2EE8A

Solution structure of three zf-c2h2 domains from mouse protein odd-skipped-related 2 splicing isoform 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
106
structure length
106
Chain Sequence
GSSGSSGGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQTSSPTAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein odd-skipped-related 2
publication title Solution structure of three zf-C2H2 domains from mouse protein odd-skipped-related 2 splicing isoform 2
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 16
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ee8A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ee8A02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ee8A01
1A1IA 2EMYA 3EPLA 2EN3A 2EOEA 2YTFA 2EORA 2EMXA 2EQ1A 5KL2A 2CT1A 4R2PA 2YRHA 2EPRA 1AAYA 1ZU1A 2EMWA 2CTDA 2LO3A 2M9AA 1RMDA 4F2JC 2YTGA 2EMAA 1X6FA 2YTIA 1TF6A 2CSHA 2EMIA 5KL5A 2EL4A 2ENAA 4IJDA 2YTNA 4R2AA 4R2EA 2HGHA 2EMBA 1ZAAC 2MKNA 2EM4A 2DMIA 5KL7A 2EM6A 1A1FA 2EOOA 4X9JA 1Z1BA 1BBOA 1X6HA 1ZR9A 1P47A 2I13A 2WBSA 1A1KA 2DGCA 2YRMA 2EM2A 2JP9A 2DLQA 1TN9A 2EN4A 2EOYA 1BB8A 2WBUA 1X3CA 2EMCA 2EOMA 2EPCA 2NABA 2WCC3 1NCSA 2ENHA 4M9VC 2A25A 2EM7A 2EOSA 4F6MA 2EL6A 2EPPA 2EN8A 2EPZA 2EMHA 2EOXA 2EOJA 2PRTA 4GZNC 4R2SA 1KJKA 2LCEA 1YUIA 2WBTA 2JPAA 4R2CA 3M99B 2EN1A 2YTJA 2LT7A 1YSAC 4R2QA 2BB8A 2YSPA 2RSIA 2ELYA 1MEYC 2DRPA 2YTQA 1A1HA 1UBDC 2D9HA 2EQ0A 2MKDA 3EPJA 2YU8A 1X5WA 2MDGA 2YU5A 2EE8A 4FK5C 2EMLA 3VHTB 5KL4A 2EPAA 2EL5A 2GLIA 2EM8A 2EOHA 2GHFA 2YSOA 2YRKA 1JK2A 2EJ4A 1G2FC 2EN2A 1UN6B 1A1LA 2YTOA 2EMFA 2LVHA 2LV2A 1YUJA 2EP3A 1X6EA 1G2DC 2EOIA 3UK3C 2EPUA 2EM3A 4IS1C 3MHHC 4F6NA 2ELZA 2EN6A 1F2IG 2DLKA 2ADRA 2J7JA 1DGCA 2EMKA 5KL3A 2YTDA 2EPXA 2EM5A 2EM0A 3EPHA 2YTEA 2R1FA 3EPKA 1B69A 2EN7A 2E72A 2RPCA 1A1GA 3MHSC 2EOQA 1LLMC 2ENCA 2EOZA 1JK1A 4R2DA 2EMZA 2YTPA 2VRDA 4WSGA 2EM9A 2EOFA 1TF3A 2EMGA 4R2RA 2EQ3A 1WJPA 5KL6A 1A1JA
chains in the Genus database with same CATH superfamily
5FLXC 1A1IA 5AC5A 2EN3A 3THNA 2EOEA 4M0VA 2K4VA 2V87A 2YT4A 2L33A 1N36E 1ZU1A 2CTDA 2DMYA 4F2JC 2EMIA 4IJDA 4R2EA 3HTXA 2EMBA 2BBGA 5KL7A 4MLQA 5BR8E 1SFEA 5A6KA 4WFTA 4O24A 1PKPA 4X9JA 5A6BD 1A1KA 1ZBTA 2EPLX 1N3GA 4LTYA 2NUEA 5AE2A 4DV6E 2B7TA 4X66E 4R03A 1PJQA 2EOYA 1BB8A 1IBME 2EMCA 1IMUA 2LRSA 2A25A 2EM7A 4DR2E 1AH5A 2EN8A 1FKAE 5A2QC 5IV8B 2PRTA 1KJKA 3VYXA 2LCEA 2V89A 2LJHA 2UUAE 2WBTA 2YTJA 1IQSA 3DJWA 2EPNA 4R2QA 2ELYA 1N34E 3RMPA 1ZBQA 4AQYE 1MGTA 2YTQA 1A1HA 1UBDC 4JI5E 2EQ0A 3P1XA 1RC7A 4OOGC 2MDGA 2YU5A 3J81C 5KL4A 2EPAA 2EOHA 2GHFA 1WHNA 1SR9A 2V86A 2LUQA 4F9AB 1XMQE 1EH8A 2EN2A 2MC6A 4DMIA 3F6GA 4GEQB 4DV5E 3ZOQB 2LVHA 1YYOA 2WZOA 1G2DC 2GPIA 2IHR1 2EM3A 1T39A 2JR1A 1EH7A 2EPXA 2EM0A 1X48A 2LTSA 5A6AA 2I9IA 4JI7E 4P7DA 4YY3E 2L2NA 1JK1A 3EQ1A 2ZM6E 1DQ3A 2EMGA 2B3TB 1TF3A 1WHQA 1PDAA 5A6BA 4DV4E 2EMYA 1J26A 3C6KA 3ADIA 4WX9A 2EMXA 5DNYA 2CT1A 2YRHA 3J7Yp 4ZYEA 1T4NA 2FGGA 1RMDA 2LO3A 4KWYA 2YTIA 1X47A 5LLQA 4LFAE 4BHCA 5KL5A 4DV2E 4R2AA 4LF4E 2EM4A 2DMIA 4X62E 5IXMB 4NXNE 2EM6A 5F3WA 4K0KE 2YZTA 4DR3E 1ZR9A 4NXME 3C4BA 2NUFA 2JP9A 3K6QA 3HPZA 1XNRE 2NUGA 2JY9A 2NABA 3IWDA 2UUBE 1NCSA 2ENHA 4M9VC 4F6MA 4B3RE 2EL6A 4JI1E 2EOJA 2N8XA 3KZZA 2JPAA 4RH8A 1YSAC 2LT7A 4JI2E 4BBYA 2VQEE 2DRPA 2D9HA 4BMJA 3EPJA 4KHPE 1X5WA 4DR6E 2EE8A 5A6JA 4JI6E 2MC5A 3C6MA 2GLIA 2V85A 2EM8A 4LU9A 1JK2A 4B3TE 4DKKA 1YYWA 5LMNE 2EJ4A 1T4OA 1G2FC 1PJTA 4TUIA 1IBKE 1UN6B 4YHHE 2RTXA 2M4IA 2LJUA 2EOIA 4HEIA 3IWBA 4IS1C 2DLKA 2ADRA 4ZYDA 1DGCA 5KL3A 2RSMA 4GKKE 1DI2A 3H09A 1I94E 2EM5A 3EPHA 4OX9E 2R1FA 4BC7A 2E72A 3FIGA 1A1GA 3BGHA 5LL6R 4HTGA 4WSPA 4JI3E 4F9BB 2EZ6A 2EOFA 2L2KB 2V8QB 3KWRA 2EOOA 2JYAA 5LMUE 2EPOA 1HNXE 2V88A 2YTFA 2EORA 4M30A 2L3CA 4DV7E 4NZVA 4L8NA 4ZYHA 2EPRA 3T1YE 1AAYA 2VF1A 4JI0E 4LF6E 1QU6A 1J5EE 2EMAA 2EPKX 1X6FA 2R76A 2CSHA 2YWQA 3QG5C 2ENAA 3LMLA 1RQ0A 2HGHA 3THOB 4JV5E 3BIDA 2EWLA 4WXCA 2ODRD 1GZ6A 3VYYA 1Z1BA 1BBOA 1X6HA 2I13A 2ODRC 5ADZA 2EM2A 1O0WA 2LMZA 3ADGA 2M1SA 1TN9A 2EN4A 2JOXA 2UXBE 2WBUA 4X65E 1X3CA 2CPNA 2EPCA 2WCC3 1GTKA 3TQMA 3ADLA 2EPPA 2LBSB 2UXCE 2EPZA 1STUA 2JWOA 1EH6A 2EMHA 5AE3A 1XMOE 3BF2A 4NHRA 1FJGE 2L92A 4ZYGA 3OMLA 3J7AG 3DF6A 4R2CA 2MDRA 2EN1A 4DR7E 2BB8A 4LFCE 4LFBE 2LE2A 4DR4E 1YPNA 2YU8A 2RQLA 1UHZA 3JU0A 2EPMX 4FK5C 4R8OA 3VHTB 4F54A 2YSOA 4LF9E 5CFFE 4X64E 1EKZA 5TSEA 3HPSA 4O5GA 1A1LA 2YTOA 2EMFA 2LV2A 3HXLA 4B3SE 1YYKA 3UK3C 4F6NA 2LTRA 2ELZA 1PJSA 2J7JA 2EMKA 2H36X 2YTDA 2YTEA 3EPKA 2L2MA 1B69A 2RPCA 2EOQA 5AE1A 3C4TA 1UILA 3ECRA 2EMZA 3L00A 4JI8E 2E1MA 2VRDA 2EM9A 5IWAE 4BHBA 2UUCE 1IQOA 2V83A 4R2RA 2UU9E 1A1JA 3KZYA 3AUZA 4I8OA 1NEIA 4Q28A 3EPLA 4DUYE 1HNZE 1L4SA 3AV0A 1QNTA 1GQEA 2EQ1A 4F9CB 1T38A 5KL2A 4R2PA 4O43A 3F6HA 3MSWA 2G7HA 4BC9A 1YZ9A 2EMWA 4JYAE 4P78A 1HNWE 4DV3E 4RHBB 2M9AA 2YTGA 1TF6A 2EL4A 2DB2A 2K7IA 2YTNA 2YPNA 1T4LB 4DV0E 1ZAAC 4WPYA 2MKNA 2LUPB 2N3GA 2HC5A 3HQ1A 4BS9A 4M2ZA 4JI4E 2KONA 1A1FA 3T1HE 1N32E 1P47A 2WBSA 2DGCA 2YRMA 4X8WA 2DLQA 5IT9C 2EOMA 2DSYA 4LF5E 3JTZA 4WXDA 2EOSA 4B3ME 2F8BA 3J80C 2KHXA 2JXPA 2Q8UA 4LF8E 2EOXA 5A69A 4GZNC 4R2SA 2L3JA 3OTOE 1YFHA 1YUIA 2L8TA 2JOBA 3M99B 2DIXA 2NA2A 3JAMC 2B9DA 2YSPA 2RSIA 4GKJE 1MEYC 1HR0E 1WXRA 1WRJA 3IWCA 5AASA 4LF7E 2MKDA 3LLHA 2JVAA 2HHHE 2EMLA 4DV1E 2EL5A 4Q35B 5AC4A 2YRKA 3ADJA 3VK6A 4O4KA 4J8ZA 2E5LE 2F4VE 1YUJA 2KOUA 5T6JA 2EP3A 1X6EA 4WYQB 4N4RB 2EPUA 2M7QA 3MHHC 1XNQE 2EN6A 1F2IG 1KYQA 2VE7C 4TUGA 1IBLE 2N3HA 1X49A 2FV4B 2VQFE 4BCAA 2EN7A 3BBGA 2RS6A 1N33E 3MHSC 4MLVA 4DR5E 2HJJA 4DUZE 1LLMC 2ENCA 2EOZA 2FTXB 4KZSA 4R2DA 2YTPA 4WSGA 2L6MA 2RS7A 4L5NC 1BBGA 2B7VA 4DR1E 2UXDE 2EQ3A 1WJPA 5KL6A
chains in the Genus database with same CATH topology
1A1IA 2EMYA 3EPLA 2EN3A 2EOEA 2YTFA 2EORA 2EMXA 2EQ1A 5KL2A 2CT1A 4R2PA 2YRHA 2EPRA 1AAYA 1ZU1A 2EMWA 2CTDA 2LO3A 2M9AA 1RMDA 4F2JC 2YTGA 2EMAA 1X6FA 2YTIA 1TF6A 2CSHA 2EMIA 5KL5A 2EL4A 2ENAA 4IJDA 2YTNA 4R2AA 4R2EA 2HGHA 2EMBA 1ZAAC 2MKNA 2EM4A 2DMIA 5KL7A 2EM6A 1A1FA 2EOOA 4X9JA 1Z1BA 1BBOA 1X6HA 1ZR9A 1P47A 2I13A 2WBSA 1A1KA 2DGCA 2YRMA 2EM2A 2JP9A 2DLQA 1TN9A 2EN4A 2EOYA 1BB8A 2WBUA 1X3CA 2EMCA 2EOMA 2EPCA 2NABA 2WCC3 1NCSA 2ENHA 4M9VC 2A25A 2EM7A 2EOSA 4F6MA 2EL6A 2EPPA 2EN8A 2EPZA 2EMHA 2EOXA 2EOJA 2PRTA 4GZNC 4R2SA 1KJKA 2LCEA 1YUIA 2WBTA 2JPAA 4R2CA 3M99B 2EN1A 2YTJA 2LT7A 1YSAC 4R2QA 2BB8A 2YSPA 2RSIA 2ELYA 1MEYC 2DRPA 2YTQA 1A1HA 1UBDC 2D9HA 2EQ0A 2MKDA 3EPJA 2YU8A 1X5WA 2MDGA 2YU5A 2EE8A 4FK5C 2EMLA 3VHTB 5KL4A 2EPAA 2EL5A 2GLIA 2EM8A 2EOHA 2GHFA 2YSOA 2YRKA 1JK2A 2EJ4A 1G2FC 2EN2A 1UN6B 1A1LA 2YTOA 2EMFA 2LVHA 2LV2A 1YUJA 2EP3A 1X6EA 1G2DC 2EOIA 3UK3C 2EPUA 2EM3A 4IS1C 3MHHC 4F6NA 2ELZA 2EN6A 1F2IG 2DLKA 2ADRA 2J7JA 1DGCA 2EMKA 5KL3A 2YTDA 2EPXA 2EM5A 2EM0A 3EPHA 2YTEA 2R1FA 3EPKA 1B69A 2EN7A 2E72A 2RPCA 1A1GA 3MHSC 2EOQA 1LLMC 2ENCA 2EOZA 1JK1A 4R2DA 2EMZA 2YTPA 2VRDA 4WSGA 2EM9A 2EOFA 1TF3A 2EMGA 4R2RA 2EQ3A 1WJPA 5KL6A 1A1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1I A;  2EMY A;  3EPL A;  2EN3 A;  2EOE A;  2YTF A;  2EOR A;  2EMX A;  2EQ1 A;  5KL2 A;  2CT1 A;  4R2P A;  2YRH A;  2EPR A;  1AAY A;  1ZU1 A;  2EMW A;  2CTD A;  2LO3 A;  2M9A A;  1RMD A;  4F2J C;  2YTG A;  2EMA A;  1X6F A;  2YTI A;  1TF6 A;  2CSH A;  2EMI A;  5KL5 A;  2EL4 A;  2ENA A;  4IJD A;  2YTN A;  4R2A A;  4R2E A;  2HGH A;  2EMB A;  1ZAA C;  2MKN A;  2EM4 A;  2DMI A;  5KL7 A;  2EM6 A;  1A1F A;  2EOO A;  4X9J A;  1Z1B A;  1BBO A;  1X6H A;  1ZR9 A;  1P47 A;  2I13 A;  2WBS A;  1A1K A;  2DGC A;  2YRM A;  2EM2 A;  2JP9 A;  2DLQ A;  1TN9 A;  2EN4 A;  2EOY A;  1BB8 A;  2WBU A;  1X3C A;  2EMC A;  2EOM A;  2EPC A;  2NAB A;  2WCC 3;  1NCS A;  2ENH A;  4M9V C;  2A25 A;  2EM7 A;  2EOS A;  4F6M A;  2EL6 A;  2EPP A;  2EN8 A;  2EPZ A;  2EMH A;  2EOX A;  2EOJ A;  2PRT A;  4GZN C;  4R2S A;  1KJK A;  2LCE A;  1YUI A;  2WBT A;  2JPA A;  4R2C A;  3M99 B;  2EN1 A;  2YTJ A;  2LT7 A;  1YSA C;  4R2Q A;  2BB8 A;  2YSP A;  2RSI A;  2ELY A;  1MEY C;  2DRP A;  2YTQ A;  1A1H A;  1UBD C;  2D9H A;  2EQ0 A;  2MKD A;  3EPJ A;  2YU8 A;  1X5W A;  2MDG A;  2YU5 A;  2EE8 A;  4FK5 C;  2EML A;  3VHT B;  5KL4 A;  2EPA A;  2EL5 A;  2GLI A;  2EM8 A;  2EOH A;  2GHF A;  2YSO A;  2YRK A;  1JK2 A;  2EJ4 A;  1G2F C;  2EN2 A;  1UN6 B;  1A1L A;  2YTO A;  2EMF A;  2LVH A;  2LV2 A;  1YUJ A;  2EP3 A;  1X6E A;  1G2D C;  2EOI A;  3UK3 C;  2EPU A;  2EM3 A;  4IS1 C;  3MHH C;  4F6N A;  2ELZ A;  2EN6 A;  1F2I G;  2DLK A;  2ADR A;  2J7J A;  1DGC A;  2EMK A;  5KL3 A;  2YTD A;  2EPX A;  2EM5 A;  2EM0 A;  3EPH A;  2YTE A;  2R1F A;  3EPK A;  1B69 A;  2EN7 A;  2E72 A;  2RPC A;  1A1G A;  3MHS C;  2EOQ A;  1LLM C;  2ENC A;  2EOZ A;  1JK1 A;  4R2D A;  2EMZ A;  2YTP A;  2VRD A;  4WSG A;  2EM9 A;  2EOF A;  1TF3 A;  2EMG A;  4R2R A;  2EQ3 A;  1WJP A;  5KL6 A;  1A1J A; 
#chains in the Genus database with same CATH topology
 5FLX C;  1A1I A;  5AC5 A;  2EN3 A;  3THN A;  2EOE A;  4M0V A;  2K4V A;  2V87 A;  2YT4 A;  2L33 A;  1N36 E;  1ZU1 A;  2CTD A;  2DMY A;  4F2J C;  2EMI A;  4IJD A;  4R2E A;  3HTX A;  2EMB A;  2BBG A;  5KL7 A;  4MLQ A;  5BR8 E;  1SFE A;  5A6K A;  4WFT A;  4O24 A;  1PKP A;  4X9J A;  5A6B D;  1A1K A;  1ZBT A;  2EPL X;  1N3G A;  4LTY A;  2NUE A;  5AE2 A;  4DV6 E;  2B7T A;  4X66 E;  4R03 A;  1PJQ A;  2EOY A;  1BB8 A;  1IBM E;  2EMC A;  1IMU A;  2LRS A;  2A25 A;  2EM7 A;  4DR2 E;  1AH5 A;  2EN8 A;  1FKA E;  5A2Q C;  5IV8 B;  2PRT A;  1KJK A;  3VYX A;  2LCE A;  2V89 A;  2LJH A;  2UUA E;  2WBT A;  2YTJ A;  1IQS A;  3DJW A;  2EPN A;  4R2Q A;  2ELY A;  1N34 E;  3RMP A;  1ZBQ A;  4AQY E;  1MGT A;  2YTQ A;  1A1H A;  1UBD C;  4JI5 E;  2EQ0 A;  3P1X A;  1RC7 A;  4OOG C;  2MDG A;  2YU5 A;  3J81 C;  5KL4 A;  2EPA A;  2EOH A;  2GHF A;  1WHN A;  1SR9 A;  2V86 A;  2LUQ A;  4F9A B;  1XMQ E;  1EH8 A;  2EN2 A;  2MC6 A;  4DMI A;  3F6G A;  4GEQ B;  4DV5 E;  3ZOQ B;  2LVH A;  1YYO A;  2WZO A;  1G2D C;  2GPI A;  2IHR 1;  2EM3 A;  1T39 A;  2JR1 A;  1EH7 A;  2EPX A;  2EM0 A;  1X48 A;  2LTS A;  5A6A A;  2I9I A;  4JI7 E;  4P7D A;  4YY3 E;  2L2N A;  1JK1 A;  3EQ1 A;  2ZM6 E;  1DQ3 A;  2EMG A;  2B3T B;  1TF3 A;  1WHQ A;  1PDA A;  5A6B A;  4DV4 E;  2EMY A;  1J26 A;  3C6K A;  3ADI A;  4WX9 A;  2EMX A;  5DNY A;  2CT1 A;  2YRH A;  3J7Y p;  4ZYE A;  1T4N A;  2FGG A;  1RMD A;  2LO3 A;  4KWY A;  2YTI A;  1X47 A;  5LLQ A;  4LFA E;  4BHC A;  5KL5 A;  4DV2 E;  4R2A A;  4LF4 E;  2EM4 A;  2DMI A;  4X62 E;  5IXM B;  4NXN E;  2EM6 A;  5F3W A;  4K0K E;  2YZT A;  4DR3 E;  1ZR9 A;  4NXM E;  3C4B A;  2NUF A;  2JP9 A;  3K6Q A;  3HPZ A;  1XNR E;  2NUG A;  2JY9 A;  2NAB A;  3IWD A;  2UUB E;  1NCS A;  2ENH A;  4M9V C;  4F6M A;  4B3R E;  2EL6 A;  4JI1 E;  2EOJ A;  2N8X A;  3KZZ A;  2JPA A;  4RH8 A;  1YSA C;  2LT7 A;  4JI2 E;  4BBY A;  2VQE E;  2DRP A;  2D9H A;  4BMJ A;  3EPJ A;  4KHP E;  1X5W A;  4DR6 E;  2EE8 A;  5A6J A;  4JI6 E;  2MC5 A;  3C6M A;  2GLI A;  2V85 A;  2EM8 A;  4LU9 A;  1JK2 A;  4B3T E;  4DKK A;  1YYW A;  5LMN E;  2EJ4 A;  1T4O A;  1G2F C;  1PJT A;  4TUI A;  1IBK E;  1UN6 B;  4YHH E;  2RTX A;  2M4I A;  2LJU A;  2EOI A;  4HEI A;  3IWB A;  4IS1 C;  2DLK A;  2ADR A;  4ZYD A;  1DGC A;  5KL3 A;  2RSM A;  4GKK E;  1DI2 A;  3H09 A;  1I94 E;  2EM5 A;  3EPH A;  4OX9 E;  2R1F A;  4BC7 A;  2E72 A;  3FIG A;  1A1G A;  3BGH A;  5LL6 R;  4HTG A;  4WSP A;  4JI3 E;  4F9B B;  2EZ6 A;  2EOF A;  2L2K B;  2V8Q B;  3KWR A;  2EOO A;  2JYA A;  5LMU E;  2EPO A;  1HNX E;  2V88 A;  2YTF A;  2EOR A;  4M30 A;  2L3C A;  4DV7 E;  4NZV A;  4L8N A;  4ZYH A;  2EPR A;  3T1Y E;  1AAY A;  2VF1 A;  4JI0 E;  4LF6 E;  1QU6 A;  1J5E E;  2EMA A;  2EPK X;  1X6F A;  2R76 A;  2CSH A;  2YWQ A;  3QG5 C;  2ENA A;  3LML A;  1RQ0 A;  2HGH A;  3THO B;  4JV5 E;  3BID A;  2EWL A;  4WXC A;  2ODR D;  1GZ6 A;  3VYY A;  1Z1B A;  1BBO A;  1X6H A;  2I13 A;  2ODR C;  5ADZ A;  2EM2 A;  1O0W A;  2LMZ A;  3ADG A;  2M1S A;  1TN9 A;  2EN4 A;  2JOX A;  2UXB E;  2WBU A;  4X65 E;  1X3C A;  2CPN A;  2EPC A;  2WCC 3;  1GTK A;  3TQM A;  3ADL A;  2EPP A;  2LBS B;  2UXC E;  2EPZ A;  1STU A;  2JWO A;  1EH6 A;  2EMH A;  5AE3 A;  1XMO E;  3BF2 A;  4NHR A;  1FJG E;  2L92 A;  4ZYG A;  3OML A;  3J7A G;  3DF6 A;  4R2C A;  2MDR A;  2EN1 A;  4DR7 E;  2BB8 A;  4LFC E;  4LFB E;  2LE2 A;  4DR4 E;  1YPN A;  2YU8 A;  2RQL A;  1UHZ A;  3JU0 A;  2EPM X;  4FK5 C;  4R8O A;  3VHT B;  4F54 A;  2YSO A;  4LF9 E;  5CFF E;  4X64 E;  1EKZ A;  5TSE A;  3HPS A;  4O5G A;  1A1L A;  2YTO A;  2EMF A;  2LV2 A;  3HXL A;  4B3S E;  1YYK A;  3UK3 C;  4F6N A;  2LTR A;  2ELZ A;  1PJS A;  2J7J A;  2EMK A;  2H36 X;  2YTD A;  2YTE A;  3EPK A;  2L2M A;  1B69 A;  2RPC A;  2EOQ A;  5AE1 A;  3C4T A;  1UIL A;  3ECR A;  2EMZ A;  3L00 A;  4JI8 E;  2E1M A;  2VRD A;  2EM9 A;  5IWA E;  4BHB A;  2UUC E;  1IQO A;  2V83 A;  4R2R A;  2UU9 E;  1A1J A;  3KZY A;  3AUZ A;  4I8O A;  1NEI A;  4Q28 A;  3EPL A;  4DUY E;  1HNZ E;  1L4S A;  3AV0 A;  1QNT A;  1GQE A;  2EQ1 A;  4F9C B;  1T38 A;  5KL2 A;  4R2P A;  4O43 A;  3F6H A;  3MSW A;  2G7H A;  4BC9 A;  1YZ9 A;  2EMW A;  4JYA E;  4P78 A;  1HNW E;  4DV3 E;  4RHB B;  2M9A A;  2YTG A;  1TF6 A;  2EL4 A;  2DB2 A;  2K7I A;  2YTN A;  2YPN A;  1T4L B;  4DV0 E;  1ZAA C;  4WPY A;  2MKN A;  2LUP B;  2N3G A;  2HC5 A;  3HQ1 A;  4BS9 A;  4M2Z A;  4JI4 E;  2KON A;  1A1F A;  3T1H E;  1N32 E;  1P47 A;  2WBS A;  2DGC A;  2YRM A;  4X8W A;  2DLQ A;  5IT9 C;  2EOM A;  2DSY A;  4LF5 E;  3JTZ A;  4WXD A;  2EOS A;  4B3M E;  2F8B A;  3J80 C;  2KHX A;  2JXP A;  2Q8U A;  4LF8 E;  2EOX A;  5A69 A;  4GZN C;  4R2S A;  2L3J A;  3OTO E;  1YFH A;  1YUI A;  2L8T A;  2JOB A;  3M99 B;  2DIX A;  2NA2 A;  3JAM C;  2B9D A;  2YSP A;  2RSI A;  4GKJ E;  1MEY C;  1HR0 E;  1WXR A;  1WRJ A;  3IWC A;  5AAS A;  4LF7 E;  2MKD A;  3LLH A;  2JVA A;  2HHH E;  2EML A;  4DV1 E;  2EL5 A;  4Q35 B;  5AC4 A;  2YRK A;  3ADJ A;  3VK6 A;  4O4K A;  4J8Z A;  2E5L E;  2F4V E;  1YUJ A;  2KOU A;  5T6J A;  2EP3 A;  1X6E A;  4WYQ B;  4N4R B;  2EPU A;  2M7Q A;  3MHH C;  1XNQ E;  2EN6 A;  1F2I G;  1KYQ A;  2VE7 C;  4TUG A;  1IBL E;  2N3H A;  1X49 A;  2FV4 B;  2VQF E;  4BCA A;  2EN7 A;  3BBG A;  2RS6 A;  1N33 E;  3MHS C;  4MLV A;  4DR5 E;  2HJJ A;  4DUZ E;  1LLM C;  2ENC A;  2EOZ A;  2FTX B;  4KZS A;  4R2D A;  2YTP A;  4WSG A;  2L6M A;  2RS7 A;  4L5N C;  1BBG A;  2B7V A;  4DR1 E;  2UXD E;  2EQ3 A;  1WJP A;  5KL6 A; 
#chains in the Genus database with same CATH homology
 1A1I A;  2EMY A;  3EPL A;  2EN3 A;  2EOE A;  2YTF A;  2EOR A;  2EMX A;  2EQ1 A;  5KL2 A;  2CT1 A;  4R2P A;  2YRH A;  2EPR A;  1AAY A;  1ZU1 A;  2EMW A;  2CTD A;  2LO3 A;  2M9A A;  1RMD A;  4F2J C;  2YTG A;  2EMA A;  1X6F A;  2YTI A;  1TF6 A;  2CSH A;  2EMI A;  5KL5 A;  2EL4 A;  2ENA A;  4IJD A;  2YTN A;  4R2A A;  4R2E A;  2HGH A;  2EMB A;  1ZAA C;  2MKN A;  2EM4 A;  2DMI A;  5KL7 A;  2EM6 A;  1A1F A;  2EOO A;  4X9J A;  1Z1B A;  1BBO A;  1X6H A;  1ZR9 A;  1P47 A;  2I13 A;  2WBS A;  1A1K A;  2DGC A;  2YRM A;  2EM2 A;  2JP9 A;  2DLQ A;  1TN9 A;  2EN4 A;  2EOY A;  1BB8 A;  2WBU A;  1X3C A;  2EMC A;  2EOM A;  2EPC A;  2NAB A;  2WCC 3;  1NCS A;  2ENH A;  4M9V C;  2A25 A;  2EM7 A;  2EOS A;  4F6M A;  2EL6 A;  2EPP A;  2EN8 A;  2EPZ A;  2EMH A;  2EOX A;  2EOJ A;  2PRT A;  4GZN C;  4R2S A;  1KJK A;  2LCE A;  1YUI A;  2WBT A;  2JPA A;  4R2C A;  3M99 B;  2EN1 A;  2YTJ A;  2LT7 A;  1YSA C;  4R2Q A;  2BB8 A;  2YSP A;  2RSI A;  2ELY A;  1MEY C;  2DRP A;  2YTQ A;  1A1H A;  1UBD C;  2D9H A;  2EQ0 A;  2MKD A;  3EPJ A;  2YU8 A;  1X5W A;  2MDG A;  2YU5 A;  2EE8 A;  4FK5 C;  2EML A;  3VHT B;  5KL4 A;  2EPA A;  2EL5 A;  2GLI A;  2EM8 A;  2EOH A;  2GHF A;  2YSO A;  2YRK A;  1JK2 A;  2EJ4 A;  1G2F C;  2EN2 A;  1UN6 B;  1A1L A;  2YTO A;  2EMF A;  2LVH A;  2LV2 A;  1YUJ A;  2EP3 A;  1X6E A;  1G2D C;  2EOI A;  3UK3 C;  2EPU A;  2EM3 A;  4IS1 C;  3MHH C;  4F6N A;  2ELZ A;  2EN6 A;  1F2I G;  2DLK A;  2ADR A;  2J7J A;  1DGC A;  2EMK A;  5KL3 A;  2YTD A;  2EPX A;  2EM5 A;  2EM0 A;  3EPH A;  2YTE A;  2R1F A;  3EPK A;  1B69 A;  2EN7 A;  2E72 A;  2RPC A;  1A1G A;  3MHS C;  2EOQ A;  1LLM C;  2ENC A;  2EOZ A;  1JK1 A;  4R2D A;  2EMZ A;  2YTP A;  2VRD A;  4WSG A;  2EM9 A;  2EOF A;  1TF3 A;  2EMG A;  4R2R A;  2EQ3 A;  1WJP A;  5KL6 A;  1A1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...