5KL3A

Wilms tumor protein (wt1) znf2-4 q369h in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl3A00
2EM3A 3VHTB 2DGCA 1A1FA 1UN6B 3MHHC 2EOOA 2EMCA 2R1FA 5KL6A 2EN4A 2EOJA 4R2RA 4IS1C 1KJKA 1X3CA 2I13A 2EMYA 2YTFA 1LLMC 2YRMA 2EM6A 2YTJA 2EPCA 1BBOA 2EE8A 2WBTA 2EOYA 2EL5A 3M99B 2DRPA 2YRHA 4GZNC 1JK1A 2ELYA 2EN1A 2EPPA 3UK3C 5KL4A 1DGCA 4X9JA 2EM4A 2YTNA 4F6NA 1A1IA 2YTIA 2EQ1A 4R2CA 2EMZA 1A1LA 2JPAA 2EOIA 2EN8A 2EOHA 2A25A 2JP9A 1X6FA 1YUJA 2EJ4A 2CSHA 2LVHA 2DLKA 2EM7A 2J7JA 1YSAC 1TF6A 1YUIA 1F2IG 5KL3A 5KL5A 1X6EA 1X6HA 2YU5A 2EMAA 2BB8A 2EPRA 2EMFA 1AAYA 2EPXA 2EMHA 2EN3A 2EM9A 2NABA 2WCC3 2MDGA 2DLQA 2ENAA 1X5WA 2EMXA 2ADRA 2LCEA 2EN6A 2VRDA 1WJPA 2E72A 1A1JA 3EPHA 2EM8A 2EQ0A 2ELZA 2EMIA 2EOXA 2EOEA 2GHFA 2YTDA 3EPKA 1Z1BA 2YTPA 2CTDA 2EMLA 2YTOA 2EL6A 1UBDC 1A1GA 2PRTA 2EM0A 2YTEA 1TF3A 2EOQA 2EP3A 4R2DA 2ENCA 1ZU1A 2EOZA 2MKNA 4R2QA 3EPJA 4IJDA 2EOFA 1RMDA 2LO3A 2EM5A 2CT1A 1JK2A 1MEYC 2EMGA 1NCSA 2LV2A 2RPCA 2WBSA 2YSOA 1ZR9A 4R2EA 2EMKA 1G2DC 4R2PA 2WBUA 1P47A 1TN9A 2GLIA 4WSGA 2DMIA 2ENHA 2EORA 2YRKA 4F2JC 2YTGA 1ZAAC 4F6MA 2M9AA 2HGHA 2YTQA 1A1HA 2EMBA 2MKDA 2EPUA 2EL4A 2EN7A 4R2AA 2EQ3A 1BB8A 1A1KA 5KL7A 2LT7A 2YSPA 1G2FC 3EPLA 3MHSC 2YU8A 4M9VC 2D9HA 2EOSA 2EOMA 4FK5C 2EPAA 2RSIA 2EPZA 5KL2A 4R2SA 1B69A 2EN2A 2EM2A 2EMWA
chains in the Genus database with same CATH superfamily
2EM3A 4ZYGA 1ZBQA 3BBGA 3C6MA 4AQYE 1UN6B 3MHHC 2EOOA 1UILA 2EMCA 2EPLX 2LJHA 5KL6A 4IS1C 2M7QA 2JWOA 5A6JA 2I13A 3RMPA 1LLMC 3THNA 2UXDE 2NA2A 2EE8A 2VQEE 2N3HA 2WBTA 2EOYA 1WHQA 5IT9C 4R03A 4KHPE 2L2NA 4F54A 4ZYEA 1ZBTA 4GKJE 3UK3C 4WPYA 3ADGA 5KL4A 3BF2A 2L2KB 1T4OA 4BHBA 2EZ6A 4B3RE 4K0KE 2EQ1A 1PKPA 4R2CA 4DR6E 3THOB 4O5GA 2B7TA 3VYYA 2JP9A 4DV1E 2LVHA 1YSAC 4F9CB 4F9AB 4JI3E 3ADJA 4B3TE 3IWCA 4WSPA 3C4BA 2Q8UA 4MLVA 1WXRA 2BB8A 2LTSA 2V85A 4ZYHA 2ZM6E 2EPXA 2EMHA 2NABA 1MGTA 2V86A 3FIGA 2L33A 3JTZA 2ENAA 2EMXA 1X48A 2ADRA 3EPHA 4JI4E 2E72A 3F6HA 2EQ0A 2ELZA 3K6QA 4P7DA 2EOXA 3ECRA 2EMLA 2EL6A 1T4NA 1N3GA 4DV3E 2HC5A 5A6KA 4JI1E 4WYQB 2EOZA 2L3JA 4IJDA 2CT1A 2VE7C 5T6JA 1IQSA 2LE2A 1YYKA 4LFBE 2H36X 1NCSA 2WBSA 2RPCA 3AV0A 4DV0E 2F4VE 4BBYA 1G2DC 5AC4A 3BGHA 2N8XA 4WSGA 4F2JC 2LJUA 2RSMA 2M9AA 1A1HA 2EL4A 2EN7A 4R2AA 1WRJA 1EH6A 2KOUA 2F8BA 5AC5A 2EPNA 3EPLA 3KZYA 4JI0E 2YU8A 2EOSA 1T38A 3T1YE 1YYWA 2EPAA 2KHXA 1B69A 3IWBA 2EN2A 2HHHE 2EMWA 1AH5A 4DV4E 3TQMA 2K4VA 3EQ1A 2JR1A 2YTFA 5AASA 2LTRA 5F3WA 1XMOE 1SFEA 5IWAE 4LF6E 4LFCE 5IXMB 3M99B 5A2QC 2ELYA 2EN1A 3AUZA 4O24A 4X9JA 2YTNA 1DGCA 1QU6A 4DV5E 5TSEA 2EMZA 2JPAA 2EOHA 4JI2E 1X6FA 2M4IA 4Q35B 4X66E 4DR5E 2MC6A 4N4RB 1YUIA 2EPKX 3LMLA 4L5NC 4X8WA 1X6EA 5KL5A 2EPRA 3HPZA 2UUBE 1YYOA 2UUAE 2WCC3 2JOXA 1EKZA 1IMUA 1N34E 4BCAA 4TUIA 4BC7A 2GHFA 2YTDA 1IBME 2V89A 5LL6R 3VK6A 2L3CA 4OX9E 4J8ZA 1TF3A 2EOQA 2L92A 2ENCA 3T1HE 5A6BD 2V83A 4R2QA 3EPJA 2EOFA 1UHZA 4Q28A 2LO3A 1YZ9A 4LF9E 1JK2A 2E1MA 4OOGC 1PJSA 2EWLA 2JYAA 4DUZE 2EMGA 1EH7A 5AE3A 2EPMX 4M30A 1DI2A 2DMIA 2ENHA 2M1SA 2YRKA 3LLHA 2NUGA 4X65E 2HGHA 2MKDA 2EPUA 2VF1A 1BB8A 2EQ3A 3P1XA 5KL7A 2YSPA 1G2FC 3MHSC 3VYXA 4M9VC 2EOMA 4B3SE 2MC5A 3J81C 2E5LE 5KL2A 4R8OA 4LFAE 5AE2A 2EM2A 5ADZA 2DGCA 4WX9A 2EPOA 2R1FA 2K7IA 4R2RA 1N33E 1KJKA 1X3CA 3OMLA 1DQ3A 1XNQE 1YPNA 1L4SA 2YRMA 2EM6A 2YTJA 2B3TB 2EPCA 4NZVA 1BBOA 4JV5E 4X62E 1RQ0A 4DR2E 2YRHA 1JK1A 3J80C 4MLQA 3KWRA 2L2MA 2EM4A 2RS7A 4F6NA 1HNZE 2B7VA 2YTIA 2EN8A 1T39A 2A25A 2JVAA 1YUJA 5AE1A 2DLKA 5A6AA 2J7JA 1TF6A 4NXNE 2CPNA 5KL3A 1YFHA 1X6HA 1X47A 2EMAA 2DB2A 4YHHE 2L8TA 1T4LB 5LMNE 2EMFA 1KYQA 1X49A 3J7AG 1AAYA 2EN3A 3HQ1A 2NUFA 2MDGA 2LCEA 2VRDA 4JYAE 2ODRD 1FJGE 1PJTA 2R76A 3ADIA 2EOEA 3EPKA 4DUYE 2YT4A 2CTDA 2YTOA 1UBDC 3HTXA 1A1GA 2RTXA 2YWQA 2V8QB 2V87A 4LTYA 4DMIA 3BIDA 4DR1E 4KWYA 4BHCA 1GTKA 3F6GA 4R2DA 2MKNA 5FLXC 1GZ6A 1HR0E 1RMDA 2L6MA 2EM5A 4ZYDA 1IBKE 2LV2A 4JI8E 4I8OA 1ZR9A 3J7Yp 1WHNA 2EMKA 1P47A 4HTGA 2GLIA 4JI7E 4LF7E 2EORA 4O4KA 3IWDA 2YTGA 4F6MA 4JI5E 1HNXE 4DR4E 4BMJA 1IQOA 2UU9E 1PDAA 4M0VA 5LMUE 2ODRC 2D9HA 4DV2E 2RQLA 2EPZA 4JI6E 4R2SA 4DR3E 4LF4E 1RC7A 3VHTB 1A1FA 1XMQE 2DSYA 2HJJA 1NEIA 1EH8A 3H09A 2EN4A 2EOJA 2VQFE 4F9BB 2UUCE 2EMYA 1XNRE 3ZOQB 1GQEA 2G7HA 4LF8E 2B9DA 2EL5A 2DRPA 1N32E 4GZNC 2MDRA 2YZTA 2EPPA 4NHRA 1PJQA 2IHR1 4O43A 5DNYA 1A1IA 2UXBE 4GEQB 2WZOA 1A1LA 3C6KA 4LF5E 2EOIA 3HXLA 4RHBB 2N3GA 2JY9A 2EJ4A 2CSHA 3HPSA 4DKKA 2EM7A 4RH8A 2FTXB 3L00A 1F2IG 1I94E 2YU5A 2LUPB 2FV4B 2KONA 3KZZA 1N36E 1BBGA 5CFFE 2LRSA 4KZSA 4B3ME 2JOBA 2EM9A 3MSWA 4WFTA 2UXCE 2DLQA 1X5WA 2BBGA 3JAMC 1A1JA 2EN6A 1WJPA 2EM8A 2GPIA 4BS9A 1J26A 2DIXA 2YPNA 2EMIA 4X64E 1Z1BA 2LBSB 2YTPA 1O0WA 5LLQA 2PRTA 2EM0A 3QG5C 5A69A 2I9IA 2YTEA 1J5EE 2EP3A 1IBLE 3ADLA 1ZU1A 1FKAE 4HEIA 3OTOE 4BC9A 4GKKE 3JU0A 2FGGA 4TUGA 4DR7E 1QNTA 2JXPA 4P78A 4WXDA 4WXCA 2NUEA 3C4TA 1MEYC 2YSOA 4M2ZA 4R2EA 2DMYA 4R2PA 2WBUA 5BR8E 1TN9A 4DV6E 1SR9A 3DJWA 2YTQA 3DF6A 2EMBA 4L8NA 1STUA 4LU9A 4DV7E 1A1KA 2LT7A 1HNWE 5A6BA 2LMZA 2V88A 4YY3E 4FK5C 5IV8B 2LUQA 2RSIA 2RS6A 4NXME 1ZAAC
chains in the Genus database with same CATH topology
2EM3A 3VHTB 2DGCA 1A1FA 1UN6B 3MHHC 2EOOA 2EMCA 2R1FA 5KL6A 2EN4A 2EOJA 4R2RA 4IS1C 1KJKA 1X3CA 2I13A 2EMYA 2YTFA 1LLMC 2YRMA 2EM6A 2YTJA 2EPCA 1BBOA 2EE8A 2WBTA 2EOYA 2EL5A 3M99B 2DRPA 2YRHA 4GZNC 1JK1A 2ELYA 2EN1A 2EPPA 3UK3C 5KL4A 1DGCA 4X9JA 2EM4A 2YTNA 4F6NA 1A1IA 2YTIA 2EQ1A 4R2CA 2EMZA 1A1LA 2JPAA 2EOIA 2EN8A 2EOHA 2A25A 2JP9A 1X6FA 1YUJA 2EJ4A 2CSHA 2LVHA 2DLKA 2EM7A 2J7JA 1YSAC 1TF6A 1YUIA 1F2IG 5KL3A 5KL5A 1X6EA 1X6HA 2YU5A 2EMAA 2BB8A 2EPRA 2EMFA 1AAYA 2EPXA 2EMHA 2EN3A 2EM9A 2NABA 2WCC3 2MDGA 2DLQA 2ENAA 1X5WA 2EMXA 2ADRA 2LCEA 2EN6A 2VRDA 1WJPA 2E72A 1A1JA 3EPHA 2EM8A 2EQ0A 2ELZA 2EMIA 2EOXA 2EOEA 2GHFA 2YTDA 3EPKA 1Z1BA 2YTPA 2CTDA 2EMLA 2YTOA 2EL6A 1UBDC 1A1GA 2PRTA 2EM0A 2YTEA 1TF3A 2EOQA 2EP3A 4R2DA 2ENCA 1ZU1A 2EOZA 2MKNA 4R2QA 3EPJA 4IJDA 2EOFA 1RMDA 2LO3A 2EM5A 2CT1A 1JK2A 1MEYC 2EMGA 1NCSA 2LV2A 2RPCA 2WBSA 2YSOA 1ZR9A 4R2EA 2EMKA 1G2DC 4R2PA 2WBUA 1P47A 1TN9A 2GLIA 4WSGA 2DMIA 2ENHA 2EORA 2YRKA 4F2JC 2YTGA 1ZAAC 4F6MA 2M9AA 2HGHA 2YTQA 1A1HA 2EMBA 2MKDA 2EPUA 2EL4A 2EN7A 4R2AA 2EQ3A 1BB8A 1A1KA 5KL7A 2LT7A 2YSPA 1G2FC 3EPLA 3MHSC 2YU8A 4M9VC 2D9HA 2EOSA 2EOMA 4FK5C 2EPAA 2RSIA 2EPZA 5KL2A 4R2SA 1B69A 2EN2A 2EM2A 2EMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM3 A;  3VHT B;  2DGC A;  1A1F A;  1UN6 B;  3MHH C;  2EOO A;  2EMC A;  2R1F A;  5KL6 A;  2EN4 A;  2EOJ A;  4R2R A;  4IS1 C;  1KJK A;  1X3C A;  2I13 A;  2EMY A;  2YTF A;  1LLM C;  2YRM A;  2EM6 A;  2YTJ A;  2EPC A;  1BBO A;  2EE8 A;  2WBT A;  2EOY A;  2EL5 A;  3M99 B;  2DRP A;  2YRH A;  4GZN C;  1JK1 A;  2ELY A;  2EN1 A;  2EPP A;  3UK3 C;  5KL4 A;  1DGC A;  4X9J A;  2EM4 A;  2YTN A;  4F6N A;  1A1I A;  2YTI A;  2EQ1 A;  4R2C A;  2EMZ A;  1A1L A;  2JPA A;  2EOI A;  2EN8 A;  2EOH A;  2A25 A;  2JP9 A;  1X6F A;  1YUJ A;  2EJ4 A;  2CSH A;  2LVH A;  2DLK A;  2EM7 A;  2J7J A;  1YSA C;  1TF6 A;  1YUI A;  1F2I G;  5KL3 A;  5KL5 A;  1X6E A;  1X6H A;  2YU5 A;  2EMA A;  2BB8 A;  2EPR A;  2EMF A;  1AAY A;  2EPX A;  2EMH A;  2EN3 A;  2EM9 A;  2NAB A;  2WCC 3;  2MDG A;  2DLQ A;  2ENA A;  1X5W A;  2EMX A;  2ADR A;  2LCE A;  2EN6 A;  2VRD A;  1WJP A;  2E72 A;  1A1J A;  3EPH A;  2EM8 A;  2EQ0 A;  2ELZ A;  2EMI A;  2EOX A;  2EOE A;  2GHF A;  2YTD A;  3EPK A;  1Z1B A;  2YTP A;  2CTD A;  2EML A;  2YTO A;  2EL6 A;  1UBD C;  1A1G A;  2PRT A;  2EM0 A;  2YTE A;  1TF3 A;  2EOQ A;  2EP3 A;  4R2D A;  2ENC A;  1ZU1 A;  2EOZ A;  2MKN A;  4R2Q A;  3EPJ A;  4IJD A;  2EOF A;  1RMD A;  2LO3 A;  2EM5 A;  2CT1 A;  1JK2 A;  1MEY C;  2EMG A;  1NCS A;  2LV2 A;  2RPC A;  2WBS A;  2YSO A;  1ZR9 A;  4R2E A;  2EMK A;  1G2D C;  4R2P A;  2WBU A;  1P47 A;  1TN9 A;  2GLI A;  4WSG A;  2DMI A;  2ENH A;  2EOR A;  2YRK A;  4F2J C;  2YTG A;  1ZAA C;  4F6M A;  2M9A A;  2HGH A;  2YTQ A;  1A1H A;  2EMB A;  2MKD A;  2EPU A;  2EL4 A;  2EN7 A;  4R2A A;  2EQ3 A;  1BB8 A;  1A1K A;  5KL7 A;  2LT7 A;  2YSP A;  1G2F C;  3EPL A;  3MHS C;  2YU8 A;  4M9V C;  2D9H A;  2EOS A;  2EOM A;  4FK5 C;  2EPA A;  2RSI A;  2EPZ A;  5KL2 A;  4R2S A;  1B69 A;  2EN2 A;  2EM2 A;  2EMW A; 
#chains in the Genus database with same CATH topology
 2EM3 A;  4ZYG A;  1ZBQ A;  3BBG A;  3C6M A;  4AQY E;  1UN6 B;  3MHH C;  2EOO A;  1UIL A;  2EMC A;  2EPL X;  2LJH A;  5KL6 A;  4IS1 C;  2M7Q A;  2JWO A;  5A6J A;  2I13 A;  3RMP A;  1LLM C;  3THN A;  2UXD E;  2NA2 A;  2EE8 A;  2VQE E;  2N3H A;  2WBT A;  2EOY A;  1WHQ A;  5IT9 C;  4R03 A;  4KHP E;  2L2N A;  4F54 A;  4ZYE A;  1ZBT A;  4GKJ E;  3UK3 C;  4WPY A;  3ADG A;  5KL4 A;  3BF2 A;  2L2K B;  1T4O A;  4BHB A;  2EZ6 A;  4B3R E;  4K0K E;  2EQ1 A;  1PKP A;  4R2C A;  4DR6 E;  3THO B;  4O5G A;  2B7T A;  3VYY A;  2JP9 A;  4DV1 E;  2LVH A;  1YSA C;  4F9C B;  4F9A B;  4JI3 E;  3ADJ A;  4B3T E;  3IWC A;  4WSP A;  3C4B A;  2Q8U A;  4MLV A;  1WXR A;  2BB8 A;  2LTS A;  2V85 A;  4ZYH A;  2ZM6 E;  2EPX A;  2EMH A;  2NAB A;  1MGT A;  2V86 A;  3FIG A;  2L33 A;  3JTZ A;  2ENA A;  2EMX A;  1X48 A;  2ADR A;  3EPH A;  4JI4 E;  2E72 A;  3F6H A;  2EQ0 A;  2ELZ A;  3K6Q A;  4P7D A;  2EOX A;  3ECR A;  2EML A;  2EL6 A;  1T4N A;  1N3G A;  4DV3 E;  2HC5 A;  5A6K A;  4JI1 E;  4WYQ B;  2EOZ A;  2L3J A;  4IJD A;  2CT1 A;  2VE7 C;  5T6J A;  1IQS A;  2LE2 A;  1YYK A;  4LFB E;  2H36 X;  1NCS A;  2WBS A;  2RPC A;  3AV0 A;  4DV0 E;  2F4V E;  4BBY A;  1G2D C;  5AC4 A;  3BGH A;  2N8X A;  4WSG A;  4F2J C;  2LJU A;  2RSM A;  2M9A A;  1A1H A;  2EL4 A;  2EN7 A;  4R2A A;  1WRJ A;  1EH6 A;  2KOU A;  2F8B A;  5AC5 A;  2EPN A;  3EPL A;  3KZY A;  4JI0 E;  2YU8 A;  2EOS A;  1T38 A;  3T1Y E;  1YYW A;  2EPA A;  2KHX A;  1B69 A;  3IWB A;  2EN2 A;  2HHH E;  2EMW A;  1AH5 A;  4DV4 E;  3TQM A;  2K4V A;  3EQ1 A;  2JR1 A;  2YTF A;  5AAS A;  2LTR A;  5F3W A;  1XMO E;  1SFE A;  5IWA E;  4LF6 E;  4LFC E;  5IXM B;  3M99 B;  5A2Q C;  2ELY A;  2EN1 A;  3AUZ A;  4O24 A;  4X9J A;  2YTN A;  1DGC A;  1QU6 A;  4DV5 E;  5TSE A;  2EMZ A;  2JPA A;  2EOH A;  4JI2 E;  1X6F A;  2M4I A;  4Q35 B;  4X66 E;  4DR5 E;  2MC6 A;  4N4R B;  1YUI A;  2EPK X;  3LML A;  4L5N C;  4X8W A;  1X6E A;  5KL5 A;  2EPR A;  3HPZ A;  2UUB E;  1YYO A;  2UUA E;  2WCC 3;  2JOX A;  1EKZ A;  1IMU A;  1N34 E;  4BCA A;  4TUI A;  4BC7 A;  2GHF A;  2YTD A;  1IBM E;  2V89 A;  5LL6 R;  3VK6 A;  2L3C A;  4OX9 E;  4J8Z A;  1TF3 A;  2EOQ A;  2L92 A;  2ENC A;  3T1H E;  5A6B D;  2V83 A;  4R2Q A;  3EPJ A;  2EOF A;  1UHZ A;  4Q28 A;  2LO3 A;  1YZ9 A;  4LF9 E;  1JK2 A;  2E1M A;  4OOG C;  1PJS A;  2EWL A;  2JYA A;  4DUZ E;  2EMG A;  1EH7 A;  5AE3 A;  2EPM X;  4M30 A;  1DI2 A;  2DMI A;  2ENH A;  2M1S A;  2YRK A;  3LLH A;  2NUG A;  4X65 E;  2HGH A;  2MKD A;  2EPU A;  2VF1 A;  1BB8 A;  2EQ3 A;  3P1X A;  5KL7 A;  2YSP A;  1G2F C;  3MHS C;  3VYX A;  4M9V C;  2EOM A;  4B3S E;  2MC5 A;  3J81 C;  2E5L E;  5KL2 A;  4R8O A;  4LFA E;  5AE2 A;  2EM2 A;  5ADZ A;  2DGC A;  4WX9 A;  2EPO A;  2R1F A;  2K7I A;  4R2R A;  1N33 E;  1KJK A;  1X3C A;  3OML A;  1DQ3 A;  1XNQ E;  1YPN A;  1L4S A;  2YRM A;  2EM6 A;  2YTJ A;  2B3T B;  2EPC A;  4NZV A;  1BBO A;  4JV5 E;  4X62 E;  1RQ0 A;  4DR2 E;  2YRH A;  1JK1 A;  3J80 C;  4MLQ A;  3KWR A;  2L2M A;  2EM4 A;  2RS7 A;  4F6N A;  1HNZ E;  2B7V A;  2YTI A;  2EN8 A;  1T39 A;  2A25 A;  2JVA A;  1YUJ A;  5AE1 A;  2DLK A;  5A6A A;  2J7J A;  1TF6 A;  4NXN E;  2CPN A;  5KL3 A;  1YFH A;  1X6H A;  1X47 A;  2EMA A;  2DB2 A;  4YHH E;  2L8T A;  1T4L B;  5LMN E;  2EMF A;  1KYQ A;  1X49 A;  3J7A G;  1AAY A;  2EN3 A;  3HQ1 A;  2NUF A;  2MDG A;  2LCE A;  2VRD A;  4JYA E;  2ODR D;  1FJG E;  1PJT A;  2R76 A;  3ADI A;  2EOE A;  3EPK A;  4DUY E;  2YT4 A;  2CTD A;  2YTO A;  1UBD C;  3HTX A;  1A1G A;  2RTX A;  2YWQ A;  2V8Q B;  2V87 A;  4LTY A;  4DMI A;  3BID A;  4DR1 E;  4KWY A;  4BHC A;  1GTK A;  3F6G A;  4R2D A;  2MKN A;  5FLX C;  1GZ6 A;  1HR0 E;  1RMD A;  2L6M A;  2EM5 A;  4ZYD A;  1IBK E;  2LV2 A;  4JI8 E;  4I8O A;  1ZR9 A;  3J7Y p;  1WHN A;  2EMK A;  1P47 A;  4HTG A;  2GLI A;  4JI7 E;  4LF7 E;  2EOR A;  4O4K A;  3IWD A;  2YTG A;  4F6M A;  4JI5 E;  1HNX E;  4DR4 E;  4BMJ A;  1IQO A;  2UU9 E;  1PDA A;  4M0V A;  5LMU E;  2ODR C;  2D9H A;  4DV2 E;  2RQL A;  2EPZ A;  4JI6 E;  4R2S A;  4DR3 E;  4LF4 E;  1RC7 A;  3VHT B;  1A1F A;  1XMQ E;  2DSY A;  2HJJ A;  1NEI A;  1EH8 A;  3H09 A;  2EN4 A;  2EOJ A;  2VQF E;  4F9B B;  2UUC E;  2EMY A;  1XNR E;  3ZOQ B;  1GQE A;  2G7H A;  4LF8 E;  2B9D A;  2EL5 A;  2DRP A;  1N32 E;  4GZN C;  2MDR A;  2YZT A;  2EPP A;  4NHR A;  1PJQ A;  2IHR 1;  4O43 A;  5DNY A;  1A1I A;  2UXB E;  4GEQ B;  2WZO A;  1A1L A;  3C6K A;  4LF5 E;  2EOI A;  3HXL A;  4RHB B;  2N3G A;  2JY9 A;  2EJ4 A;  2CSH A;  3HPS A;  4DKK A;  2EM7 A;  4RH8 A;  2FTX B;  3L00 A;  1F2I G;  1I94 E;  2YU5 A;  2LUP B;  2FV4 B;  2KON A;  3KZZ A;  1N36 E;  1BBG A;  5CFF E;  2LRS A;  4KZS A;  4B3M E;  2JOB A;  2EM9 A;  3MSW A;  4WFT A;  2UXC E;  2DLQ A;  1X5W A;  2BBG A;  3JAM C;  1A1J A;  2EN6 A;  1WJP A;  2EM8 A;  2GPI A;  4BS9 A;  1J26 A;  2DIX A;  2YPN A;  2EMI A;  4X64 E;  1Z1B A;  2LBS B;  2YTP A;  1O0W A;  5LLQ A;  2PRT A;  2EM0 A;  3QG5 C;  5A69 A;  2I9I A;  2YTE A;  1J5E E;  2EP3 A;  1IBL E;  3ADL A;  1ZU1 A;  1FKA E;  4HEI A;  3OTO E;  4BC9 A;  4GKK E;  3JU0 A;  2FGG A;  4TUG A;  4DR7 E;  1QNT A;  2JXP A;  4P78 A;  4WXD A;  4WXC A;  2NUE A;  3C4T A;  1MEY C;  2YSO A;  4M2Z A;  4R2E A;  2DMY A;  4R2P A;  2WBU A;  5BR8 E;  1TN9 A;  4DV6 E;  1SR9 A;  3DJW A;  2YTQ A;  3DF6 A;  2EMB A;  4L8N A;  1STU A;  4LU9 A;  4DV7 E;  1A1K A;  2LT7 A;  1HNW E;  5A6B A;  2LMZ A;  2V88 A;  4YY3 E;  4FK5 C;  5IV8 B;  2LUQ A;  2RSI A;  2RS6 A;  4NXM E;  1ZAA C; 
#chains in the Genus database with same CATH homology
 2EM3 A;  3VHT B;  2DGC A;  1A1F A;  1UN6 B;  3MHH C;  2EOO A;  2EMC A;  2R1F A;  5KL6 A;  2EN4 A;  2EOJ A;  4R2R A;  4IS1 C;  1KJK A;  1X3C A;  2I13 A;  2EMY A;  2YTF A;  1LLM C;  2YRM A;  2EM6 A;  2YTJ A;  2EPC A;  1BBO A;  2EE8 A;  2WBT A;  2EOY A;  2EL5 A;  3M99 B;  2DRP A;  2YRH A;  4GZN C;  1JK1 A;  2ELY A;  2EN1 A;  2EPP A;  3UK3 C;  5KL4 A;  1DGC A;  4X9J A;  2EM4 A;  2YTN A;  4F6N A;  1A1I A;  2YTI A;  2EQ1 A;  4R2C A;  2EMZ A;  1A1L A;  2JPA A;  2EOI A;  2EN8 A;  2EOH A;  2A25 A;  2JP9 A;  1X6F A;  1YUJ A;  2EJ4 A;  2CSH A;  2LVH A;  2DLK A;  2EM7 A;  2J7J A;  1YSA C;  1TF6 A;  1YUI A;  1F2I G;  5KL3 A;  5KL5 A;  1X6E A;  1X6H A;  2YU5 A;  2EMA A;  2BB8 A;  2EPR A;  2EMF A;  1AAY A;  2EPX A;  2EMH A;  2EN3 A;  2EM9 A;  2NAB A;  2WCC 3;  2MDG A;  2DLQ A;  2ENA A;  1X5W A;  2EMX A;  2ADR A;  2LCE A;  2EN6 A;  2VRD A;  1WJP A;  2E72 A;  1A1J A;  3EPH A;  2EM8 A;  2EQ0 A;  2ELZ A;  2EMI A;  2EOX A;  2EOE A;  2GHF A;  2YTD A;  3EPK A;  1Z1B A;  2YTP A;  2CTD A;  2EML A;  2YTO A;  2EL6 A;  1UBD C;  1A1G A;  2PRT A;  2EM0 A;  2YTE A;  1TF3 A;  2EOQ A;  2EP3 A;  4R2D A;  2ENC A;  1ZU1 A;  2EOZ A;  2MKN A;  4R2Q A;  3EPJ A;  4IJD A;  2EOF A;  1RMD A;  2LO3 A;  2EM5 A;  2CT1 A;  1JK2 A;  1MEY C;  2EMG A;  1NCS A;  2LV2 A;  2RPC A;  2WBS A;  2YSO A;  1ZR9 A;  4R2E A;  2EMK A;  1G2D C;  4R2P A;  2WBU A;  1P47 A;  1TN9 A;  2GLI A;  4WSG A;  2DMI A;  2ENH A;  2EOR A;  2YRK A;  4F2J C;  2YTG A;  1ZAA C;  4F6M A;  2M9A A;  2HGH A;  2YTQ A;  1A1H A;  2EMB A;  2MKD A;  2EPU A;  2EL4 A;  2EN7 A;  4R2A A;  2EQ3 A;  1BB8 A;  1A1K A;  5KL7 A;  2LT7 A;  2YSP A;  1G2F C;  3EPL A;  3MHS C;  2YU8 A;  4M9V C;  2D9H A;  2EOS A;  2EOM A;  4FK5 C;  2EPA A;  2RSI A;  2EPZ A;  5KL2 A;  4R2S A;  1B69 A;  2EN2 A;  2EM2 A;  2EMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...