X49 A;  3AV0 A;  2ZM6 E;  3JAM C;  3MSW A;  3F6H A;  1EH7 A;  4DR3 E;  2L8T A;  1X6E A;  1X5W A;  1N33 E;  2EQ1 A;  1UBD C;  1UN6 B;  3M99 B;  1X48 A;  1PJQ A;  4ZYD A;  2RSM A;  2ODR D;  1DGC A;  3J81 C;  2L2N A;  2L6M A;  1HNW E;  1RMD A;  5KL4 A;  4JI7 E;  2LRS A;  4WXC A;  2N3H A;  3ADL A;  4P78 A;  2A25 A;  5AC5 A;  2CPN A;  5ADZ A;  4IJD A;  4DUZ E;  1XNQ E;  1IQO A;  1G2F C;  2EPN A;  2JVA A;  3TQM A;  3HXL A;  5IXM B;  2EM9 A;  2YWQ A;  2VQF E;  2RQL A;  1T39 A;  2EMX A;  2BBG A;  2YTF A;  1JK2 A;  2EMY A;  4YHH E;  2LUQ A;  1I94 E;  1J5E E;  2EN2 A;  1WJP A;  2NAB A;  3J7Y p;  1WXR A;  3H09 A;  4X64 E;  2EOY A;  2L33 A;  3VK6 A;  4B3S E;  2WCC 3;  4BCA A;  4DV0 E;  4F6M A;  2YRM A;  2LTS A;  2EPL X;  1X3C A;  4NXM E;  2EL6 A;  1X6F A;  2EOH A;  2WBS A;  4LF8 E;  2CT1 A;  1DQ3 A;  2EMF A;  2L2K B;  1IBM E;  2EQ3 A;  2FGG A;  2Q8U A;  2EPP A;  2EOE A;  2EL5 A;  1LLM C;  1Z1B A;  2EPZ A;  3UK3 C;  1X47 A;  2MDR A;  2EOJ A;  4LF6 E;  1N32 E;  2DMY A;  2EPU A;  2V88 A;  1L4S A;  4R8O A;  1A1K A;  1GQE A;  5A6J A;  2YTI A;  2EOR A;  1XMQ E;  1X6H A;  1TF6 A;  5A6A A;  1IMU A;  4WSG A;  2V86 A;  1A1G A;  3C4B A;  4DR7 E;  4M0V A;  2NUG A;  2E72 A;  4RHB B;  4DV6 E;  1B69 A;  2EN3 A;  4GKK E;  1PKP A;  2LJU A;  4L8N A;  3T1H E;  2KHX A;  2EOI A;  4ZYE A;  4LF9 E;  2JXP A;  4DV4 E;  2EMI A;  1HNX E;  2V83 A;  2JYA A;  2CTD A;  2MKN A;  1ZR9 A;  2YSO A;  5KL6 A;  2EP3 A;  2EM2 A;  4TUG A;  1T38 A;  2L3J A;  4B3T E;  4KWY A;  4KZS A;  1A1I A;  2EM7 A;  5A6K A;  3ADJ A;  4JI6 E;  3ECR A;  1YYK A;  2YTQ A;  4JI8 E;  4GKJ E;  2KON A;  2YPN A;  1A1J A;  2EML A;  2DRP A;  2V85 A;  1KYQ A;  4B3M E;  1PDA A;  1YPN A;  2B7V A;  5TSE A; 
#chains in the Genus database with same CATH homology
 2DLK A;  4IJD A;  4IS1 C;  1YSA C;  1G2F C;  2WBU A;  1BB8 A;  5KL3 A;  2ENA A;  2EM9 A;  4F2J C;  5KL7 A;  2J7J A;  5KL2 A;  1TF3 A;  2YRK A;  1MEY C;  4M9V C;  2EMX A;  2YTF A;  1JK2 A;  2M9A A;  4F6N A;  2EMY A;  2EMZ A;  2JP9 A;  4R2A A;  2EMC A;  2EOF A;  2MDG A;  2EN2 A;  1WJP A;  2EN6 A;  2EM3 A;  2NAB A;  2R1F A;  3MHH C;  2EMA A;  2EPC A;  2EPA A;  2EOY A;  2JPA A;  2D9H A;  2EN7 A;  1ZU1 A;  2WCC 3;  2EMG A;  4F6M A;  1G2D C;  4R2E A;  2YRM A;  2EOQ A;  1P47 A;  1A1H A;  2ADR A;  2EMK A;  1X3C A;  2EL6 A;  1X6F A;  2EOH A;  2RPC A;  2YTE A;  2CT1 A;  2ENH A;  2WBS A;  2EMF A;  2EOZ A;  4R2S A;  2CSH A;  2EQ3 A;  2LVH A;  3VHT B;  3MHS C;  2YTD A;  4R2C A;  2EM8 A;  1BBO A;  1YUI A;  2EPP A;  2EOE A;  2EL5 A;  1LLM C;  4FK5 C;  1Z1B A;  2EPZ A;  2EM5 A;  1AAY A;  3UK3 C;  2YTP A;  2EOJ A;  2BB8 A;  2EOM A;  2EPU A;  2VRD A;  2EMH A;  2YTJ A;  2EOX A;  1A1K A;  3EPL A;  2YTI A;  2EJ4 A;  2EMB A;  2EOR A;  2EOS A;  2EPX A;  2EMW A;  1YUJ A;  2EN1 A;  2DMI A;  2YRH A;  4R2D A;  1TN9 A;  1X6H A;  2LCE A;  2LO3 A;  2LV2 A;  4R2R A;  3EPH A;  1KJK A;  1TF6 A;  2EM4 A;  4R2Q A;  2GHF A;  2DLQ A;  2YTN A;  4WSG A;  1A1G A;  1A1F A;  2EOO A;  2E72 A;  2EM6 A;  2RSI A;  1B69 A;  2YU5 A;  2EN3 A;  3EPK A;  2EM0 A;  4R2P A;  1NCS A;  2YTG A;  4X9J A;  2YSP A;  2EOI A;  2LT7 A;  1A1L A;  2EN4 A;  2EE8 A;  2EMI A;  1X6E A;  1X5W A;  2EQ1 A;  1UBD C;  5KL5 A;  1UN6 B;  3M99 B;  2WBT A;  2CTD A;  2EPR A;  2MKN A;  1ZR9 A;  3EPJ A;  2EL4 A;  2ELY A;  2YTO A;  1ZAA C;  2YSO A;  5KL6 A;  2EP3 A;  1JK1 A;  2EM2 A;  2I13 A;  1DGC A;  1A1I A;  2EN8 A;  2EM7 A;  2YU8 A;  2ELZ A;  2HGH A;  1RMD A;  2YTQ A;  2PRT A;  5KL4 A;  2GLI A;  1A1J A;  2EML A;  2DRP A;  2DGC A;  2EQ0 A;  2ENC A;  1F2I G;  4GZN C;  2A25 A;  2MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...