5KL3A

Wilms tumor protein (wt1) znf2-4 q369h in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
b'KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl3A00
1ZU1A 2R1FA 2EMIA 1G2DC 3EPKA 3EPJA 2EM7A 2WBUA 1TF6A 2EMKA 2JP9A 2EOHA 4R2EA 2WBSA 2LO3A 2J7JA 2WBTA 1LLMC 2EMLA 5KL3A 4R2PA 2LV2A 1NCSA 2CTDA 2MKDA 1JK2A 1YUJA 2YRMA 2LVHA 1UBDC 2EM9A 3EPHA 1X3CA 2EPAA 1A1LA 2EMXA 2EOZA 2DRPA 2YTJA 1X6HA 1BB8A 1UN6B 2EOMA 2EE8A 2YTPA 2EN8A 2YTIA 4R2AA 2EP3A 2EL6A 2EN1A 3MHSC 1Z1BA 1P47A 2YSPA 2YRHA 1RMDA 1X6EA 1TN9A 1X5WA 4R2RA 2YTOA 2ENHA 1YSAC 2CSHA 2ELZA 4X9JA 4F6MA 2ENAA 4R2DA 2EOYA 2YTQA 1A1GA 1A1IA 2DLKA 1ZAAC 2EMFA 2EN3A 2EMWA 2EQ1A 5KL6A 1JK1A 2EM3A 2HGHA 2YSOA 1TF3A 2EM4A 2EPXA 2BB8A 2EORA 5KL7A 2YTEA 2EMZA 2EMCA 2EMGA 2EM0A 1BBOA 2VRDA 2WCC3 2ADRA 2NABA 2LCEA 1G2FC 1A1HA 2ENCA 3M99B 1B69A 2MKNA 5KL5A 4IS1C 2YTDA 1WJPA 2EPCA 2M9AA 4R2CA 3UK3C 4R2SA 2EOFA 1F2IG 4R2QA 2EMAA 2EPUA 2A25A 2EL4A 2EQ0A 2YTGA 2GLIA 5KL2A 2RPCA 2EM2A 2DMIA 2EOXA 1YUIA 2EOSA 2EN4A 1AAYA 2PRTA 2LT7A 2YU8A 2EPPA 3EPLA 2EMYA 1X6FA 2RSIA 4F6NA 2EOJA 4FK5C 2YRKA 2E72A 2I13A 1ZR9A 2EOEA 4F2JC 2EOQA 2EM5A 4WSGA 1A1KA 2JPAA 2EM6A 2ELYA 2YTFA 5KL4A 2EMBA 2EJ4A 4M9VC 2DGCA 2EN2A 1A1JA 4IJDA 2EOOA 2YTNA 3MHHC 1DGCA 4GZNC 2D9HA 2CT1A 2MDGA 2EPZA 2EM8A 2DLQA 2YU5A 2EPRA 2GHFA 2EMHA 1KJKA 2EL5A 2EN7A 1A1FA 2EQ3A 3VHTB 1MEYC 2EN6A 2EOIA
chains in the Genus database with same CATH superfamily
2EPMX 4DUZE 1YYKA 1UHZA 5T6JA 4BMJA 4Q35B 1T4OA 4LF7E 1N3GA 2EM7A 3KZZA 2MC5A 2EMKA 3VYYA 2B7TA 5AE3A 5CFFE 2RS6A 4NXME 2LO3A 2J7JA 2YT4A 1LLMC 2KONA 5KL3A 1XNRE 4DKKA 4YHHE 4ZYEA 2YRMA 5AC5A 2LVHA 1PJSA 4DV3E 4ZYHA 3EPHA 4K0KE 1X3CA 2UU9E 2FTXB 3J80C 2EOZA 4WFTA 1BB8A 1ZBTA 4X8WA 2EN8A 2YTIA 1IBLE 2EL6A 2EN1A 4JV5E 5A6KA 1RMDA 1X6EA 1TN9A 1J5EE 2JR1A 4X9JA 2ELZA 4R2DA 1A1GA 4JYAE 4R8OA 5KL6A 2EM4A 3J81C 3J7Yp 4WXCA 1DI2A 5KL7A 3F6GA 1FKAE 4JI0E 5LMUE 2GPIA 2L2NA 4L5NC 1SFEA 5AE1A 2L33A 2LCEA 1G2FC 2ENCA 3M99B 4DR5E 1WJPA 2EPCA 1AH5A 2M7QA 3UK3C 1N36E 2Q8UA 1F2IG 4GKKE 3IWDA 4KZSA 3ZOQB 4R2QA 2EL4A 2GLIA 4LF9E 2B3TB 1XMQE 2RPCA 2ODRD 1X49A 2BBGA 2EN4A 5IV8B 2PRTA 4ZYDA 4LF5E 5LMNE 1GZ6A 1YYOA 1IBME 2RSIA 3L00A 2VE7C 3HXLA 5LL6R 2DSYA 4NXNE 4F2JC 3OMLA 2V88A 1A1KA 2JPAA 2YTFA 2N3GA 2EPNA 2NUEA 5A2QC 2DMYA 2EN2A 4DUYE 4DV4E 1YZ9A 1YPNA 1FJGE 2L2MA 4DMIA 4DR7E 2L3JA 2GHFA 2EMHA 4LFBE 1A1FA 2EQ3A 3VHTB 1BBGA 1MEYC 1HNWE 1PJQA 4BC7A 2EN6A 2I9IA 1WRJA 3IWCA 2EOIA 1ZU1A 2R1FA 2HJJA 2LMZA 1G2DC 3EPKA 1RQ0A 4LFAE 2WBUA 4F9AB 4X62E 3HQ1A 4L8NA 1UILA 5F3WA 4Q28A 2HHHE 2KHXA 2EPLX 2B9DA 3HPZA 2EM9A 2FGGA 3DJWA 5LLQA 1XMOE 2UUCE 3K6QA 2EMXA 4WXDA 2DRPA 2VQEE 2LJUA 3ADJA 4DV5E 4B3SE 1UN6B 2YTPA 4JI8E 1T4NA 4R2AA 4WSPA 1Z1BA 1P47A 4X66E 3VYXA 3EQ1A 2LJHA 2NA2A 1X5WA 1SR9A 2YTOA 2ENHA 1WHQA 2N8XA 2LE2A 2KOUA 2LUPB 2ENAA 2JXPA 1A1IA 1ZAAC 2EMFA 2EN3A 2EMWA 1JK1A 2EM3A 4O5GA 1TF3A 2EPXA 4WX9A 1IMUA 5IWAE 2EMZA 3MSWA 5DNYA 2EMCA 4X64E 1BBOA 2B7VA 1WXRA 3FIGA 3KWRA 3THNA 3VK6A 3BBGA 5KL5A 2FV4B 3H09A 2M9AA 1GTKA 4R2CA 4R2SA 2EOFA 1YFHA 5IT9C 4M2ZA 2EMAA 2YWQA 2EQ0A 2MDRA 5KL2A 2DMIA 2EOXA 2JOXA 4MLVA 1EH7A 3OTOE 4DR2E 1L4SA 5IXMB 4F6NA 4DV0E 2EOJA 4B3ME 2CPNA 2RSMA 2YRKA 2JWOA 1ZR9A 4B3RE 4WSGA 2ELYA 5KL4A 4N4RB 4JI2E 2DGCA 1QU6A 2EOOA 4DR6E 2YTNA 3MHHC 4GZNC 2V89A 2MDGA 1T38A 2M4IA 4F9BB 2EPRA 1DQ3A 1IBKE 1KJKA 2EL5A 2EN7A 1WHNA 4HTGA 2MC6A 5BR8E 2YZTA 3T1HE 2M1SA 3BGHA 2LUQA 4BHBA 3RMPA 2NUGA 1TF6A 3BIDA 2JP9A 1QNTA 3TQMA 2WBSA 3F6HA 2WBTA 4DV2E 5A6AA 2RQLA 4JI4E 4R2PA 2MKDA 1NEIA 2G7HA 1YUJA 1UBDC 2ODRC 5AE2A 5AASA 2EPAA 1A1LA 2L3CA 2VF1A 3T1YE 1STUA 4O24A 2EOMA 2EE8A 4P7DA 4DV1E 4X65E 2EP3A 2F8BA 3MHSC 2YRHA 5ADZA 2EZ6A 4R2RA 1X48A 2CSHA 4F6MA 1J26A 4WPYA 1I94E 2DLKA 2DB2A 2EQ1A 2HGHA 4P78A 1N34E 2BB8A 1RC7A 2YTEA 4LF8E 1N33E 4BC9A 2EM0A 4M0VA 3THOB 2V83A 2ADRA 3AV0A 4KWYA 2R76A 3C6MA 2L2KB 2YTDA 2UUAE 3KZYA 3HTXA 2A25A 2YTGA 2DIXA 2VQFE 3ADIA 1YUIA 2EOSA 2ZM6E 2LBSB 2H36X 2LT7A 1T4LB 2YU8A 2E5LE 4KHPE 2EPPA 4LU9A 3EPLA 2EWLA 1O0WA 4GKJE 4FK5C 2E72A 2I13A 4BHCA 2EOQA 2EM5A 2EM6A 2EJ4A 4DV6E 1XNQE 4M9VC 1IQOA 5A6BA 4DR4E 4IJDA 1DGCA 4F9CB 4BBYA 2UXDE 1X47A 2CT1A 2IHR1 4RH8A 2EM8A 3JU0A 2YU5A 1HR0E 4I8OA 1KYQA 2N3HA 2UUBE 2E1MA 3C4BA 2EMIA 2YPNA 4AQYE 2V8QB 3EPJA 1EH8A 1PKPA 2LRSA 2JVAA 2EOHA 4R03A 3JTZA 4R2EA 5A6JA 2WZOA 2L8TA 4M30A 1ZBQA 2EMLA 2UXBE 2F4VE 2LV2A 4ZYGA 1NCSA 2CTDA 4OOGC 1MGTA 1JK2A 4LTYA 1GQEA 1PDAA 2NUFA 2YTJA 2EPKX 5AC4A 1X6HA 4LF4E 4BS9A 3C4TA 4J8ZA 1T39A 2YSPA 4JI6E 1PJTA 2K7IA 3ECRA 1YSAC 2EOYA 2JOBA 2YTQA 3ADGA 2LTSA 3BF2A 4GEQB 1HNZE 4LFCE 4NZVA 2YSOA 4YY3E 2EORA 3AUZA 3HPSA 2EMGA 2VRDA 1HNXE 2WCC3 2NABA 2RTXA 4TUGA 4TUIA 2V85A 1B69A 3QG5C 1A1HA 2MKNA 2K4VA 4IS1C 2RS7A 4B3TE 3JAMC 5A69A 4DV7E 4NHRA 2JYAA 4DR3E 1N32E 4JI7E 4O4KA 4DR1E 2EPUA 3IWBA 4MLQA 3LMLA 1EKZA 2LTRA 2EM2A 2L6MA 4O43A 4RHBB 1AAYA 2UXCE 4JI3E 4HEIA 4OX9E 2EMYA 1X6FA 1YYWA 4F54A 2EOEA 2JY9A 1EH6A 5TSEA 2EPOA 2EMBA 4BCAA 3ADLA 2HC5A 1IQSA 1A1JA 2V87A 3C6KA 2D9HA 4JI1E 2EPZA 2L92A 5A6BD 2DLQA 2V86A 4WYQB 4LF6E 5FLXC 4JI5E 3LLHA 3J7AG 3DF6A 3P1XA
chains in the Genus database with same CATH topology
1ZU1A 2R1FA 2EMIA 1G2DC 3EPKA 3EPJA 2EM7A 2WBUA 1TF6A 2EMKA 2JP9A 2EOHA 4R2EA 2WBSA 2LO3A 2J7JA 2WBTA 1LLMC 2EMLA 5KL3A 4R2PA 2LV2A 1NCSA 2CTDA 2MKDA 1JK2A 1YUJA 2YRMA 2LVHA 1UBDC 2EM9A 3EPHA 1X3CA 2EPAA 1A1LA 2EMXA 2EOZA 2DRPA 2YTJA 1X6HA 1BB8A 1UN6B 2EOMA 2EE8A 2YTPA 2EN8A 2YTIA 4R2AA 2EP3A 2EL6A 2EN1A 3MHSC 1Z1BA 1P47A 2YSPA 2YRHA 1RMDA 1X6EA 1TN9A 1X5WA 4R2RA 2YTOA 2ENHA 1YSAC 2CSHA 2ELZA 4X9JA 4F6MA 2ENAA 4R2DA 2EOYA 2YTQA 1A1GA 1A1IA 2DLKA 1ZAAC 2EMFA 2EN3A 2EMWA 2EQ1A 5KL6A 1JK1A 2EM3A 2HGHA 2YSOA 1TF3A 2EM4A 2EPXA 2BB8A 2EORA 5KL7A 2YTEA 2EMZA 2EMCA 2EMGA 2EM0A 1BBOA 2VRDA 2WCC3 2ADRA 2NABA 2LCEA 1G2FC 1A1HA 2ENCA 3M99B 1B69A 2MKNA 5KL5A 4IS1C 2YTDA 1WJPA 2EPCA 2M9AA 4R2CA 3UK3C 4R2SA 2EOFA 1F2IG 4R2QA 2EMAA 2EPUA 2A25A 2EL4A 2EQ0A 2YTGA 2GLIA 5KL2A 2RPCA 2EM2A 2DMIA 2EOXA 1YUIA 2EOSA 2EN4A 1AAYA 2PRTA 2LT7A 2YU8A 2EPPA 3EPLA 2EMYA 1X6FA 2RSIA 4F6NA 2EOJA 4FK5C 2YRKA 2E72A 2I13A 1ZR9A 2EOEA 4F2JC 2EOQA 2EM5A 4WSGA 1A1KA 2JPAA 2EM6A 2ELYA 2YTFA 5KL4A 2EMBA 2EJ4A 4M9VC 2DGCA 2EN2A 1A1JA 4IJDA 2EOOA 2YTNA 3MHHC 1DGCA 4GZNC 2D9HA 2CT1A 2MDGA 2EPZA 2EM8A 2DLQA 2YU5A 2EPRA 2GHFA 2EMHA 1KJKA 2EL5A 2EN7A 1A1FA 2EQ3A 3VHTB 1MEYC 2EN6A 2EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU1 A;  2R1F A;  2EMI A;  1G2D C;  3EPK A;  3EPJ A;  2EM7 A;  2WBU A;  1TF6 A;  2EMK A;  2JP9 A;  2EOH A;  4R2E A;  2WBS A;  2LO3 A;  2J7J A;  2WBT A;  1LLM C;  2EML A;  5KL3 A;  4R2P A;  2LV2 A;  1NCS A;  2CTD A;  2MKD A;  1JK2 A;  1YUJ A;  2YRM A;  2LVH A;  1UBD C;  2EM9 A;  3EPH A;  1X3C A;  2EPA A;  1A1L A;  2EMX A;  2EOZ A;  2DRP A;  2YTJ A;  1X6H A;  1BB8 A;  1UN6 B;  2EOM A;  2EE8 A;  2YTP A;  2EN8 A;  2YTI A;  4R2A A;  2EP3 A;  2EL6 A;  2EN1 A;  3MHS C;  1Z1B A;  1P47 A;  2YSP A;  2YRH A;  1RMD A;  1X6E A;  1TN9 A;  1X5W A;  4R2R A;  2YTO A;  2ENH A;  1YSA C;  2CSH A;  2ELZ A;  4X9J A;  4F6M A;  2ENA A;  4R2D A;  2EOY A;  2YTQ A;  1A1G A;  1A1I A;  2DLK A;  1ZAA C;  2EMF A;  2EN3 A;  2EMW A;  2EQ1 A;  5KL6 A;  1JK1 A;  2EM3 A;  2HGH A;  2YSO A;  1TF3 A;  2EM4 A;  2EPX A;  2BB8 A;  2EOR A;  5KL7 A;  2YTE A;  2EMZ A;  2EMC A;  2EMG A;  2EM0 A;  1BBO A;  2VRD A;  2WCC 3;  2ADR A;  2NAB A;  2LCE A;  1G2F C;  1A1H A;  2ENC A;  3M99 B;  1B69 A;  2MKN A;  5KL5 A;  4IS1 C;  2YTD A;  1WJP A;  2EPC A;  2M9A A;  4R2C A;  3UK3 C;  4R2S A;  2EOF A;  1F2I G;  4R2Q A;  2EMA A;  2EPU A;  2A25 A;  2EL4 A;  2EQ0 A;  2YTG A;  2GLI A;  5KL2 A;  2RPC A;  2EM2 A;  2DMI A;  2EOX A;  1YUI A;  2EOS A;  2EN4 A;  1AAY A;  2PRT A;  2LT7 A;  2YU8 A;  2EPP A;  3EPL A;  2EMY A;  1X6F A;  2RSI A;  4F6N A;  2EOJ A;  4FK5 C;  2YRK A;  2E72 A;  2I13 A;  1ZR9 A;  2EOE A;  4F2J C;  2EOQ A;  2EM5 A;  4WSG A;  1A1K A;  2JPA A;  2EM6 A;  2ELY A;  2YTF A;  5KL4 A;  2EMB A;  2EJ4 A;  4M9V C;  2DGC A;  2EN2 A;  1A1J A;  4IJD A;  2EOO A;  2YTN A;  3MHH C;  1DGC A;  4GZN C;  2D9H A;  2CT1 A;  2MDG A;  2EPZ A;  2EM8 A;  2DLQ A;  2YU5 A;  2EPR A;  2GHF A;  2EMH A;  1KJK A;  2EL5 A;  2EN7 A;  1A1F A;  2EQ3 A;  3VHT B;  1MEY C;  2EN6 A;  2EOI A; 
#chains in the Genus database with same CATH topology
 2EPM X;  4DUZ E;  1YYK A;  1UHZ A;  5T6J A;  4BMJ A;  4Q35 B;  1T4O A;  4LF7 E;  1N3G A;  2EM7 A;  3KZZ A;  2MC5 A;  2EMK A;  3VYY A;  2B7T A;  5AE3 A;  5CFF E;  2RS6 A;  4NXM E;  2LO3 A;  2J7J A;  2YT4 A;  1LLM C;  2KON A;  5KL3 A;  1XNR E;  4DKK A;  4YHH E;  4ZYE A;  2YRM A;  5AC5 A;  2LVH A;  1PJS A;  4DV3 E;  4ZYH A;  3EPH A;  4K0K E;  1X3C A;  2UU9 E;  2FTX B;  3J80 C;  2EOZ A;  4WFT A;  1BB8 A;  1ZBT A;  4X8W A;  2EN8 A;  2YTI A;  1IBL E;  2EL6 A;  2EN1 A;  4JV5 E;  5A6K A;  1RMD A;  1X6E A;  1TN9 A;  1J5E E;  2JR1 A;  4X9J A;  2ELZ A;  4R2D A;  1A1G A;  4JYA E;  4R8O A;  5KL6 A;  2EM4 A;  3J81 C;  3J7Y p;  4WXC A;  1DI2 A;  5KL7 A;  3F6G A;  1FKA E;  4JI0 E;  5LMU E;  2GPI A;  2L2N A;  4L5N C;  1SFE A;  5AE1 A;  2L33 A;  2LCE A;  1G2F C;  2ENC A;  3M99 B;  4DR5 E;  1WJP A;  2EPC A;  1AH5 A;  2M7Q A;  3UK3 C;  1N36 E;  2Q8U A;  1F2I G;  4GKK E;  3IWD A;  4KZS A;  3ZOQ B;  4R2Q A;  2EL4 A;  2GLI A;  4LF9 E;  2B3T B;  1XMQ E;  2RPC A;  2ODR D;  1X49 A;  2BBG A;  2EN4 A;  5IV8 B;  2PRT A;  4ZYD A;  4LF5 E;  5LMN E;  1GZ6 A;  1YYO A;  1IBM E;  2RSI A;  3L00 A;  2VE7 C;  3HXL A;  5LL6 R;  2DSY A;  4NXN E;  4F2J C;  3OML A;  2V88 A;  1A1K A;  2JPA A;  2YTF A;  2N3G A;  2EPN A;  2NUE A;  5A2Q C;  2DMY A;  2EN2 A;  4DUY E;  4DV4 E;  1YZ9 A;  1YPN A;  1FJG E;  2L2M A;  4DMI A;  4DR7 E;  2L3J A;  2GHF A;  2EMH A;  4LFB E;  1A1F A;  2EQ3 A;  3VHT B;  1BBG A;  1MEY C;  1HNW E;  1PJQ A;  4BC7 A;  2EN6 A;  2I9I A;  1WRJ A;  3IWC A;  2EOI A;  1ZU1 A;  2R1F A;  2HJJ A;  2LMZ A;  1G2D C;  3EPK A;  1RQ0 A;  4LFA E;  2WBU A;  4F9A B;  4X62 E;  3HQ1 A;  4L8N A;  1UIL A;  5F3W A;  4Q28 A;  2HHH E;  2KHX A;  2EPL X;  2B9D A;  3HPZ A;  2EM9 A;  2FGG A;  3DJW A;  5LLQ A;  1XMO E;  2UUC E;  3K6Q A;  2EMX A;  4WXD A;  2DRP A;  2VQE E;  2LJU A;  3ADJ A;  4DV5 E;  4B3S E;  1UN6 B;  2YTP A;  4JI8 E;  1T4N A;  4R2A A;  4WSP A;  1Z1B A;  1P47 A;  4X66 E;  3VYX A;  3EQ1 A;  2LJH A;  2NA2 A;  1X5W A;  1SR9 A;  2YTO A;  2ENH A;  1WHQ A;  2N8X A;  2LE2 A;  2KOU A;  2LUP B;  2ENA A;  2JXP A;  1A1I A;  1ZAA C;  2EMF A;  2EN3 A;  2EMW A;  1JK1 A;  2EM3 A;  4O5G A;  1TF3 A;  2EPX A;  4WX9 A;  1IMU A;  5IWA E;  2EMZ A;  3MSW A;  5DNY A;  2EMC A;  4X64 E;  1BBO A;  2B7V A;  1WXR A;  3FIG A;  3KWR A;  3THN A;  3VK6 A;  3BBG A;  5KL5 A;  2FV4 B;  3H09 A;  2M9A A;  1GTK A;  4R2C A;  4R2S A;  2EOF A;  1YFH A;  5IT9 C;  4M2Z A;  2EMA A;  2YWQ A;  2EQ0 A;  2MDR A;  5KL2 A;  2DMI A;  2EOX A;  2JOX A;  4MLV A;  1EH7 A;  3OTO E;  4DR2 E;  1L4S A;  5IXM B;  4F6N A;  4DV0 E;  2EOJ A;  4B3M E;  2CPN A;  2RSM A;  2YRK A;  2JWO A;  1ZR9 A;  4B3R E;  4WSG A;  2ELY A;  5KL4 A;  4N4R B;  4JI2 E;  2DGC A;  1QU6 A;  2EOO A;  4DR6 E;  2YTN A;  3MHH C;  4GZN C;  2V89 A;  2MDG A;  1T38 A;  2M4I A;  4F9B B;  2EPR A;  1DQ3 A;  1IBK E;  1KJK A;  2EL5 A;  2EN7 A;  1WHN A;  4HTG A;  2MC6 A;  5BR8 E;  2YZT A;  3T1H E;  2M1S A;  3BGH A;  2LUQ A;  4BHB A;  3RMP A;  2NUG A;  1TF6 A;  3BID A;  2JP9 A;  1QNT A;  3TQM A;  2WBS A;  3F6H A;  2WBT A;  4DV2 E;  5A6A A;  2RQL A;  4JI4 E;  4R2P A;  2MKD A;  1NEI A;  2G7H A;  1YUJ A;  1UBD C;  2ODR C;  5AE2 A;  5AAS A;  2EPA A;  1A1L A;  2L3C A;  2VF1 A;  3T1Y E;  1STU A;  4O24 A;  2EOM A;  2EE8 A;  4P7D A;  4DV1 E;  4X65 E;  2EP3 A;  2F8B A;  3MHS C;  2YRH A;  5ADZ A;  2EZ6 A;  4R2R A;  1X48 A;  2CSH A;  4F6M A;  1J26 A;  4WPY A;  1I94 E;  2DLK A;  2DB2 A;  2EQ1 A;  2HGH A;  4P78 A;  1N34 E;  2BB8 A;  1RC7 A;  2YTE A;  4LF8 E;  1N33 E;  4BC9 A;  2EM0 A;  4M0V A;  3THO B;  2V83 A;  2ADR A;  3AV0 A;  4KWY A;  2R76 A;  3C6M A;  2L2K B;  2YTD A;  2UUA E;  3KZY A;  3HTX A;  2A25 A;  2YTG A;  2DIX A;  2VQF E;  3ADI A;  1YUI A;  2EOS A;  2ZM6 E;  2LBS B;  2H36 X;  2LT7 A;  1T4L B;  2YU8 A;  2E5L E;  4KHP E;  2EPP A;  4LU9 A;  3EPL A;  2EWL A;  1O0W A;  4GKJ E;  4FK5 C;  2E72 A;  2I13 A;  4BHC A;  2EOQ A;  2EM5 A;  2EM6 A;  2EJ4 A;  4DV6 E;  1XNQ E;  4M9V C;  1IQO A;  5A6B A;  4DR4 E;  4IJD A;  1DGC A;  4F9C B;  4BBY A;  2UXD E;  1X47 A;  2CT1 A;  2IHR 1;  4RH8 A;  2EM8 A;  3JU0 A;  2YU5 A;  1HR0 E;  4I8O A;  1KYQ A;  2N3H A;  2UUB E;  2E1M A;  3C4B A;  2EMI A;  2YPN A;  4AQY E;  2V8Q B;  3EPJ A;  1EH8 A;  1PKP A;  2LRS A;  2JVA A;  2EOH A;  4R03 A;  3JTZ A;  4R2E A;  5A6J A;  2WZO A;  2L8T A;  4M30 A;  1ZBQ A;  2EML A;  2UXB E;  2F4V E;  2LV2 A;  4ZYG A;  1NCS A;  2CTD A;  4OOG C;  1MGT A;  1JK2 A;  4LTY A;  1GQE A;  1PDA A;  2NUF A;  2YTJ A;  2EPK X;  5AC4 A;  1X6H A;  4LF4 E;  4BS9 A;  3C4T A;  4J8Z A;  1T39 A;  2YSP A;  4JI6 E;  1PJT A;  2K7I A;  3ECR A;  1YSA C;  2EOY A;  2JOB A;  2YTQ A;  3ADG A;  2LTS A;  3BF2 A;  4GEQ B;  1HNZ E;  4LFC E;  4NZV A;  2YSO A;  4YY3 E;  2EOR A;  3AUZ A;  3HPS A;  2EMG A;  2VRD A;  1HNX E;  2WCC 3;  2NAB A;  2RTX A;  4TUG A;  4TUI A;  2V85 A;  1B69 A;  3QG5 C;  1A1H A;  2MKN A;  2K4V A;  4IS1 C;  2RS7 A;  4B3T E;  3JAM C;  5A69 A;  4DV7 E;  4NHR A;  2JYA A;  4DR3 E;  1N32 E;  4JI7 E;  4O4K A;  4DR1 E;  2EPU A;  3IWB A;  4MLQ A;  3LML A;  1EKZ A;  2LTR A;  2EM2 A;  2L6M A;  4O43 A;  4RHB B;  1AAY A;  2UXC E;  4JI3 E;  4HEI A;  4OX9 E;  2EMY A;  1X6F A;  1YYW A;  4F54 A;  2EOE A;  2JY9 A;  1EH6 A;  5TSE A;  2EPO A;  2EMB A;  4BCA A;  3ADL A;  2HC5 A;  1IQS A;  1A1J A;  2V87 A;  3C6K A;  2D9H A;  4JI1 E;  2EPZ A;  2L92 A;  5A6B D;  2DLQ A;  2V86 A;  4WYQ B;  4LF6 E;  5FLX C;  4JI5 E;  3LLH A;  3J7A G;  3DF6 A;  3P1X A; 
#chains in the Genus database with same CATH homology
 1ZU1 A;  2R1F A;  2EMI A;  1G2D C;  3EPK A;  3EPJ A;  2EM7 A;  2WBU A;  1TF6 A;  2EMK A;  2JP9 A;  2EOH A;  4R2E A;  2WBS A;  2LO3 A;  2J7J A;  2WBT A;  1LLM C;  2EML A;  5KL3 A;  4R2P A;  2LV2 A;  1NCS A;  2CTD A;  2MKD A;  1JK2 A;  1YUJ A;  2YRM A;  2LVH A;  1UBD C;  2EM9 A;  3EPH A;  1X3C A;  2EPA A;  1A1L A;  2EMX A;  2EOZ A;  2DRP A;  2YTJ A;  1X6H A;  1BB8 A;  1UN6 B;  2EOM A;  2EE8 A;  2YTP A;  2EN8 A;  2YTI A;  4R2A A;  2EP3 A;  2EL6 A;  2EN1 A;  3MHS C;  1Z1B A;  1P47 A;  2YSP A;  2YRH A;  1RMD A;  1X6E A;  1TN9 A;  1X5W A;  4R2R A;  2YTO A;  2ENH A;  1YSA C;  2CSH A;  2ELZ A;  4X9J A;  4F6M A;  2ENA A;  4R2D A;  2EOY A;  2YTQ A;  1A1G A;  1A1I A;  2DLK A;  1ZAA C;  2EMF A;  2EN3 A;  2EMW A;  2EQ1 A;  5KL6 A;  1JK1 A;  2EM3 A;  2HGH A;  2YSO A;  1TF3 A;  2EM4 A;  2EPX A;  2BB8 A;  2EOR A;  5KL7 A;  2YTE A;  2EMZ A;  2EMC A;  2EMG A;  2EM0 A;  1BBO A;  2VRD A;  2WCC 3;  2ADR A;  2NAB A;  2LCE A;  1G2F C;  1A1H A;  2ENC A;  3M99 B;  1B69 A;  2MKN A;  5KL5 A;  4IS1 C;  2YTD A;  1WJP A;  2EPC A;  2M9A A;  4R2C A;  3UK3 C;  4R2S A;  2EOF A;  1F2I G;  4R2Q A;  2EMA A;  2EPU A;  2A25 A;  2EL4 A;  2EQ0 A;  2YTG A;  2GLI A;  5KL2 A;  2RPC A;  2EM2 A;  2DMI A;  2EOX A;  1YUI A;  2EOS A;  2EN4 A;  1AAY A;  2PRT A;  2LT7 A;  2YU8 A;  2EPP A;  3EPL A;  2EMY A;  1X6F A;  2RSI A;  4F6N A;  2EOJ A;  4FK5 C;  2YRK A;  2E72 A;  2I13 A;  1ZR9 A;  2EOE A;  4F2J C;  2EOQ A;  2EM5 A;  4WSG A;  1A1K A;  2JPA A;  2EM6 A;  2ELY A;  2YTF A;  5KL4 A;  2EMB A;  2EJ4 A;  4M9V C;  2DGC A;  2EN2 A;  1A1J A;  4IJD A;  2EOO A;  2YTN A;  3MHH C;  1DGC A;  4GZN C;  2D9H A;  2CT1 A;  2MDG A;  2EPZ A;  2EM8 A;  2DLQ A;  2YU5 A;  2EPR A;  2GHF A;  2EMH A;  1KJK A;  2EL5 A;  2EN7 A;  1A1F A;  2EQ3 A;  3VHT B;  1MEY C;  2EN6 A;  2EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...