4RHBB

Crystal structure of the lipopolysaccharide assembly complex lptd-lpte from the escherichia coli outer membrane
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
GWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords LPS-assembly protein LptD
publication title Structural basis of lipopolysaccharide insertion into the bacterial outer membrane
rcsb
source organism Escherichia coli
total genus 37
structure length 150
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4rhbB00
4KWYA 2N8XA 4Q35B 5IXMB 5IV8B 4RH8A 4RHBB 3BF2A 5TSEA 2JXPA 4N4RB 4NHRA 2R76A
chains in the Genus database with same CATH superfamily
2YU8A 3AUZA 3J80C 4Q35B 2M1SA 2EMCA 2YPNA 4IJDA 2ENCA 3THOB 2DLKA 1PJTA 1A1GA 4MLVA 2EOHA 2B7TA 4DV7E 4BCAA 4R2SA 2LCEA 1PJQA 2DLQA 1YSAC 2R1FA 2V83A 1EKZA 2LJUA 1ZAAC 1YYKA 2YTNA 4JI5E 3VYXA 2FGGA 4NXNE 1WJPA 4B3SE 2EMWA 2FV4B 3JU0A 2EM5A 2CTDA 4JV5E 5T6JA 1AAYA 4BHBA 2LT7A 4JYAE 3MHSC 1KYQA 1UILA 4KHPE 4DR5E 1X49A 4R03A 1XMOE 2DGCA 1T4LB 2DRPA 2EM2A 2EOSA 4DMIA 2EL6A 2RS7A 2EM3A 1KJKA 1TF6A 4YHHE 2B7VA 4GKKE 2ADRA 2YU5A 2GHFA 4K0KE 4F9BB 2EM9A 2MC6A 5KL2A 2E1MA 2JR1A 1IBME 5LMUE 3ADIA 3QG5C 3HTXA 4DV1E 3OTOE 2EPLX 2EPZA 1N32E 2NUEA 4R2EA 5A69A 2R76A 2EN3A 3EPKA 5AC4A 2YTQA 1AH5A 2EM0A 3BF2A 5TSEA 5IWAE 1JK2A 2K4VA 2LVHA 5A6BA 4LFAE 2UXDE 2YTPA 1YPNA 4R2AA 1STUA 2JPAA 2LV2A 3C4TA 1DI2A 2LJHA 4BBYA 2JWOA 1N33E 4ZYHA 4O4KA 2DB2A 4DR1E 5LMNE 4X8WA 4M2ZA 2M9AA 4JI6E 2EPXA 4WXDA 4HTGA 2EMHA 2EOFA 5CFFE 3EQ1A 4JI1E 3VHTB 4DR4E 5DNYA 4B3RE 4JI8E 4KZSA 5ADZA 2M7QA 2EOEA 4LF6E 3AV0A 3KZYA 5FLXC 2WBUA 4M9VC 2F8BA 1L4SA 5AASA 2YWQA 2CPNA 4DKKA 3EPLA 1X47A 2YTIA 4LF8E 1EH7A 2LUPB 2M4IA 1QNTA 2EOQA 3RMPA 3BIDA 1YUJA 1MGTA 2MKNA 5KL6A 4F9CB 4LF4E 2DMYA 4RHBB 1ZU1A 1YYOA 1ZR9A 4R2QA 2UXBE 1PJSA 2RPCA 4ZYDA 3DF6A 1JK1A 2WBSA 2E72A 4BC7A 1X6FA 1NEIA 1YUIA 2WCC3 1GQEA 2L33A 5AC5A 4DV3E 2LTRA 2GLIA 4Q28A 2EMXA 4M30A 1BB8A 2RSMA 2HHHE 2L3CA 1UN6B 2WZOA 4F6MA 2CT1A 3IWBA 1B69A 2YSOA 3C6KA 2FTXB 4KWYA 1O0WA 2NA2A 4B3TE 5IXMB 2Q8UA 3MHHC 2ODRD 2F4VE 1J5EE 2LO3A 2L2KB 2EN7A 2EPAA 3JTZA 3F6GA 2YTFA 2E5LE 2EN1A 2RTXA 3EPHA 2B9DA 4I8OA 2UUAE 2ELZA 1ZBTA 1EH8A 2V85A 2EPRA 1GZ6A 4LF5E 3ADJA 2EL5A 2EQ0A 5LLQA 2L8TA 2V8QB 4WX9A 2EL4A 1PKPA 1WHQA 4JI4E 2KONA 4IS1C 5A6KA 2LUQA 2EWLA 3J7Yp 1WRJA 1A1HA 1G2DC 4TUIA 4X9JA 2RS6A 2UXCE 1HNXE 4B3ME 1FKAE 3H09A 2YRHA 4LTYA 1F2IG 2YTGA 4RH8A 1NCSA 2EZ6A 4J8ZA 1BBGA 4BC9A 4F54A 2I13A 3ECRA 2EM4A 2RSIA 2LE2A 1P47A 5KL5A 2H36X 4WPYA 5AE3A 1PDAA 2EM6A 2N8XA 2EM7A 3K6QA 3JAMC 4DV0E 5LL6R 2JVAA 2EOYA 2N3GA 2D9HA 1RQ0A 1SFEA 5KL7A 2I9IA 2V86A 2EMZA 5A2QC 5KL3A 4OX9E 4DR7E 3J7AG 2EOIA 4NZVA 2V88A 1X5WA 2EN2A 3L00A 1IBLE 2YRMA 2UUBE 4JI3E 3ADLA 4BMJA 1X6EA 2EPMX 1IQOA 1WHNA 5A6BD 4JI7E 2EPPA 4F9AB 1RC7A 3HPZA 2HC5A 4YY3E 4LFCE 2HGHA 1TF3A 4DUYE 1T39A 2LBSB 2EORA 1A1IA 2JOBA 2EPKX 2K7IA 5AE1A 1X3CA 4HEIA 2EPOA 5A6JA 3LMLA 4R2CA 2EE8A 3KWRA 4NHRA 1T4NA 3T1HE 4DV4E 1IMUA 2JP9A 3FIGA 3HXLA 4R2RA 2VQFE 1X6HA 2NUGA 2EM8A 1HR0E 2EMBA 2DIXA 2PRTA 3BGHA 1N34E 2MDGA 3HPSA 4JI0E 2L92A 3F6HA 3IWDA 4WSGA 4X65E 3UK3C 4M0VA 2EN4A 1T4OA 1ZBQA 1N36E 1A1FA 3OMLA 2EOJA 3EPJA 2VF1A 2EMAA 2MDRA 2YSPA 2YT4A 1RMDA 2L2MA 4O43A 3ADGA 2BB8A 3ZOQB 4DR3E 5AE2A 5IT9C 1N3GA 2EQ1A 3M99B 1XNRE 4X66E 4LF7E 4OOGC 5KL4A 2HJJA 2KHXA 2ENHA 1HNWE 1IQSA 1XNQE 2BBGA 2V87A 2ODRC 2YZTA 3VK6A 2GPIA 4LF9E 3C6MA 1Z1BA 3IWCA 1EH6A 2ZM6E 2EMGA 2JOXA 4R8OA 2EPNA 4WSPA 1A1LA 1TN9A 1GTKA 4L8NA 2DSYA 1T38A 2EP3A 3LLHA 1IBKE 1SR9A 3J81C 1DQ3A 2LRSA 2MKDA 2LMZA 4NXME 2L3JA 1DGCA 4JI2E 4LU9A 2EPUA 4LFBE 4P78A 4TUGA 1YYWA 4ZYGA 2JYAA 2NUFA 1FJGE 2LTSA 4DR6E 2DMIA 1A1JA 3KZZA 2EN8A 4WFTA 2J7JA 4R2PA 5BR8E 2EPCA 4GEQB 2YTOA 4DV5E 4O5GA 1UBDC 2YTEA 4BHCA 2EOXA 4AQYE 5IV8B 3T1YE 2ELYA 4O24A 2EQ3A 4L5NC 3C4BA 2N3HA 4WXCA 1BBOA 2L2NA 3HQ1A 1WXRA 2EOZA 2MC5A 3BBGA 4MLQA 2NABA 4F6NA 2EOOA 4FK5C 2VRDA 2EMYA 2VQEE 2YRKA 4DUZE 4DV2E 4X64E 2UU9E 2IHR1 2EMIA 2KOUA 2EMLA 2EMFA 2EMKA 4ZYEA 2JXPA 3TQMA 1YZ9A 3P1XA 4DR2E 2CSHA 1J26A 4GKJE 2JY9A 2B3TB 1XMQE 2A25A 2EOMA 2YTDA 4BS9A 2V89A 3VYYA 1YFHA 2EN6A 5A6AA 2VE7C 3MSWA 4DV6E 5F3WA 1X48A 4F2JC 1HNZE 4N4RB 2RQLA 4R2DA 3DJWA 1QU6A 4P7DA 4GZNC 2ENAA 2G7HA 4X62E 1I94E 2UUCE 1MEYC 2EJ4A 3THNA 2L6MA 2WBTA 1UHZA 1LLMC 1G2FC 2YTJA 4WYQB 1A1KA
chains in the Genus database with same CATH topology
4KWYA 2N8XA 4Q35B 5IXMB 5IV8B 4RH8A 4RHBB 3BF2A 5TSEA 2JXPA 4N4RB 4NHRA 2R76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KWY A;  2N8X A;  4Q35 B;  5IXM B;  5IV8 B;  4RH8 A;  4RHB B;  3BF2 A;  5TSE A;  2JXP A;  4N4R B;  4NHR A;  2R76 A; 
#chains in the Genus database with same CATH topology
 2YU8 A;  3AUZ A;  3J80 C;  4Q35 B;  2M1S A;  2EMC A;  2YPN A;  4IJD A;  2ENC A;  3THO B;  2DLK A;  1PJT A;  1A1G A;  4MLV A;  2EOH A;  2B7T A;  4DV7 E;  4BCA A;  4R2S A;  2LCE A;  1PJQ A;  2DLQ A;  1YSA C;  2R1F A;  2V83 A;  1EKZ A;  2LJU A;  1ZAA C;  1YYK A;  2YTN A;  4JI5 E;  3VYX A;  2FGG A;  4NXN E;  1WJP A;  4B3S E;  2EMW A;  2FV4 B;  3JU0 A;  2EM5 A;  2CTD A;  4JV5 E;  5T6J A;  1AAY A;  4BHB A;  2LT7 A;  4JYA E;  3MHS C;  1KYQ A;  1UIL A;  4KHP E;  4DR5 E;  1X49 A;  4R03 A;  1XMO E;  2DGC A;  1T4L B;  2DRP A;  2EM2 A;  2EOS A;  4DMI A;  2EL6 A;  2RS7 A;  2EM3 A;  1KJK A;  1TF6 A;  4YHH E;  2B7V A;  4GKK E;  2ADR A;  2YU5 A;  2GHF A;  4K0K E;  4F9B B;  2EM9 A;  2MC6 A;  5KL2 A;  2E1M A;  2JR1 A;  1IBM E;  5LMU E;  3ADI A;  3QG5 C;  3HTX A;  4DV1 E;  3OTO E;  2EPL X;  2EPZ A;  1N32 E;  2NUE A;  4R2E A;  5A69 A;  2R76 A;  2EN3 A;  3EPK A;  5AC4 A;  2YTQ A;  1AH5 A;  2EM0 A;  3BF2 A;  5TSE A;  5IWA E;  1JK2 A;  2K4V A;  2LVH A;  5A6B A;  4LFA E;  2UXD E;  2YTP A;  1YPN A;  4R2A A;  1STU A;  2JPA A;  2LV2 A;  3C4T A;  1DI2 A;  2LJH A;  4BBY A;  2JWO A;  1N33 E;  4ZYH A;  4O4K A;  2DB2 A;  4DR1 E;  5LMN E;  4X8W A;  4M2Z A;  2M9A A;  4JI6 E;  2EPX A;  4WXD A;  4HTG A;  2EMH A;  2EOF A;  5CFF E;  3EQ1 A;  4JI1 E;  3VHT B;  4DR4 E;  5DNY A;  4B3R E;  4JI8 E;  4KZS A;  5ADZ A;  2M7Q A;  2EOE A;  4LF6 E;  3AV0 A;  3KZY A;  5FLX C;  2WBU A;  4M9V C;  2F8B A;  1L4S A;  5AAS A;  2YWQ A;  2CPN A;  4DKK A;  3EPL A;  1X47 A;  2YTI A;  4LF8 E;  1EH7 A;  2LUP B;  2M4I A;  1QNT A;  2EOQ A;  3RMP A;  3BID A;  1YUJ A;  1MGT A;  2MKN A;  5KL6 A;  4F9C B;  4LF4 E;  2DMY A;  4RHB B;  1ZU1 A;  1YYO A;  1ZR9 A;  4R2Q A;  2UXB E;  1PJS A;  2RPC A;  4ZYD A;  3DF6 A;  1JK1 A;  2WBS A;  2E72 A;  4BC7 A;  1X6F A;  1NEI A;  1YUI A;  2WCC 3;  1GQE A;  2L33 A;  5AC5 A;  4DV3 E;  2LTR A;  2GLI A;  4Q28 A;  2EMX A;  4M30 A;  1BB8 A;  2RSM A;  2HHH E;  2L3C A;  1UN6 B;  2WZO A;  4F6M A;  2CT1 A;  3IWB A;  1B69 A;  2YSO A;  3C6K A;  2FTX B;  4KWY A;  1O0W A;  2NA2 A;  4B3T E;  5IXM B;  2Q8U A;  3MHH C;  2ODR D;  2F4V E;  1J5E E;  2LO3 A;  2L2K B;  2EN7 A;  2EPA A;  3JTZ A;  3F6G A;  2YTF A;  2E5L E;  2EN1 A;  2RTX A;  3EPH A;  2B9D A;  4I8O A;  2UUA E;  2ELZ A;  1ZBT A;  1EH8 A;  2V85 A;  2EPR A;  1GZ6 A;  4LF5 E;  3ADJ A;  2EL5 A;  2EQ0 A;  5LLQ A;  2L8T A;  2V8Q B;  4WX9 A;  2EL4 A;  1PKP A;  1WHQ A;  4JI4 E;  2KON A;  4IS1 C;  5A6K A;  2LUQ A;  2EWL A;  3J7Y p;  1WRJ A;  1A1H A;  1G2D C;  4TUI A;  4X9J A;  2RS6 A;  2UXC E;  1HNX E;  4B3M E;  1FKA E;  3H09 A;  2YRH A;  4LTY A;  1F2I G;  2YTG A;  4RH8 A;  1NCS A;  2EZ6 A;  4J8Z A;  1BBG A;  4BC9 A;  4F54 A;  2I13 A;  3ECR A;  2EM4 A;  2RSI A;  2LE2 A;  1P47 A;  5KL5 A;  2H36 X;  4WPY A;  5AE3 A;  1PDA A;  2EM6 A;  2N8X A;  2EM7 A;  3K6Q A;  3JAM C;  4DV0 E;  5LL6 R;  2JVA A;  2EOY A;  2N3G A;  2D9H A;  1RQ0 A;  1SFE A;  5KL7 A;  2I9I A;  2V86 A;  2EMZ A;  5A2Q C;  5KL3 A;  4OX9 E;  4DR7 E;  3J7A G;  2EOI A;  4NZV A;  2V88 A;  1X5W A;  2EN2 A;  3L00 A;  1IBL E;  2YRM A;  2UUB E;  4JI3 E;  3ADL A;  4BMJ A;  1X6E A;  2EPM X;  1IQO A;  1WHN A;  5A6B D;  4JI7 E;  2EPP A;  4F9A B;  1RC7 A;  3HPZ A;  2HC5 A;  4YY3 E;  4LFC E;  2HGH A;  1TF3 A;  4DUY E;  1T39 A;  2LBS B;  2EOR A;  1A1I A;  2JOB A;  2EPK X;  2K7I A;  5AE1 A;  1X3C A;  4HEI A;  2EPO A;  5A6J A;  3LML A;  4R2C A;  2EE8 A;  3KWR A;  4NHR A;  1T4N A;  3T1H E;  4DV4 E;  1IMU A;  2JP9 A;  3FIG A;  3HXL A;  4R2R A;  2VQF E;  1X6H A;  2NUG A;  2EM8 A;  1HR0 E;  2EMB A;  2DIX A;  2PRT A;  3BGH A;  1N34 E;  2MDG A;  3HPS A;  4JI0 E;  2L92 A;  3F6H A;  3IWD A;  4WSG A;  4X65 E;  3UK3 C;  4M0V A;  2EN4 A;  1T4O A;  1ZBQ A;  1N36 E;  1A1F A;  3OML A;  2EOJ A;  3EPJ A;  2VF1 A;  2EMA A;  2MDR A;  2YSP A;  2YT4 A;  1RMD A;  2L2M A;  4O43 A;  3ADG A;  2BB8 A;  3ZOQ B;  4DR3 E;  5AE2 A;  5IT9 C;  1N3G A;  2EQ1 A;  3M99 B;  1XNR E;  4X66 E;  4LF7 E;  4OOG C;  5KL4 A;  2HJJ A;  2KHX A;  2ENH A;  1HNW E;  1IQS A;  1XNQ E;  2BBG A;  2V87 A;  2ODR C;  2YZT A;  3VK6 A;  2GPI A;  4LF9 E;  3C6M A;  1Z1B A;  3IWC A;  1EH6 A;  2ZM6 E;  2EMG A;  2JOX A;  4R8O A;  2EPN A;  4WSP A;  1A1L A;  1TN9 A;  1GTK A;  4L8N A;  2DSY A;  1T38 A;  2EP3 A;  3LLH A;  1IBK E;  1SR9 A;  3J81 C;  1DQ3 A;  2LRS A;  2MKD A;  2LMZ A;  4NXM E;  2L3J A;  1DGC A;  4JI2 E;  4LU9 A;  2EPU A;  4LFB E;  4P78 A;  4TUG A;  1YYW A;  4ZYG A;  2JYA A;  2NUF A;  1FJG E;  2LTS A;  4DR6 E;  2DMI A;  1A1J A;  3KZZ A;  2EN8 A;  4WFT A;  2J7J A;  4R2P A;  5BR8 E;  2EPC A;  4GEQ B;  2YTO A;  4DV5 E;  4O5G A;  1UBD C;  2YTE A;  4BHC A;  2EOX A;  4AQY E;  5IV8 B;  3T1Y E;  2ELY A;  4O24 A;  2EQ3 A;  4L5N C;  3C4B A;  2N3H A;  4WXC A;  1BBO A;  2L2N A;  3HQ1 A;  1WXR A;  2EOZ A;  2MC5 A;  3BBG A;  4MLQ A;  2NAB A;  4F6N A;  2EOO A;  4FK5 C;  2VRD A;  2EMY A;  2VQE E;  2YRK A;  4DUZ E;  4DV2 E;  4X64 E;  2UU9 E;  2IHR 1;  2EMI A;  2KOU A;  2EML A;  2EMF A;  2EMK A;  4ZYE A;  2JXP A;  3TQM A;  1YZ9 A;  3P1X A;  4DR2 E;  2CSH A;  1J26 A;  4GKJ E;  2JY9 A;  2B3T B;  1XMQ E;  2A25 A;  2EOM A;  2YTD A;  4BS9 A;  2V89 A;  3VYY A;  1YFH A;  2EN6 A;  5A6A A;  2VE7 C;  3MSW A;  4DV6 E;  5F3W A;  1X48 A;  4F2J C;  1HNZ E;  4N4R B;  2RQL A;  4R2D A;  3DJW A;  1QU6 A;  4P7D A;  4GZN C;  2ENA A;  2G7H A;  4X62 E;  1I94 E;  2UUC E;  1MEY C;  2EJ4 A;  3THN A;  2L6M A;  2WBT A;  1UHZ A;  1LLM C;  1G2F C;  2YTJ A;  4WYQ B;  1A1K A; 
#chains in the Genus database with same CATH homology
 4KWY A;  2N8X A;  4Q35 B;  5IXM B;  5IV8 B;  4RH8 A;  4RHB B;  3BF2 A;  5TSE A;  2JXP A;  4N4R B;  4NHR A;  2R76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...