5KL3A

Wilms tumor protein (wt1) znf2-4 q369h in complex with dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 28
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl3A00
2MDGA 2GLIA 2EOZA 1AAYA 2EP3A 1G2FC 2EMCA 2EMWA 2EOEA 1LLMC 4R2PA 2CT1A 2DGCA 2EPPA 4R2QA 2CSHA 2YTFA 1A1IA 4M9VC 2WBTA 1NCSA 1G2DC 3EPHA 2EQ0A 1ZAAC 1ZR9A 2YTNA 5KL7A 4WSGA 3UK3C 2YRKA 4R2CA 1BBOA 2EN6A 2LT7A 1X3CA 2EM0A 1KJKA 2EM9A 2DMIA 2YTDA 2PRTA 1X6HA 2JPAA 2ELZA 2ELYA 2MKDA 2ENCA 5KL2A 2EOJA 4R2RA 1TF3A 2YTPA 2LCEA 1A1FA 2ENHA 3MHSC 5KL5A 2EMFA 2EMIA 2YRMA 2EL5A 1A1LA 2YU5A 2E72A 2EMGA 2WBSA 5KL6A 2GHFA 2JP9A 2R1FA 2RPCA 2EL6A 1JK1A 1A1JA 2EMYA 2EN8A 2EOIA 2EMHA 2DLKA 2LV2A 2EQ3A 1YUIA 2EOSA 2BB8A 2EM3A 2RSIA 2YTEA 2YTGA 1X5WA 4FK5C 4R2AA 2EMZA 2CTDA 4R2DA 1JK2A 2EN7A 2EOHA 2A25A 2EN2A 3EPJA 2WCC3 1DGCA 1A1HA 2DLQA 2EL4A 2EM2A 2EPAA 1X6EA 2EPRA 2EOMA 2EM6A 1UN6B 2EQ1A 4X9JA 2EMXA 2YTJA 3EPKA 1ZU1A 2EMKA 4R2SA 1A1KA 2EOFA 2EM8A 2ADRA 2EMLA 2EPZA 1YUJA 4F6MA 1BB8A 4F6NA 2NABA 2EN1A 2EORA 3VHTB 2EM5A 1WJPA 1RMDA 2J7JA 5KL3A 1X6FA 1MEYC 1TN9A 2YSPA 4R2EA 4GZNC 4F2JC 2YSOA 1B69A 2LO3A 2YTOA 4IS1C 2MKNA 1Z1BA 5KL4A 2EN4A 2YRHA 1UBDC 2HGHA 2EPUA 1A1GA 3M99B 1TF6A 2EM7A 2EOOA 2YTIA 2EM4A 2EJ4A 2YTQA 2EN3A 2EMAA 2LVHA 2EOYA 1F2IG 2EMBA 1P47A 1YSAC 2EPXA 2EOQA 4IJDA 2EPCA 2VRDA 2DRPA 2ENAA 2YU8A 2EE8A 3MHHC 2D9HA 2M9AA 2WBUA 2EOXA 3EPLA 2I13A
chains in the Genus database with same CATH superfamily
1ZBTA 2B3TB 1RC7A 2EMCA 2JY9A 4LF4E 4R2QA 3C4BA 2UXBE 2L3JA 2LMZA 2WBTA 4Q35B 1G2DC 3EPHA 1ZR9A 5TSEA 3UK3C 1T39A 3K6QA 2LUQA 2YRKA 4M30A 4ZYDA 2ZM6E 4RH8A 4JI0E 1KJKA 2PRTA 2LBSB 4NZVA 2GPIA 4JI1E 2ELYA 1EH6A 5KL2A 2EOJA 1A1FA 3ADIA 5KL5A 2H36X 2YRMA 4TUGA 2IHR1 5AC4A 2WBSA 3BGHA 2GHFA 4DUZE 1QU6A 2VQEE 2DB2A 2EMYA 4WXDA 2EMHA 1FKAE 4F54A 4JV5E 4JI5E 2LV2A 4DR1E 4X62E 2LTSA 1AH5A 2CTDA 4OOGC 2EN7A 2K4VA 2A25A 2EN2A 2WCC3 2FTXB 4L5NC 2EL4A 2EOMA 2EPRA 2EM6A 3DF6A 3MSWA 1UILA 2CPNA 2EQ1A 4F9BB 4DV0E 1IMUA 5LMUE 3T1YE 2UUCE 2EMKA 1T4NA 2N8XA 4R2SA 1A1KA 3JU0A 4WSPA 5A6AA 2VQFE 4L8NA 2EZ6A 3JAMC 4B3RE 2EPZA 2ODRC 1J26A 1N34E 3TQMA 4OX9E 1BB8A 1N3GA 2NABA 1RMDA 5IT9C 4DKKA 5BR8E 2YSOA 1B69A 2NA2A 2M1SA 2I9IA 2JVAA 5AE1A 5LLQA 4X64E 1Z1BA 1UBDC 2EPUA 1A1GA 1TF6A 4I8OA 1GQEA 2EM7A 2YTIA 4DMIA 2YTQA 2KONA 3BBGA 2UXDE 1P47A 1T4OA 4LF9E 2EOQA 1HNWE 3AV0A 2EPCA 2VRDA 4JI7E 2DSYA 2EE8A 2WBUA 4JI2E 2RQLA 2I13A 5FLXC 3T1HE 2UXCE 2EOZA 2EP3A 2JWOA 3J80C 4DR3E 5A6JA 1LLMC 2LTRA 2CT1A 2DGCA 2EPPA 1UHZA 1O0WA 3P1XA 3J7Yp 4DR6E 1ZAAC 2V85A 2EPMX 4WPYA 2L2MA 2YT4A 4DR4E 1BBOA 2EM0A 4BC9A 1WHNA 2DMIA 2YTDA 1X6HA 1PJSA 1YYKA 3RMPA 2JYAA 2LE2A 2LCEA 4MLVA 2RS7A 3MHSC 3THOB 2UUAE 1EH8A 2EMFA 5KL6A 2R1FA 3AUZA 2EL6A 1A1JA 4DR5E 2DLKA 1QNTA 2EQ3A 3ADLA 2NUFA 4BS9A 2BB8A 3C6MA 2EM3A 2RSIA 2YTEA 4LTYA 1IBKE 1L4SA 1HNXE 1SR9A 4O4KA 3ECRA 1DGCA 2EPAA 4WXCA 4O5GA 1I94E 5IV8B 3BIDA 1UN6B 2YTJA 1YFHA 1PDAA 5AE2A 5A2QC 2EM8A 2RS6A 4DV7E 2L2NA 3ZOQB 1WXRA 1YUJA 2M4IA 2V88A 5DNYA 3EQ1A 2F4VE 4ZYEA 1DI2A 2ODRD 3VHTB 2B9DA 1WJPA 5KL3A 5F3WA 2DMYA 3L00A 2B7TA 1KYQA 2YSPA 4AQYE 4GZNC 4LFBE 4BHCA 1IBLE 4LF5E 5KL4A 2EN4A 2HGHA 1T4LB 2N3GA 1PJTA 4LU9A 4DR2E 2DIXA 2EOOA 3ADGA 2HJJA 2EN3A 1WHQA 2LVHA 4BC7A 2KOUA 3FIGA 1YSAC 2L3CA 4IJDA 4JI3E 1YPNA 2UU9E 3MHHC 3HPSA 4R2DA 2MDGA 2HC5A 2LJUA 1AAYA 1G2FC 2WZOA 2EMWA 2EOEA 2V89A 4DV2E 2F8BA 1IBME 5AC5A 1DQ3A 3C6KA 1YYOA 2CSHA 2YTFA 4M9VC 1T38A 1NCSA 2LJHA 5ADZA 4WX9A 1SFEA 3LMLA 4DV5E 2EN6A 3QG5C 1X3CA 2EM9A 3HTXA 4NXME 5T6JA 2ELZA 4M0VA 4WFTA 4R2RA 2ENCA 4TUIA 2NUGA 2EPLX 1PKPA 2MC5A 4F9CB 5A6BA 5A6BD 1FJGE 5LMNE 2K7IA 2EMIA 3HPZA 2EL5A 1A1LA 2E72A 2JP9A 4M2ZA 4BBYA 4MLQA 2EOIA 4GKJE 1YZ9A 2LUPB 1YUIA 3J81C 2L8TA 4FK5C 4ZYHA 1X5WA 1X49A 2L2KB 2EMZA 1NEIA 3HXLA 2EOHA 4JI4E 3EPJA 3KZZA 1A1HA 2DLQA 2E1MA 4BMJA 3VYXA 2V86A 3EPKA 3KZYA 1ZU1A 4LF6E 5A69A 4HTGA 1EH7A 2ADRA 4YHHE 4F6MA 5CFFE 5AASA 4X65E 3VYYA 4F6NA 5IWAE 2EORA 1IQSA 4JI8E 2J7JA 4JYAE 1MEYC 2FV4B 4DUYE 1N32E 4F2JC 4WYQB 2LO3A 4R8OA 4DV4E 2YRHA 3JTZA 1EKZA 2VF1A 4J8ZA 2YPNA 1XNRE 4Q28A 1XMQE 1XMOE 2EM4A 2EJ4A 2EMAA 1F2IG 2EWLA 2EMBA 4K0KE 2ENAA 4KWYA 2D9HA 2M9AA 2UUBE 2EOXA 4ZYGA 3EPLA 2HHHE 2GLIA 2EPOA 1STUA 1X48A 4R2PA 3LLHA 2V8QB 2JOBA 1N33E 1A1IA 4R03A 2Q8UA 1ZBQA 2EQ0A 5AE3A 2YTNA 5KL7A 4NHRA 4WSGA 3H09A 2RTXA 4R2CA 3HQ1A 1YYWA 2LT7A 2JXPA 4X8WA 3F6HA 2JPAA 2V87A 3OTOE 1N36E 2MKDA 1TF3A 4BHBA 2EPKX 5A6KA 1HNZE 2YTPA 2ENHA 1X47A 3DJWA 4NXNE 1HR0E 2EPNA 2YU5A 2EMGA 2G7HA 2RPCA 3BF2A 4B3ME 1JK1A 5LL6R 2EN8A 2L6MA 5IXMB 2M7QA 3J7AG 2EOSA 2N3HA 4F9AB 2L92A 2YTGA 2V83A 3C4TA 4R2AA 1MGTA 3IWDA 1RQ0A 4P7DA 1JK2A 2YWQA 4B3SE 4JI6E 2EM2A 4O24A 1X6EA 4DV6E 4DV3E 1XNQE 1IQOA 4X9JA 2EMXA 3THNA 2L33A 2VE7C 3ADJA 4B3TE 2EOFA 2RSMA 4KHPE 2EMLA 2JR1A 2MDRA 2E5LE 4GKKE 4P78A 2EN1A 2KHXA 3OMLA 2EM5A 2B7VA 1PJQA 4KZSA 4YY3E 1X6FA 3IWBA 2LRSA 4LF8E 1TN9A 3VK6A 4R2EA 4LF7E 4LFCE 2YTOA 4IS1C 4DR7E 2MKNA 3IWCA 1J5EE 3F6GA 4O43A 1GTKA 3M99B 4BCAA 2JOXA 2MC6A 4X66E 2FGGA 2EOYA 1BBGA 4RHBB 4DV1E 3KWRA 4LFAE 1WRJA 2R76A 4HEIA 4GEQB 2EPXA 2YZTA 4N4RB 2DRPA 2YU8A 2BBGA 1GZ6A 2NUEA
chains in the Genus database with same CATH topology
2MDGA 2GLIA 2EOZA 1AAYA 2EP3A 1G2FC 2EMCA 2EMWA 2EOEA 1LLMC 4R2PA 2CT1A 2DGCA 2EPPA 4R2QA 2CSHA 2YTFA 1A1IA 4M9VC 2WBTA 1NCSA 1G2DC 3EPHA 2EQ0A 1ZAAC 1ZR9A 2YTNA 5KL7A 4WSGA 3UK3C 2YRKA 4R2CA 1BBOA 2EN6A 2LT7A 1X3CA 2EM0A 1KJKA 2EM9A 2DMIA 2YTDA 2PRTA 1X6HA 2JPAA 2ELZA 2ELYA 2MKDA 2ENCA 5KL2A 2EOJA 4R2RA 1TF3A 2YTPA 2LCEA 1A1FA 2ENHA 3MHSC 5KL5A 2EMFA 2EMIA 2YRMA 2EL5A 1A1LA 2YU5A 2E72A 2EMGA 2WBSA 5KL6A 2GHFA 2JP9A 2R1FA 2RPCA 2EL6A 1JK1A 1A1JA 2EMYA 2EN8A 2EOIA 2EMHA 2DLKA 2LV2A 2EQ3A 1YUIA 2EOSA 2BB8A 2EM3A 2RSIA 2YTEA 2YTGA 1X5WA 4FK5C 4R2AA 2EMZA 2CTDA 4R2DA 1JK2A 2EN7A 2EOHA 2A25A 2EN2A 3EPJA 2WCC3 1DGCA 1A1HA 2DLQA 2EL4A 2EM2A 2EPAA 1X6EA 2EPRA 2EOMA 2EM6A 1UN6B 2EQ1A 4X9JA 2EMXA 2YTJA 3EPKA 1ZU1A 2EMKA 4R2SA 1A1KA 2EOFA 2EM8A 2ADRA 2EMLA 2EPZA 1YUJA 4F6MA 1BB8A 4F6NA 2NABA 2EN1A 2EORA 3VHTB 2EM5A 1WJPA 1RMDA 2J7JA 5KL3A 1X6FA 1MEYC 1TN9A 2YSPA 4R2EA 4GZNC 4F2JC 2YSOA 1B69A 2LO3A 2YTOA 4IS1C 2MKNA 1Z1BA 5KL4A 2EN4A 2YRHA 1UBDC 2HGHA 2EPUA 1A1GA 3M99B 1TF6A 2EM7A 2EOOA 2YTIA 2EM4A 2EJ4A 2YTQA 2EN3A 2EMAA 2LVHA 2EOYA 1F2IG 2EMBA 1P47A 1YSAC 2EPXA 2EOQA 4IJDA 2EPCA 2VRDA 2DRPA 2ENAA 2YU8A 2EE8A 3MHHC 2D9HA 2M9AA 2WBUA 2EOXA 3EPLA 2I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDG A;  2GLI A;  2EOZ A;  1AAY A;  2EP3 A;  1G2F C;  2EMC A;  2EMW A;  2EOE A;  1LLM C;  4R2P A;  2CT1 A;  2DGC A;  2EPP A;  4R2Q A;  2CSH A;  2YTF A;  1A1I A;  4M9V C;  2WBT A;  1NCS A;  1G2D C;  3EPH A;  2EQ0 A;  1ZAA C;  1ZR9 A;  2YTN A;  5KL7 A;  4WSG A;  3UK3 C;  2YRK A;  4R2C A;  1BBO A;  2EN6 A;  2LT7 A;  1X3C A;  2EM0 A;  1KJK A;  2EM9 A;  2DMI A;  2YTD A;  2PRT A;  1X6H A;  2JPA A;  2ELZ A;  2ELY A;  2MKD A;  2ENC A;  5KL2 A;  2EOJ A;  4R2R A;  1TF3 A;  2YTP A;  2LCE A;  1A1F A;  2ENH A;  3MHS C;  5KL5 A;  2EMF A;  2EMI A;  2YRM A;  2EL5 A;  1A1L A;  2YU5 A;  2E72 A;  2EMG A;  2WBS A;  5KL6 A;  2GHF A;  2JP9 A;  2R1F A;  2RPC A;  2EL6 A;  1JK1 A;  1A1J A;  2EMY A;  2EN8 A;  2EOI A;  2EMH A;  2DLK A;  2LV2 A;  2EQ3 A;  1YUI A;  2EOS A;  2BB8 A;  2EM3 A;  2RSI A;  2YTE A;  2YTG A;  1X5W A;  4FK5 C;  4R2A A;  2EMZ A;  2CTD A;  4R2D A;  1JK2 A;  2EN7 A;  2EOH A;  2A25 A;  2EN2 A;  3EPJ A;  2WCC 3;  1DGC A;  1A1H A;  2DLQ A;  2EL4 A;  2EM2 A;  2EPA A;  1X6E A;  2EPR A;  2EOM A;  2EM6 A;  1UN6 B;  2EQ1 A;  4X9J A;  2EMX A;  2YTJ A;  3EPK A;  1ZU1 A;  2EMK A;  4R2S A;  1A1K A;  2EOF A;  2EM8 A;  2ADR A;  2EML A;  2EPZ A;  1YUJ A;  4F6M A;  1BB8 A;  4F6N A;  2NAB A;  2EN1 A;  2EOR A;  3VHT B;  2EM5 A;  1WJP A;  1RMD A;  2J7J A;  5KL3 A;  1X6F A;  1MEY C;  1TN9 A;  2YSP A;  4R2E A;  4GZN C;  4F2J C;  2YSO A;  1B69 A;  2LO3 A;  2YTO A;  4IS1 C;  2MKN A;  1Z1B A;  5KL4 A;  2EN4 A;  2YRH A;  1UBD C;  2HGH A;  2EPU A;  1A1G A;  3M99 B;  1TF6 A;  2EM7 A;  2EOO A;  2YTI A;  2EM4 A;  2EJ4 A;  2YTQ A;  2EN3 A;  2EMA A;  2LVH A;  2EOY A;  1F2I G;  2EMB A;  1P47 A;  1YSA C;  2EPX A;  2EOQ A;  4IJD A;  2EPC A;  2VRD A;  2DRP A;  2ENA A;  2YU8 A;  2EE8 A;  3MHH C;  2D9H A;  2M9A A;  2WBU A;  2EOX A;  3EPL A;  2I13 A; 
#chains in the Genus database with same CATH topology
 1ZBT A;  2B3T B;  1RC7 A;  2EMC A;  2JY9 A;  4LF4 E;  4R2Q A;  3C4B A;  2UXB E;  2L3J A;  2LMZ A;  2WBT A;  4Q35 B;  1G2D C;  3EPH A;  1ZR9 A;  5TSE A;  3UK3 C;  1T39 A;  3K6Q A;  2LUQ A;  2YRK A;  4M30 A;  4ZYD A;  2ZM6 E;  4RH8 A;  4JI0 E;  1KJK A;  2PRT A;  2LBS B;  4NZV A;  2GPI A;  4JI1 E;  2ELY A;  1EH6 A;  5KL2 A;  2EOJ A;  1A1F A;  3ADI A;  5KL5 A;  2H36 X;  2YRM A;  4TUG A;  2IHR 1;  5AC4 A;  2WBS A;  3BGH A;  2GHF A;  4DUZ E;  1QU6 A;  2VQE E;  2DB2 A;  2EMY A;  4WXD A;  2EMH A;  1FKA E;  4F54 A;  4JV5 E;  4JI5 E;  2LV2 A;  4DR1 E;  4X62 E;  2LTS A;  1AH5 A;  2CTD A;  4OOG C;  2EN7 A;  2K4V A;  2A25 A;  2EN2 A;  2WCC 3;  2FTX B;  4L5N C;  2EL4 A;  2EOM A;  2EPR A;  2EM6 A;  3DF6 A;  3MSW A;  1UIL A;  2CPN A;  2EQ1 A;  4F9B B;  4DV0 E;  1IMU A;  5LMU E;  3T1Y E;  2UUC E;  2EMK A;  1T4N A;  2N8X A;  4R2S A;  1A1K A;  3JU0 A;  4WSP A;  5A6A A;  2VQF E;  4L8N A;  2EZ6 A;  3JAM C;  4B3R E;  2EPZ A;  2ODR C;  1J26 A;  1N34 E;  3TQM A;  4OX9 E;  1BB8 A;  1N3G A;  2NAB A;  1RMD A;  5IT9 C;  4DKK A;  5BR8 E;  2YSO A;  1B69 A;  2NA2 A;  2M1S A;  2I9I A;  2JVA A;  5AE1 A;  5LLQ A;  4X64 E;  1Z1B A;  1UBD C;  2EPU A;  1A1G A;  1TF6 A;  4I8O A;  1GQE A;  2EM7 A;  2YTI A;  4DMI A;  2YTQ A;  2KON A;  3BBG A;  2UXD E;  1P47 A;  1T4O A;  4LF9 E;  2EOQ A;  1HNW E;  3AV0 A;  2EPC A;  2VRD A;  4JI7 E;  2DSY A;  2EE8 A;  2WBU A;  4JI2 E;  2RQL A;  2I13 A;  5FLX C;  3T1H E;  2UXC E;  2EOZ A;  2EP3 A;  2JWO A;  3J80 C;  4DR3 E;  5A6J A;  1LLM C;  2LTR A;  2CT1 A;  2DGC A;  2EPP A;  1UHZ A;  1O0W A;  3P1X A;  3J7Y p;  4DR6 E;  1ZAA C;  2V85 A;  2EPM X;  4WPY A;  2L2M A;  2YT4 A;  4DR4 E;  1BBO A;  2EM0 A;  4BC9 A;  1WHN A;  2DMI A;  2YTD A;  1X6H A;  1PJS A;  1YYK A;  3RMP A;  2JYA A;  2LE2 A;  2LCE A;  4MLV A;  2RS7 A;  3MHS C;  3THO B;  2UUA E;  1EH8 A;  2EMF A;  5KL6 A;  2R1F A;  3AUZ A;  2EL6 A;  1A1J A;  4DR5 E;  2DLK A;  1QNT A;  2EQ3 A;  3ADL A;  2NUF A;  4BS9 A;  2BB8 A;  3C6M A;  2EM3 A;  2RSI A;  2YTE A;  4LTY A;  1IBK E;  1L4S A;  1HNX E;  1SR9 A;  4O4K A;  3ECR A;  1DGC A;  2EPA A;  4WXC A;  4O5G A;  1I94 E;  5IV8 B;  3BID A;  1UN6 B;  2YTJ A;  1YFH A;  1PDA A;  5AE2 A;  5A2Q C;  2EM8 A;  2RS6 A;  4DV7 E;  2L2N A;  3ZOQ B;  1WXR A;  1YUJ A;  2M4I A;  2V88 A;  5DNY A;  3EQ1 A;  2F4V E;  4ZYE A;  1DI2 A;  2ODR D;  3VHT B;  2B9D A;  1WJP A;  5KL3 A;  5F3W A;  2DMY A;  3L00 A;  2B7T A;  1KYQ A;  2YSP A;  4AQY E;  4GZN C;  4LFB E;  4BHC A;  1IBL E;  4LF5 E;  5KL4 A;  2EN4 A;  2HGH A;  1T4L B;  2N3G A;  1PJT A;  4LU9 A;  4DR2 E;  2DIX A;  2EOO A;  3ADG A;  2HJJ A;  2EN3 A;  1WHQ A;  2LVH A;  4BC7 A;  2KOU A;  3FIG A;  1YSA C;  2L3C A;  4IJD A;  4JI3 E;  1YPN A;  2UU9 E;  3MHH C;  3HPS A;  4R2D A;  2MDG A;  2HC5 A;  2LJU A;  1AAY A;  1G2F C;  2WZO A;  2EMW A;  2EOE A;  2V89 A;  4DV2 E;  2F8B A;  1IBM E;  5AC5 A;  1DQ3 A;  3C6K A;  1YYO A;  2CSH A;  2YTF A;  4M9V C;  1T38 A;  1NCS A;  2LJH A;  5ADZ A;  4WX9 A;  1SFE A;  3LML A;  4DV5 E;  2EN6 A;  3QG5 C;  1X3C A;  2EM9 A;  3HTX A;  4NXM E;  5T6J A;  2ELZ A;  4M0V A;  4WFT A;  4R2R A;  2ENC A;  4TUI A;  2NUG A;  2EPL X;  1PKP A;  2MC5 A;  4F9C B;  5A6B A;  5A6B D;  1FJG E;  5LMN E;  2K7I A;  2EMI A;  3HPZ A;  2EL5 A;  1A1L A;  2E72 A;  2JP9 A;  4M2Z A;  4BBY A;  4MLQ A;  2EOI A;  4GKJ E;  1YZ9 A;  2LUP B;  1YUI A;  3J81 C;  2L8T A;  4FK5 C;  4ZYH A;  1X5W A;  1X49 A;  2L2K B;  2EMZ A;  1NEI A;  3HXL A;  2EOH A;  4JI4 E;  3EPJ A;  3KZZ A;  1A1H A;  2DLQ A;  2E1M A;  4BMJ A;  3VYX A;  2V86 A;  3EPK A;  3KZY A;  1ZU1 A;  4LF6 E;  5A69 A;  4HTG A;  1EH7 A;  2ADR A;  4YHH E;  4F6M A;  5CFF E;  5AAS A;  4X65 E;  3VYY A;  4F6N A;  5IWA E;  2EOR A;  1IQS A;  4JI8 E;  2J7J A;  4JYA E;  1MEY C;  2FV4 B;  4DUY E;  1N32 E;  4F2J C;  4WYQ B;  2LO3 A;  4R8O A;  4DV4 E;  2YRH A;  3JTZ A;  1EKZ A;  2VF1 A;  4J8Z A;  2YPN A;  1XNR E;  4Q28 A;  1XMQ E;  1XMO E;  2EM4 A;  2EJ4 A;  2EMA A;  1F2I G;  2EWL A;  2EMB A;  4K0K E;  2ENA A;  4KWY A;  2D9H A;  2M9A A;  2UUB E;  2EOX A;  4ZYG A;  3EPL A;  2HHH E;  2GLI A;  2EPO A;  1STU A;  1X48 A;  4R2P A;  3LLH A;  2V8Q B;  2JOB A;  1N33 E;  1A1I A;  4R03 A;  2Q8U A;  1ZBQ A;  2EQ0 A;  5AE3 A;  2YTN A;  5KL7 A;  4NHR A;  4WSG A;  3H09 A;  2RTX A;  4R2C A;  3HQ1 A;  1YYW A;  2LT7 A;  2JXP A;  4X8W A;  3F6H A;  2JPA A;  2V87 A;  3OTO E;  1N36 E;  2MKD A;  1TF3 A;  4BHB A;  2EPK X;  5A6K A;  1HNZ E;  2YTP A;  2ENH A;  1X47 A;  3DJW A;  4NXN E;  1HR0 E;  2EPN A;  2YU5 A;  2EMG A;  2G7H A;  2RPC A;  3BF2 A;  4B3M E;  1JK1 A;  5LL6 R;  2EN8 A;  2L6M A;  5IXM B;  2M7Q A;  3J7A G;  2EOS A;  2N3H A;  4F9A B;  2L92 A;  2YTG A;  2V83 A;  3C4T A;  4R2A A;  1MGT A;  3IWD A;  1RQ0 A;  4P7D A;  1JK2 A;  2YWQ A;  4B3S E;  4JI6 E;  2EM2 A;  4O24 A;  1X6E A;  4DV6 E;  4DV3 E;  1XNQ E;  1IQO A;  4X9J A;  2EMX A;  3THN A;  2L33 A;  2VE7 C;  3ADJ A;  4B3T E;  2EOF A;  2RSM A;  4KHP E;  2EML A;  2JR1 A;  2MDR A;  2E5L E;  4GKK E;  4P78 A;  2EN1 A;  2KHX A;  3OML A;  2EM5 A;  2B7V A;  1PJQ A;  4KZS A;  4YY3 E;  1X6F A;  3IWB A;  2LRS A;  4LF8 E;  1TN9 A;  3VK6 A;  4R2E A;  4LF7 E;  4LFC E;  2YTO A;  4IS1 C;  4DR7 E;  2MKN A;  3IWC A;  1J5E E;  3F6G A;  4O43 A;  1GTK A;  3M99 B;  4BCA A;  2JOX A;  2MC6 A;  4X66 E;  2FGG A;  2EOY A;  1BBG A;  4RHB B;  4DV1 E;  3KWR A;  4LFA E;  1WRJ A;  2R76 A;  4HEI A;  4GEQ B;  2EPX A;  2YZT A;  4N4R B;  2DRP A;  2YU8 A;  2BBG A;  1GZ6 A;  2NUE A; 
#chains in the Genus database with same CATH homology
 2MDG A;  2GLI A;  2EOZ A;  1AAY A;  2EP3 A;  1G2F C;  2EMC A;  2EMW A;  2EOE A;  1LLM C;  4R2P A;  2CT1 A;  2DGC A;  2EPP A;  4R2Q A;  2CSH A;  2YTF A;  1A1I A;  4M9V C;  2WBT A;  1NCS A;  1G2D C;  3EPH A;  2EQ0 A;  1ZAA C;  1ZR9 A;  2YTN A;  5KL7 A;  4WSG A;  3UK3 C;  2YRK A;  4R2C A;  1BBO A;  2EN6 A;  2LT7 A;  1X3C A;  2EM0 A;  1KJK A;  2EM9 A;  2DMI A;  2YTD A;  2PRT A;  1X6H A;  2JPA A;  2ELZ A;  2ELY A;  2MKD A;  2ENC A;  5KL2 A;  2EOJ A;  4R2R A;  1TF3 A;  2YTP A;  2LCE A;  1A1F A;  2ENH A;  3MHS C;  5KL5 A;  2EMF A;  2EMI A;  2YRM A;  2EL5 A;  1A1L A;  2YU5 A;  2E72 A;  2EMG A;  2WBS A;  5KL6 A;  2GHF A;  2JP9 A;  2R1F A;  2RPC A;  2EL6 A;  1JK1 A;  1A1J A;  2EMY A;  2EN8 A;  2EOI A;  2EMH A;  2DLK A;  2LV2 A;  2EQ3 A;  1YUI A;  2EOS A;  2BB8 A;  2EM3 A;  2RSI A;  2YTE A;  2YTG A;  1X5W A;  4FK5 C;  4R2A A;  2EMZ A;  2CTD A;  4R2D A;  1JK2 A;  2EN7 A;  2EOH A;  2A25 A;  2EN2 A;  3EPJ A;  2WCC 3;  1DGC A;  1A1H A;  2DLQ A;  2EL4 A;  2EM2 A;  2EPA A;  1X6E A;  2EPR A;  2EOM A;  2EM6 A;  1UN6 B;  2EQ1 A;  4X9J A;  2EMX A;  2YTJ A;  3EPK A;  1ZU1 A;  2EMK A;  4R2S A;  1A1K A;  2EOF A;  2EM8 A;  2ADR A;  2EML A;  2EPZ A;  1YUJ A;  4F6M A;  1BB8 A;  4F6N A;  2NAB A;  2EN1 A;  2EOR A;  3VHT B;  2EM5 A;  1WJP A;  1RMD A;  2J7J A;  5KL3 A;  1X6F A;  1MEY C;  1TN9 A;  2YSP A;  4R2E A;  4GZN C;  4F2J C;  2YSO A;  1B69 A;  2LO3 A;  2YTO A;  4IS1 C;  2MKN A;  1Z1B A;  5KL4 A;  2EN4 A;  2YRH A;  1UBD C;  2HGH A;  2EPU A;  1A1G A;  3M99 B;  1TF6 A;  2EM7 A;  2EOO A;  2YTI A;  2EM4 A;  2EJ4 A;  2YTQ A;  2EN3 A;  2EMA A;  2LVH A;  2EOY A;  1F2I G;  2EMB A;  1P47 A;  1YSA C;  2EPX A;  2EOQ A;  4IJD A;  2EPC A;  2VRD A;  2DRP A;  2ENA A;  2YU8 A;  2EE8 A;  3MHH C;  2D9H A;  2M9A A;  2WBU A;  2EOX A;  3EPL A;  2I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...