4RHBB

Crystal structure of the lipopolysaccharide assembly complex lptd-lpte from the escherichia coli outer membrane
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
GWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of lipopolysaccharide insertion into the bacterial outer membrane
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords LPS-assembly protein LptD
total genus 37
structure length 150
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4rhbB00
4NHRA 4RH8A 3BF2A 5TSEA 4RHBB 4Q35B 5IXMB 4N4RB 2R76A 4KWYA 5IV8B 2JXPA 2N8XA
chains in the Genus database with same CATH superfamily
1X47A 2EM9A 2JOXA 2UU9E 3DF6A 2EOSA 4WYQB 2NA2A 2DLQA 3EQ1A 2EOXA 2EJ4A 3ZOQB 4LTYA 3M99B 1EH7A 2EPUA 5A69A 1X6EA 4LF8E 3TQMA 2LTSA 2VQEE 2UUAE 2E72A 1PKPA 2YTIA 2RSMA 4M30A 4DMIA 2EE8A 4ZYGA 2EPAA 4WSGA 4WSPA 2EMYA 3BIDA 2EM7A 1X6HA 2FV4B 2IHR1 1TF3A 2UUBE 4R2EA 5A6AA 1AH5A 2EOQA 1YFHA 3J80C 2RTXA 4JI2E 2HGHA 4JYAE 2EM2A 3HTXA 2L6MA 2YRMA 4LF5E 2F4VE 2J7JA 4LU9A 3MHSC 4HEIA 3C6MA 2EMAA 4BHCA 5LMUE 2EMFA 1IBLE 2EWLA 2KOUA 4MLQA 2B7VA 2WBSA 3L00A 4O4KA 1ZU1A 4OOGC 2MKDA 2EM0A 4GKKE 2MDRA 4JI6E 2UXCE 2YTGA 4R2CA 2EN8A 2I13A 3IWBA 4DV3E 3UK3C 2CT1A 4LF6E 4DR3E 3JU0A 2M7QA 2CTDA 1HR0E 2EPRA 2EZ6A 2L3JA 2WBUA 1NEIA 2FGGA 1N36E 1A1LA 4WXDA 1P47A 1BB8A 4JI4E 2EL5A 5AE3A 2JYAA 4DV6E 4JI5E 2M9AA 1JK1A 1WJPA 4JI3E 3LMLA 1ZR9A 1KJKA 3AUZA 1EKZA 1F2IG 3C4BA 2YPNA 2ENAA 2EMWA 1XMOE 2DRPA 4Q28A 2JXPA 1JK2A 5CFFE 2YTEA 2RS7A 2EM5A 2V86A 2A25A 2WZOA 2EPKX 4DUYE 2EOIA 2YZTA 4NXNE 4DV5E 4WPYA 3OMLA 2YU5A 2EOYA 1BBOA 3K6QA 4BC7A 2EMCA 1L4SA 3J7AG 4O43A 5KL6A 3ADLA 5LLQA 4WFTA 1MGTA 4P78A 1TN9A 4R2QA 1EH6A 3F6HA 1PDAA 2DB2A 2NABA 4DV2E 2LUQA 3EPJA 2CPNA 4AQYE 4DR2E 1J5EE 2EQ0A 2EOMA 4LFBE 2H36X 3KWRA 2EOFA 2LMZA 3F6GA 2EOZA 4DR7E 2EN7A 3ADIA 1PJSA 2YTDA 2Q8UA 2EMIA 3DJWA 4NXME 1SR9A 4LF4E 2NUEA 2EQ1A 1O0WA 2L2NA 2YTJA 2LT7A 4GEQB 2KHXA 2UXBE 4Q35B 1HNXE 4MLVA 5BR8E 2N3GA 2R76A 3BGHA 2EN2A 3KZZA 1LLMC 4LFAE 2JOBA 2LTRA 2EOHA 2JWOA 1IBME 1MEYC 2MDGA 4DR5E 4KHPE 1G2DC 3MHHC 1T4NA 4R2PA 1WRJA 4F2JC 1N34E 2UXDE 4P7DA 4ZYEA 2ELYA 4DV1E 2MKNA 5IXMB 5T6JA 1YYKA 2ENCA 4NZVA 5A6JA 2ADRA 2I9IA 4WX9A 2YT4A 4LF7E 1J26A 2M1SA 2V87A 5IWAE 1T4OA 2HHHE 4R03A 3HPZA 2F8BA 2LUPB 1YYOA 1A1HA 2LO3A 1UBDC 3KZYA 1X3CA 4BBYA 2EOEA 3VYXA 4O24A 2GHFA 4RH8A 1YYWA 2EPZA 2G7HA 4JV5E 3C6KA 4GZNC 1G2FC 2EN1A 3HXLA 2EQ3A 4DUZE 4DV4E 4F9CB 1X48A 2R1FA 4BCAA 4X9JA 2EORA 5IT9C 5KL4A 2EN4A 2EMBA 1N32E 2LE2A 4X62E 2CSHA 4KWYA 4F9AB 2EOOA 3IWCA 4ZYDA 5LMNE 2N8XA 4DV7E 3T1HE 2K4VA 2YWQA 4R8OA 1I94E 5AC4A 5KL5A 2HJJA 5AE2A 4F6MA 1FKAE 2EN3A 4O5GA 2EMXA 4F6NA 4HTGA 2B9DA 2EMHA 2YTFA 2YTPA 5FLXC 5KL7A 2V83A 1XNQE 2EMZA 1XNRE 2EN6A 4ZYHA 3FIGA 2YSPA 1UHZA 1BBGA 4GKJE 2DMIA 5F3WA 2EPCA 2L92A 2DSYA 2YSOA 5TSEA 1UN6B 2YTOA 2VRDA 2RQLA 1EH8A 2V8QB 2HC5A 2LV2A 3EPHA 1WHQA 1A1GA 2YTNA 5A2QC 2EPXA 4YHHE 1ZAAC 2JR1A 1N3GA 2L8TA 2ODRD 4DR4E 2WCC3 1YSAC 4TUIA 3HPSA 3ECRA 1STUA 4R2DA 2RPCA 1T39A 1QU6A 2WBTA 3THNA 2GLIA 3THOB 1NCSA 5AE1A 1X49A 2ODRC 2E5LE 1WXRA 2RS6A 2K7IA 3J7Yp 2EMGA 4BS9A 2LVHA 1UILA 4BHBA 3HQ1A 4F9BB 4BC9A 2VQFE 4X66E 1T4LB 1GZ6A 2LJUA 1B69A 2EOJA 1DI2A 2UUCE 2N3HA 4X64E 1A1JA 2EPMX 4IS1C 4R2RA 5KL3A 2EM3A 1X6FA 3IWDA 3MSWA 1IBKE 2EMKA 1KYQA 2M4IA 4DR1E 1X5WA 2YU8A 2MC6A 2V88A 2LCEA 4DV0E 1IQSA 4F54A 1Z1BA 1PJTA 1TF6A 4K0KE 1WHNA 1RMDA 2V89A 1QNTA 4TUGA 4JI0E 2LRSA 2D9HA 3C4TA 2JVAA 4NHRA 3EPKA 4I8OA 1SFEA 1T38A 2EPOA 5LL6R 2NUGA 2E1MA 4R2AA 1YUJA 2V85A 5ADZA 1GQEA 2L33A 5IV8B 2JY9A 4JI1E 4N4RB 2GPIA 2NUFA 1N33E 5DNYA 2MC5A 2DGCA 1YZ9A 3JAMC 1HNZE 2PRTA 5A6KA 4WXCA 1IQOA 2EM8A 4BMJA 2EM6A 1IMUA 1A1FA 2L3CA 2KONA 2L2KB 4B3ME 2L2MA 2DIXA 3BF2A 5KL2A 2EL4A 1DGCA 4DKKA 3QG5C 2FTXB 4L8NA 4M2ZA 2YTQA 3LLHA 5A6BD 4M0VA 4JI7E 3BBGA 4X65E 3VHTB 3VK6A 2B3TB 2EPNA 2JPAA 1YUIA 1RQ0A 4RHBB 3ADGA 4LF9E 1GTKA 5A6BA 2EP3A 4IJDA 2EPLX 2LBSB 2ELZA 4OX9E 2VF1A 1DQ3A 2BBGA 2LJHA 3JTZA 3VYYA 2YRHA 3ADJA 2ENHA 1XMQE 1AAYA 2EMLA 4LFCE 3AV0A 4YY3E 4R2SA 4B3RE 2EM4A 4KZSA 2YRKA 2DMYA 1FJGE 3P1XA 3T1YE 3OTOE 4B3TE 2RSIA 4B3SE 2B7TA 2JP9A 3EPLA 4M9VC 2ZM6E 1RC7A 2BB8A 1A1KA 4FK5C 3RMPA 4DR6E 5AC5A 4JI8E 1YPNA 2EL6A 2EPPA 2DLKA 4L5NC 3J81C 1A1IA 4J8ZA 5AASA 2VE7C 3H09A 1PJQA 4X8WA 1HNWE 1ZBQA 1ZBTA
chains in the Genus database with same CATH topology
4NHRA 4RH8A 3BF2A 5TSEA 4RHBB 4Q35B 5IXMB 4N4RB 2R76A 4KWYA 5IV8B 2JXPA 2N8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHR A;  4RH8 A;  3BF2 A;  5TSE A;  4RHB B;  4Q35 B;  5IXM B;  4N4R B;  2R76 A;  4KWY A;  5IV8 B;  2JXP A;  2N8X A; 
#chains in the Genus database with same CATH topology
 1X47 A;  2EM9 A;  2JOX A;  2UU9 E;  3DF6 A;  2EOS A;  4WYQ B;  2NA2 A;  2DLQ A;  3EQ1 A;  2EOX A;  2EJ4 A;  3ZOQ B;  4LTY A;  3M99 B;  1EH7 A;  2EPU A;  5A69 A;  1X6E A;  4LF8 E;  3TQM A;  2LTS A;  2VQE E;  2UUA E;  2E72 A;  1PKP A;  2YTI A;  2RSM A;  4M30 A;  4DMI A;  2EE8 A;  4ZYG A;  2EPA A;  4WSG A;  4WSP A;  2EMY A;  3BID A;  2EM7 A;  1X6H A;  2FV4 B;  2IHR 1;  1TF3 A;  2UUB E;  4R2E A;  5A6A A;  1AH5 A;  2EOQ A;  1YFH A;  3J80 C;  2RTX A;  4JI2 E;  2HGH A;  4JYA E;  2EM2 A;  3HTX A;  2L6M A;  2YRM A;  4LF5 E;  2F4V E;  2J7J A;  4LU9 A;  3MHS C;  4HEI A;  3C6M A;  2EMA A;  4BHC A;  5LMU E;  2EMF A;  1IBL E;  2EWL A;  2KOU A;  4MLQ A;  2B7V A;  2WBS A;  3L00 A;  4O4K A;  1ZU1 A;  4OOG C;  2MKD A;  2EM0 A;  4GKK E;  2MDR A;  4JI6 E;  2UXC E;  2YTG A;  4R2C A;  2EN8 A;  2I13 A;  3IWB A;  4DV3 E;  3UK3 C;  2CT1 A;  4LF6 E;  4DR3 E;  3JU0 A;  2M7Q A;  2CTD A;  1HR0 E;  2EPR A;  2EZ6 A;  2L3J A;  2WBU A;  1NEI A;  2FGG A;  1N36 E;  1A1L A;  4WXD A;  1P47 A;  1BB8 A;  4JI4 E;  2EL5 A;  5AE3 A;  2JYA A;  4DV6 E;  4JI5 E;  2M9A A;  1JK1 A;  1WJP A;  4JI3 E;  3LML A;  1ZR9 A;  1KJK A;  3AUZ A;  1EKZ A;  1F2I G;  3C4B A;  2YPN A;  2ENA A;  2EMW A;  1XMO E;  2DRP A;  4Q28 A;  2JXP A;  1JK2 A;  5CFF E;  2YTE A;  2RS7 A;  2EM5 A;  2V86 A;  2A25 A;  2WZO A;  2EPK X;  4DUY E;  2EOI A;  2YZT A;  4NXN E;  4DV5 E;  4WPY A;  3OML A;  2YU5 A;  2EOY A;  1BBO A;  3K6Q A;  4BC7 A;  2EMC A;  1L4S A;  3J7A G;  4O43 A;  5KL6 A;  3ADL A;  5LLQ A;  4WFT A;  1MGT A;  4P78 A;  1TN9 A;  4R2Q A;  1EH6 A;  3F6H A;  1PDA A;  2DB2 A;  2NAB A;  4DV2 E;  2LUQ A;  3EPJ A;  2CPN A;  4AQY E;  4DR2 E;  1J5E E;  2EQ0 A;  2EOM A;  4LFB E;  2H36 X;  3KWR A;  2EOF A;  2LMZ A;  3F6G A;  2EOZ A;  4DR7 E;  2EN7 A;  3ADI A;  1PJS A;  2YTD A;  2Q8U A;  2EMI A;  3DJW A;  4NXM E;  1SR9 A;  4LF4 E;  2NUE A;  2EQ1 A;  1O0W A;  2L2N A;  2YTJ A;  2LT7 A;  4GEQ B;  2KHX A;  2UXB E;  4Q35 B;  1HNX E;  4MLV A;  5BR8 E;  2N3G A;  2R76 A;  3BGH A;  2EN2 A;  3KZZ A;  1LLM C;  4LFA E;  2JOB A;  2LTR A;  2EOH A;  2JWO A;  1IBM E;  1MEY C;  2MDG A;  4DR5 E;  4KHP E;  1G2D C;  3MHH C;  1T4N A;  4R2P A;  1WRJ A;  4F2J C;  1N34 E;  2UXD E;  4P7D A;  4ZYE A;  2ELY A;  4DV1 E;  2MKN A;  5IXM B;  5T6J A;  1YYK A;  2ENC A;  4NZV A;  5A6J A;  2ADR A;  2I9I A;  4WX9 A;  2YT4 A;  4LF7 E;  1J26 A;  2M1S A;  2V87 A;  5IWA E;  1T4O A;  2HHH E;  4R03 A;  3HPZ A;  2F8B A;  2LUP B;  1YYO A;  1A1H A;  2LO3 A;  1UBD C;  3KZY A;  1X3C A;  4BBY A;  2EOE A;  3VYX A;  4O24 A;  2GHF A;  4RH8 A;  1YYW A;  2EPZ A;  2G7H A;  4JV5 E;  3C6K A;  4GZN C;  1G2F C;  2EN1 A;  3HXL A;  2EQ3 A;  4DUZ E;  4DV4 E;  4F9C B;  1X48 A;  2R1F A;  4BCA A;  4X9J A;  2EOR A;  5IT9 C;  5KL4 A;  2EN4 A;  2EMB A;  1N32 E;  2LE2 A;  4X62 E;  2CSH A;  4KWY A;  4F9A B;  2EOO A;  3IWC A;  4ZYD A;  5LMN E;  2N8X A;  4DV7 E;  3T1H E;  2K4V A;  2YWQ A;  4R8O A;  1I94 E;  5AC4 A;  5KL5 A;  2HJJ A;  5AE2 A;  4F6M A;  1FKA E;  2EN3 A;  4O5G A;  2EMX A;  4F6N A;  4HTG A;  2B9D A;  2EMH A;  2YTF A;  2YTP A;  5FLX C;  5KL7 A;  2V83 A;  1XNQ E;  2EMZ A;  1XNR E;  2EN6 A;  4ZYH A;  3FIG A;  2YSP A;  1UHZ A;  1BBG A;  4GKJ E;  2DMI A;  5F3W A;  2EPC A;  2L92 A;  2DSY A;  2YSO A;  5TSE A;  1UN6 B;  2YTO A;  2VRD A;  2RQL A;  1EH8 A;  2V8Q B;  2HC5 A;  2LV2 A;  3EPH A;  1WHQ A;  1A1G A;  2YTN A;  5A2Q C;  2EPX A;  4YHH E;  1ZAA C;  2JR1 A;  1N3G A;  2L8T A;  2ODR D;  4DR4 E;  2WCC 3;  1YSA C;  4TUI A;  3HPS A;  3ECR A;  1STU A;  4R2D A;  2RPC A;  1T39 A;  1QU6 A;  2WBT A;  3THN A;  2GLI A;  3THO B;  1NCS A;  5AE1 A;  1X49 A;  2ODR C;  2E5L E;  1WXR A;  2RS6 A;  2K7I A;  3J7Y p;  2EMG A;  4BS9 A;  2LVH A;  1UIL A;  4BHB A;  3HQ1 A;  4F9B B;  4BC9 A;  2VQF E;  4X66 E;  1T4L B;  1GZ6 A;  2LJU A;  1B69 A;  2EOJ A;  1DI2 A;  2UUC E;  2N3H A;  4X64 E;  1A1J A;  2EPM X;  4IS1 C;  4R2R A;  5KL3 A;  2EM3 A;  1X6F A;  3IWD A;  3MSW A;  1IBK E;  2EMK A;  1KYQ A;  2M4I A;  4DR1 E;  1X5W A;  2YU8 A;  2MC6 A;  2V88 A;  2LCE A;  4DV0 E;  1IQS A;  4F54 A;  1Z1B A;  1PJT A;  1TF6 A;  4K0K E;  1WHN A;  1RMD A;  2V89 A;  1QNT A;  4TUG A;  4JI0 E;  2LRS A;  2D9H A;  3C4T A;  2JVA A;  4NHR A;  3EPK A;  4I8O A;  1SFE A;  1T38 A;  2EPO A;  5LL6 R;  2NUG A;  2E1M A;  4R2A A;  1YUJ A;  2V85 A;  5ADZ A;  1GQE A;  2L33 A;  5IV8 B;  2JY9 A;  4JI1 E;  4N4R B;  2GPI A;  2NUF A;  1N33 E;  5DNY A;  2MC5 A;  2DGC A;  1YZ9 A;  3JAM C;  1HNZ E;  2PRT A;  5A6K A;  4WXC A;  1IQO A;  2EM8 A;  4BMJ A;  2EM6 A;  1IMU A;  1A1F A;  2L3C A;  2KON A;  2L2K B;  4B3M E;  2L2M A;  2DIX A;  3BF2 A;  5KL2 A;  2EL4 A;  1DGC A;  4DKK A;  3QG5 C;  2FTX B;  4L8N A;  4M2Z A;  2YTQ A;  3LLH A;  5A6B D;  4M0V A;  4JI7 E;  3BBG A;  4X65 E;  3VHT B;  3VK6 A;  2B3T B;  2EPN A;  2JPA A;  1YUI A;  1RQ0 A;  4RHB B;  3ADG A;  4LF9 E;  1GTK A;  5A6B A;  2EP3 A;  4IJD A;  2EPL X;  2LBS B;  2ELZ A;  4OX9 E;  2VF1 A;  1DQ3 A;  2BBG A;  2LJH A;  3JTZ A;  3VYY A;  2YRH A;  3ADJ A;  2ENH A;  1XMQ E;  1AAY A;  2EML A;  4LFC E;  3AV0 A;  4YY3 E;  4R2S A;  4B3R E;  2EM4 A;  4KZS A;  2YRK A;  2DMY A;  1FJG E;  3P1X A;  3T1Y E;  3OTO E;  4B3T E;  2RSI A;  4B3S E;  2B7T A;  2JP9 A;  3EPL A;  4M9V C;  2ZM6 E;  1RC7 A;  2BB8 A;  1A1K A;  4FK5 C;  3RMP A;  4DR6 E;  5AC5 A;  4JI8 E;  1YPN A;  2EL6 A;  2EPP A;  2DLK A;  4L5N C;  3J81 C;  1A1I A;  4J8Z A;  5AAS A;  2VE7 C;  3H09 A;  1PJQ A;  4X8W A;  1HNW E;  1ZBQ A;  1ZBT A; 
#chains in the Genus database with same CATH homology
 4NHR A;  4RH8 A;  3BF2 A;  5TSE A;  4RHB B;  4Q35 B;  5IXM B;  4N4R B;  2R76 A;  4KWY A;  5IV8 B;  2JXP A;  2N8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...