2L3CA

Solution structure of adar2 dsrbm1 bound to lsl rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
molecule keywords Double-stranded RNA-specific editase 1
total genus 16
structure length 74
sequence length 74
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3cA00
2JY9A 1XMOE 2MDRA 1DI2A 2L2NA 2NA2A 4YHHE 1I94E 1IBLE 1EKZA 4DR4E 4NXME 2LTRA 2CPNA 2LJHA 4WYQB 4JI4E 4WFTA 2F4VE 1HNZE 1HNWE 4LFAE 4LF8E 2UUCE 1HR0E 4YY3E 4KHPE 1X47A 1T4OA 2UXBE 2L3CA 4DV6E 1X48A 1IBME 3ADIA 3T1HE 3C4TA 4DR2E 2L2KB 1N34E 4DR5E 1UHZA 5LMUE 2L3JA 4LF6E 2UUAE 4JI1E 1XNQE 3HTXA 2UXDE 1YYOA 4JI6E 4B3ME 4LFCE 2NUGA 1IBKE 2B7VA 1O0WA 4M2ZA 3T1YE 1FJGE 4NXNE 3P1XA 4OOGC 2RS7A 4DR3E 1J26A 4X8WA 1HNXE 4DV1E 4OX9E 1XNRE 4JI5E 4B3SE 2VQEE 4LFBE 1YYKA 3ADGA 2JVAA 1N32E 1STUA 4X65E 1RQ0A 2UXCE 2YT4A 4DV2E 2LTSA 4DV4E 1FKAE 1XMQE 2NUFA 2IHR1 2HHHE 4DUYE 4DV3E 2RTXA 3J7Yp 2E5LE 1N33E 4B3RE 4X64E 4M30A 4DV5E 4JI0E 2N3HA 2DIXA 2DB2A 1YYWA 1T4LB 5IWAE 1GQEA 4JV5E 3VYYA 2ZM6E 4DV0E 3C4BA 3LLHA 4DKKA 1QU6A 5BR8E 4DV7E 2UU9E 2L2MA 4K0KE 2LBSB 2KHXA 1WHNA 3ADJA 4DUZE 4JI2E 3ADLA 1J5EE 3VYXA 1RC7A 4DR6E 2RS6A 2RSMA 2LUQA 1T4NA 1PKPA 2VQFE 2UUBE 2EZ6A 4LF7E 1WHQA 2DMYA 4JI3E 1ZBTA 2LUPB 4X66E 2B7TA 5LMNE 2L33A 2N3GA 4LF4E 4DR1E 1YZ9A 2NUEA 4GKJE 3OTOE 4B3TE 4LF5E 2B3TB 1N36E 4X62E 4LF9E 4JI8E 4DR7E 1UILA 5CFFE 4JI7E 1X49A 4AQYE 4JYAE 2LRSA 4GKKE
chains in the Genus database with same CATH superfamily
1JK1A 2L2NA 1I94E 4YHHE 4NXME 2LTRA 1Z1BA 4R2PA 4N4RB 2YTJA 2EPPA 3F6GA 2ENCA 4ZYHA 1HNZE 4WPYA 4LF8E 2UUCE 1TF3A 2CT1A 1X47A 1ZBQA 2EM4A 2EN1A 2DRPA 1T4OA 1X6HA 4HEIA 2L3CA 5A6KA 3C4TA 2L2KB 2K7IA 1UHZA 2ELZA 1DGCA 3MHSC 4WSPA 4JI1E 1XNQE 1YYOA 4JI6E 4WSGA 4B3ME 2EP3A 2WCC3 3T1YE 4NXNE 2EMHA 2RS7A 2V8QB 4F6MA 1P47A 2EE8A 3EPLA 2EM7A 3DF6A 1WXRA 1XNRE 2JR1A 4LTYA 3VHTB 2VQEE 3MSWA 1L4SA 5AE1A 2Q8UA 2BB8A 1RQ0A 2ODRD 2YT4A 2EOZA 4O5GA 1YUIA 1AAYA 4X64E 2EMYA 2LMZA 4DV5E 4BMJA 3FIGA 2EMGA 4Q35B 4ZYGA 4O24A 2EOJA 2EN2A 2VE7C 5IWAE 5LL6R 2EMWA 4BCAA 4JV5E 4DV0E 2EMKA 5BR8E 2EM0A 3HPZA 2FTXB 4JI2E 2EOHA 2YRKA 2EOQA 3THNA 1T39A 5A2QC 2ADRA 2RS6A 4NZVA 5FLXC 2L8TA 4LF7E 4MLQA 4JI3E 2FV4B 5LMNE 2N3GA 2EOSA 2ODRC 4O4KA 3MHHC 5AE3A 5A6BD 2L6MA 1TF6A 2YU5A 2MKDA 4FK5C 2EM8A 4DR7E 2EQ3A 4JYAE 3OMLA 2MKNA 1G2DC 3J80C 2EN6A 4R2EA 1IBLE 2M1SA 4DR4E 1MEYC 1EKZA 4Q28A 2EPMX 2V86A 1EH8A 5LLQA 4JI4E 2YTGA 1HNWE 4LFAE 2V87A 4R8OA 2YSOA 4KHPE 4TUIA 3K6QA 5AC5A 1IBME 2K4VA 4DR2E 4X9JA 1N34E 4DR5E 3UK3C 2VF1A 2RPCA 1KYQA 4BHCA 2WBSA 3F6HA 4L8NA 3P1XA 4OOGC 3VK6A 4GZNC 4DR3E 2JOXA 4X8WA 2JXPA 2EOFA 2E72A 1ZR9A 1N3GA 2G7HA 4B3SE 2EPRA 2EM9A 2EMLA 2EPXA 1YYKA 3ADGA 1RMDA 2EM2A 2JVAA 1MGTA 1YFHA 1YSAC 1PJSA 2YTNA 1FKAE 1XMQE 2EM6A 2D9HA 3AUZA 4DUYE 5A6AA 2RTXA 1X6FA 2E5LE 3J7AG 2WZOA 4B3RE 1EH6A 3LMLA 2EMFA 2EL4A 4BC7A 4R2QA 5IXMB 1A1GA 1YYWA 1BB8A 4WXCA 2YWQA 3BF2A 1AH5A 4F9BB 4DMIA 3IWDA 5IT9C 1PJQA 1GQEA 1A1HA 2EL6A 2I9IA 2R1FA 2YTPA 1PJTA 3HXLA 3C4BA 1QU6A 2HJJA 2L2MA 2KHXA 2A25A 1J5EE 5KL5A 3C6KA 4DR6E 2LUQA 2H36X 1PKPA 2EN3A 4LU9A 2VQFE 1ZAAC 1WRJA 2EZ6A 1SR9A 1WHQA 1NEIA 4M0VA 3KWRA 3DJWA 5KL4A 4LF4E 2CSHA 4DR1E 3BBGA 2J7JA 1GZ6A 2YPNA 1T38A 4LF5E 4X62E 2JP9A 1UILA 4JI7E 2EPAA 3ECRA 4GKKE 2JY9A 4MLVA 1XMOE 2F8BA 2MDRA 4R2AA 1DI2A 2NA2A 2YTEA 4P7DA 2CPNA 4BBYA 2LJHA 2ENHA 2YU8A 2F4VE 2KOUA 4YY3E 2LT7A 4R2RA 3L00A 2EPOA 2UXBE 3ADIA 3T1HE 2FGGA 2BBGA 2E1MA 1TN9A 2EORA 2EL5A 2YTQA 2UUAE 2EN7A 3HTXA 2MC5A 1UN6B 2MC6A 4LFCE 2NUGA 2KONA 2B7VA 1IBKE 3EQ1A 1ZU1A 2CTDA 2DMIA 2RSIA 1IQOA 4ZYEA 2RQLA 4OX9E 4JI5E 5ADZA 4BHBA 4LFBE 1N32E 1STUA 2YTFA 3EPJA 4X65E 1BBOA 2YRHA 3KZYA 2JWOA 2YZTA 2HHHE 2EOIA 2LE2A 3HQ1A 4DV3E 3J7Yp 2EPCA 2YTDA 1NCSA 3IWCA 3J81C 4F9AB 5AASA 1WJPA 4M30A 4KZSA 4JI0E 2N3HA 2DIXA 4R2CA 1QNTA 5KL6A 5AC4A 4IJDA 1T4LB 2EPZA 2LVHA 4BC9A 2JPAA 2WBTA 1LLMC 1UBDC 1GTKA 5TSEA 1A1FA 2UU9E 2EPUA 4K0KE 1A1LA 2LBSB 3BIDA 1WHNA 3VYXA 1A1JA 2EN4A 4P78A 2EOXA 2WBUA 2EMXA 3BGHA 1RC7A 2N8XA 4HTGA 2MDGA 2RSMA 3EPKA 1A1KA 2DGCA 2I13A 4WXDA 2DMYA 2EJ4A 1ZBTA 2LUPB 2B7TA 2EPNA 2M9AA 2NUEA 1IQSA 3OTOE 4B3TE 2B3TB 1N36E 2EWLA 5KL2A 4WX9A 5KL7A 2YTOA 4JI8E 5CFFE 2LRSA 2PRTA 1B69A 2GHFA 4R03A 5A6JA 2EOEA 1KJKA 2EMIA 2V83A 3EPHA 2M7QA 4RHBB 2GPIA 2VRDA 4WYQB 2EMBA 4WFTA 1DQ3A 1HR0E 2EPKX 2YSPA 3JAMC 2DLQA 2LCEA 4DV6E 1X48A 2V85A 2LV2A 4F6NA 2EN8A 4IS1C 5LMUE 2ENAA 2L3JA 2LO3A 4LF6E 3RMPA 5KL3A 2UXDE 4F54A 3ZOQB 3TQMA 4F2JC 5DNYA 4M2ZA 1O0WA 1FJGE 1BBGA 1J26A 3HPSA 2DSYA 2GLIA 2EMAA 4DV1E 4J8ZA 4I8OA 2V89A 3QG5C 2EMZA 3THOB 1A1IA 1X6EA 4ZYDA 5A6BA 3AV0A 2UXCE 1YPNA 4BS9A 2LTSA 4R2SA 4DV2E 4DV4E 2NUFA 2IHR1 2HGHA 1SFEA 1N33E 2HC5A 2JOBA 2EOOA 2R76A 2JYAA 1X3CA 2DB2A 4TUGA 1JK2A 5AE2A 5F3WA 2EQ0A 3JTZA 3KZZA 4F9CB 3VYYA 5IV8B 2ZM6E 3LLHA 4DKKA 4RH8A 5T6JA 4DV7E 3JU0A 3ADJA 4DUZE 3ADLA 2EQ1A 2YTIA 2EOYA 3C6MA 2LJUA 2M4IA 2YRMA 3M99B 5A69A 1T4NA 2EM3A 1G2FC 2UUBE 2DLKA 4M9VC 2L92A 2EPLX 2EM5A 4X66E 2L33A 2V88A 2ELYA 3H09A 1YUJA 4L5NC 1YZ9A 2NABA 4O43A 4GEQB 4GKJE 2EOMA 4LF9E 1EH7A 1PDAA 2EMCA 4NHRA 4R2DA 3IWBA 1X5WA 1X49A 2B9DA 4AQYE 4KWYA 1F2IG 1HNXE 1IMUA
chains in the Genus database with same CATH topology
2JY9A 1XMOE 2F8BA 2MDRA 4R03A 3J80C 1DI2A 2L2NA 2M1SA 2NA2A 4YHHE 4P7DA 1I94E 1IBLE 1EKZA 2V83A 4Q28A 4DR4E 4NXME 2LTRA 2M7QA 2CPNA 4BBYA 2LJHA 2V86A 4WYQB 4JI4E 4WFTA 3F6GA 1HNZE 2F4VE 1HNWE 4WPYA 4LFAE 2V87A 4R8OA 2UUCE 2KOUA 4LF8E 1DQ3A 1HR0E 4YY3E 4KHPE 1X47A 1ZBQA 1T4OA 3JAMC 4TUIA 3K6QA 2UXBE 2L3CA 4DV6E 1X48A 2V85A 1IBME 3ADIA 2K4VA 3C4TA 3T1HE 4DR2E 2FGGA 2E1MA 2L2KB 1N34E 4DR5E 1UHZA 5LMUE 2L3JA 4WSPA 4LF6E 2UUAE 3RMPA 4JI1E 1XNQE 3HTXA 4F54A 2UXDE 3ZOQB 1YYOA 4JI6E 2VF1A 2MC5A 5DNYA 2MC6A 4B3ME 4LFCE 2NUGA 2KONA 2B7VA 1O0WA 3F6HA 3T1YE 1IBKE 4M2ZA 1FJGE 4L8NA 4NXNE 3P1XA 4OOGC 2RS7A 3VK6A 4DR3E 2JOXA 2V8QB 4X8WA 3VYXA 1J26A 3HPSA 2DSYA 1HNXE 4DV1E 3DF6A 4J8ZA 1WXRA 4OX9E 1XNRE 2JR1A 4JI5E 4LTYA 2G7HA 5ADZA 4B3SE 4I8OA 2V89A 2VQEE 4LFBE 3MSWA 1YYKA 3ADGA 2JVAA 1N32E 1STUA 5AE1A 4X65E 1RQ0A 3AV0A 2ODRD 2UXCE 4BS9A 2JWOA 2LTSA 2YT4A 4DV2E 4DV4E 1FKAE 1XMQE 2NUFA 2IHR1 2YZTA 3AUZA 2HHHE 4DUYE 2LE2A 3HQ1A 4DV3E 2RTXA 3J7Yp 2E5LE 1N33E 3J7AG 2JOBA 2WZOA 4B3RE 3IWCA 4X64E 3LMLA 3J81C 4F9AB 2LMZA 5AASA 4M30A 4KZSA 4DV5E 4JI0E 2N3HA 2DIXA 4BC7A 2DB2A 4TUGA 4BMJA 3FIGA 1YYWA 5AE2A 5F3WA 1T4LB 4F9BB 4BC9A 2VE7C 4DMIA 3IWDA 5LL6R 5IWAE 3JTZA 5IT9C 1GQEA 4BCAA 4F9CB 3VYYA 4JV5E 2ZM6E 4DV0E 3HXLA 3C4BA 3LLHA 4DKKA 1QU6A 5T6JA 5BR8E 4DV7E 2UU9E 2L2MA 3HPZA 4K0KE 2FTXB 2KHXA 1WHNA 3ADJA 3JU0A 4DUZE 2LBSB 1J5EE 4JI2E 4P78A 3ADLA 1RC7A 4DR6E 5A2QC 2RS6A 2M4IA 2RSMA 2LUQA 1T4NA 2H36X 1PKPA 2VQFE 4LU9A 2UUBE 2L92A 2EZ6A 1SR9A 5FLXC 2L8TA 4LF7E 1WHQA 2DMYA 4JI3E 2FV4B 1ZBTA 2LUPB 4M0VA 3KWRA 2B7TA 4X66E 5LMNE 2L33A 2N3GA 3DJWA 2ODRC 2V88A 4LF4E 3H09A 5AE3A 4DR1E 4L5NC 1YZ9A 2NUEA 4GEQB 1GZ6A 4GKJE 3OTOE 2L6MA 4B3TE 4LF5E 2B3TB 1N36E 4X62E 2EWLA 4LF9E 4JI8E 4DR7E 1UILA 3IWBA 5CFFE 2B9DA 1X49A 4JI7E 4AQYE 4JYAE 2LRSA 3OMLA 4GKKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY9 A;  1XMO E;  2MDR A;  1DI2 A;  2L2N A;  2NA2 A;  4YHH E;  1I94 E;  1IBL E;  1EKZ A;  4DR4 E;  4NXM E;  2LTR A;  2CPN A;  2LJH A;  4WYQ B;  4JI4 E;  4WFT A;  2F4V E;  1HNZ E;  1HNW E;  4LFA E;  4LF8 E;  2UUC E;  1HR0 E;  4YY3 E;  4KHP E;  1X47 A;  1T4O A;  2UXB E;  2L3C A;  4DV6 E;  1X48 A;  1IBM E;  3ADI A;  3T1H E;  3C4T A;  4DR2 E;  2L2K B;  1N34 E;  4DR5 E;  1UHZ A;  5LMU E;  2L3J A;  4LF6 E;  2UUA E;  4JI1 E;  1XNQ E;  3HTX A;  2UXD E;  1YYO A;  4JI6 E;  4B3M E;  4LFC E;  2NUG A;  1IBK E;  2B7V A;  1O0W A;  4M2Z A;  3T1Y E;  1FJG E;  4NXN E;  3P1X A;  4OOG C;  2RS7 A;  4DR3 E;  1J26 A;  4X8W A;  1HNX E;  4DV1 E;  4OX9 E;  1XNR E;  4JI5 E;  4B3S E;  2VQE E;  4LFB E;  1YYK A;  3ADG A;  2JVA A;  1N32 E;  1STU A;  4X65 E;  1RQ0 A;  2UXC E;  2YT4 A;  4DV2 E;  2LTS A;  4DV4 E;  1FKA E;  1XMQ E;  2NUF A;  2IHR 1;  2HHH E;  4DUY E;  4DV3 E;  2RTX A;  3J7Y p;  2E5L E;  1N33 E;  4B3R E;  4X64 E;  4M30 A;  4DV5 E;  4JI0 E;  2N3H A;  2DIX A;  2DB2 A;  1YYW A;  1T4L B;  5IWA E;  1GQE A;  4JV5 E;  3VYY A;  2ZM6 E;  4DV0 E;  3C4B A;  3LLH A;  4DKK A;  1QU6 A;  5BR8 E;  4DV7 E;  2UU9 E;  2L2M A;  4K0K E;  2LBS B;  2KHX A;  1WHN A;  3ADJ A;  4DUZ E;  4JI2 E;  3ADL A;  1J5E E;  3VYX A;  1RC7 A;  4DR6 E;  2RS6 A;  2RSM A;  2LUQ A;  1T4N A;  1PKP A;  2VQF E;  2UUB E;  2EZ6 A;  4LF7 E;  1WHQ A;  2DMY A;  4JI3 E;  1ZBT A;  2LUP B;  4X66 E;  2B7T A;  5LMN E;  2L33 A;  2N3G A;  4LF4 E;  4DR1 E;  1YZ9 A;  2NUE A;  4GKJ E;  3OTO E;  4B3T E;  4LF5 E;  2B3T B;  1N36 E;  4X62 E;  4LF9 E;  4JI8 E;  4DR7 E;  1UIL A;  5CFF E;  4JI7 E;  1X49 A;  4AQY E;  4JYA E;  2LRS A;  4GKK E; 
#chains in the Genus database with same CATH topology
 1JK1 A;  2L2N A;  1I94 E;  4YHH E;  4NXM E;  2LTR A;  1Z1B A;  4R2P A;  4N4R B;  2YTJ A;  2EPP A;  3F6G A;  2ENC A;  4ZYH A;  1HNZ E;  4WPY A;  4LF8 E;  2UUC E;  1TF3 A;  2CT1 A;  1X47 A;  1ZBQ A;  2EM4 A;  2EN1 A;  2DRP A;  1T4O A;  1X6H A;  4HEI A;  2L3C A;  5A6K A;  3C4T A;  2L2K B;  2K7I A;  1UHZ A;  2ELZ A;  1DGC A;  3MHS C;  4WSP A;  4JI1 E;  1XNQ E;  1YYO A;  4JI6 E;  4WSG A;  4B3M E;  2EP3 A;  2WCC 3;  3T1Y E;  4NXN E;  2EMH A;  2RS7 A;  2V8Q B;  4F6M A;  1P47 A;  2EE8 A;  3EPL A;  2EM7 A;  3DF6 A;  1WXR A;  1XNR E;  2JR1 A;  4LTY A;  3VHT B;  2VQE E;  3MSW A;  1L4S A;  5AE1 A;  2Q8U A;  2BB8 A;  1RQ0 A;  2ODR D;  2YT4 A;  2EOZ A;  4O5G A;  1YUI A;  1AAY A;  4X64 E;  2EMY A;  2LMZ A;  4DV5 E;  4BMJ A;  3FIG A;  2EMG A;  4Q35 B;  4ZYG A;  4O24 A;  2EOJ A;  2EN2 A;  2VE7 C;  5IWA E;  5LL6 R;  2EMW A;  4BCA A;  4JV5 E;  4DV0 E;  2EMK A;  5BR8 E;  2EM0 A;  3HPZ A;  2FTX B;  4JI2 E;  2EOH A;  2YRK A;  2EOQ A;  3THN A;  1T39 A;  5A2Q C;  2ADR A;  2RS6 A;  4NZV A;  5FLX C;  2L8T A;  4LF7 E;  4MLQ A;  4JI3 E;  2FV4 B;  5LMN E;  2N3G A;  2EOS A;  2ODR C;  4O4K A;  3MHH C;  5AE3 A;  5A6B D;  2L6M A;  1TF6 A;  2YU5 A;  2MKD A;  4FK5 C;  2EM8 A;  4DR7 E;  2EQ3 A;  4JYA E;  3OML A;  2MKN A;  1G2D C;  3J80 C;  2EN6 A;  4R2E A;  1IBL E;  2M1S A;  4DR4 E;  1MEY C;  1EKZ A;  4Q28 A;  2EPM X;  2V86 A;  1EH8 A;  5LLQ A;  4JI4 E;  2YTG A;  1HNW E;  4LFA E;  2V87 A;  4R8O A;  2YSO A;  4KHP E;  4TUI A;  3K6Q A;  5AC5 A;  1IBM E;  2K4V A;  4DR2 E;  4X9J A;  1N34 E;  4DR5 E;  3UK3 C;  2VF1 A;  2RPC A;  1KYQ A;  4BHC A;  2WBS A;  3F6H A;  4L8N A;  3P1X A;  4OOG C;  3VK6 A;  4GZN C;  4DR3 E;  2JOX A;  4X8W A;  2JXP A;  2EOF A;  2E72 A;  1ZR9 A;  1N3G A;  2G7H A;  4B3S E;  2EPR A;  2EM9 A;  2EML A;  2EPX A;  1YYK A;  3ADG A;  1RMD A;  2EM2 A;  2JVA A;  1MGT A;  1YFH A;  1YSA C;  1PJS A;  2YTN A;  1FKA E;  1XMQ E;  2EM6 A;  2D9H A;  3AUZ A;  4DUY E;  5A6A A;  2RTX A;  1X6F A;  2E5L E;  3J7A G;  2WZO A;  4B3R E;  1EH6 A;  3LML A;  2EMF A;  2EL4 A;  4BC7 A;  4R2Q A;  5IXM B;  1A1G A;  1YYW A;  1BB8 A;  4WXC A;  2YWQ A;  3BF2 A;  1AH5 A;  4F9B B;  4DMI A;  3IWD A;  5IT9 C;  1PJQ A;  1GQE A;  1A1H A;  2EL6 A;  2I9I A;  2R1F A;  2YTP A;  1PJT A;  3HXL A;  3C4B A;  1QU6 A;  2HJJ A;  2L2M A;  2KHX A;  2A25 A;  1J5E E;  5KL5 A;  3C6K A;  4DR6 E;  2LUQ A;  2H36 X;  1PKP A;  2EN3 A;  4LU9 A;  2VQF E;  1ZAA C;  1WRJ A;  2EZ6 A;  1SR9 A;  1WHQ A;  1NEI A;  4M0V A;  3KWR A;  3DJW A;  5KL4 A;  4LF4 E;  2CSH A;  4DR1 E;  3BBG A;  2J7J A;  1GZ6 A;  2YPN A;  1T38 A;  4LF5 E;  4X62 E;  2JP9 A;  1UIL A;  4JI7 E;  2EPA A;  3ECR A;  4GKK E;  2JY9 A;  4MLV A;  1XMO E;  2F8B A;  2MDR A;  4R2A A;  1DI2 A;  2NA2 A;  2YTE A;  4P7D A;  2CPN A;  4BBY A;  2LJH A;  2ENH A;  2YU8 A;  2F4V E;  2KOU A;  4YY3 E;  2LT7 A;  4R2R A;  3L00 A;  2EPO A;  2UXB E;  3ADI A;  3T1H E;  2FGG A;  2BBG A;  2E1M A;  1TN9 A;  2EOR A;  2EL5 A;  2YTQ A;  2UUA E;  2EN7 A;  3HTX A;  2MC5 A;  1UN6 B;  2MC6 A;  4LFC E;  2NUG A;  2KON A;  2B7V A;  1IBK E;  3EQ1 A;  1ZU1 A;  2CTD A;  2DMI A;  2RSI A;  1IQO A;  4ZYE A;  2RQL A;  4OX9 E;  4JI5 E;  5ADZ A;  4BHB A;  4LFB E;  1N32 E;  1STU A;  2YTF A;  3EPJ A;  4X65 E;  1BBO A;  2YRH A;  3KZY A;  2JWO A;  2YZT A;  2HHH E;  2EOI A;  2LE2 A;  3HQ1 A;  4DV3 E;  3J7Y p;  2EPC A;  2YTD A;  1NCS A;  3IWC A;  3J81 C;  4F9A B;  5AAS A;  1WJP A;  4M30 A;  4KZS A;  4JI0 E;  2N3H A;  2DIX A;  4R2C A;  1QNT A;  5KL6 A;  5AC4 A;  4IJD A;  1T4L B;  2EPZ A;  2LVH A;  4BC9 A;  2JPA A;  2WBT A;  1LLM C;  1UBD C;  1GTK A;  5TSE A;  1A1F A;  2UU9 E;  2EPU A;  4K0K E;  1A1L A;  2LBS B;  3BID A;  1WHN A;  3VYX A;  1A1J A;  2EN4 A;  4P78 A;  2EOX A;  2WBU A;  2EMX A;  3BGH A;  1RC7 A;  2N8X A;  4HTG A;  2MDG A;  2RSM A;  3EPK A;  1A1K A;  2DGC A;  2I13 A;  4WXD A;  2DMY A;  2EJ4 A;  1ZBT A;  2LUP B;  2B7T A;  2EPN A;  2M9A A;  2NUE A;  1IQS A;  3OTO E;  4B3T E;  2B3T B;  1N36 E;  2EWL A;  5KL2 A;  4WX9 A;  5KL7 A;  2YTO A;  4JI8 E;  5CFF E;  2LRS A;  2PRT A;  1B69 A;  2GHF A;  4R03 A;  5A6J A;  2EOE A;  1KJK A;  2EMI A;  2V83 A;  3EPH A;  2M7Q A;  4RHB B;  2GPI A;  2VRD A;  4WYQ B;  2EMB A;  4WFT A;  1DQ3 A;  1HR0 E;  2EPK X;  2YSP A;  3JAM C;  2DLQ A;  2LCE A;  4DV6 E;  1X48 A;  2V85 A;  2LV2 A;  4F6N A;  2EN8 A;  4IS1 C;  5LMU E;  2ENA A;  2L3J A;  2LO3 A;  4LF6 E;  3RMP A;  5KL3 A;  2UXD E;  4F54 A;  3ZOQ B;  3TQM A;  4F2J C;  5DNY A;  4M2Z A;  1O0W A;  1FJG E;  1BBG A;  1J26 A;  3HPS A;  2DSY A;  2GLI A;  2EMA A;  4DV1 E;  4J8Z A;  4I8O A;  2V89 A;  3QG5 C;  2EMZ A;  3THO B;  1A1I A;  1X6E A;  4ZYD A;  5A6B A;  3AV0 A;  2UXC E;  1YPN A;  4BS9 A;  2LTS A;  4R2S A;  4DV2 E;  4DV4 E;  2NUF A;  2IHR 1;  2HGH A;  1SFE A;  1N33 E;  2HC5 A;  2JOB A;  2EOO A;  2R76 A;  2JYA A;  1X3C A;  2DB2 A;  4TUG A;  1JK2 A;  5AE2 A;  5F3W A;  2EQ0 A;  3JTZ A;  3KZZ A;  4F9C B;  3VYY A;  5IV8 B;  2ZM6 E;  3LLH A;  4DKK A;  4RH8 A;  5T6J A;  4DV7 E;  3JU0 A;  3ADJ A;  4DUZ E;  3ADL A;  2EQ1 A;  2YTI A;  2EOY A;  3C6M A;  2LJU A;  2M4I A;  2YRM A;  3M99 B;  5A69 A;  1T4N A;  2EM3 A;  1G2F C;  2UUB E;  2DLK A;  4M9V C;  2L92 A;  2EPL X;  2EM5 A;  4X66 E;  2L33 A;  2V88 A;  2ELY A;  3H09 A;  1YUJ A;  4L5N C;  1YZ9 A;  2NAB A;  4O43 A;  4GEQ B;  4GKJ E;  2EOM A;  4LF9 E;  1EH7 A;  1PDA A;  2EMC A;  4NHR A;  4R2D A;  3IWB A;  1X5W A;  1X49 A;  2B9D A;  4AQY E;  4KWY A;  1F2I G;  1HNX E;  1IMU A; 
#chains in the Genus database with same CATH homology
 2JY9 A;  1XMO E;  2F8B A;  2MDR A;  4R03 A;  3J80 C;  1DI2 A;  2L2N A;  2M1S A;  2NA2 A;  4YHH E;  4P7D A;  1I94 E;  1IBL E;  1EKZ A;  2V83 A;  4Q28 A;  4DR4 E;  4NXM E;  2LTR A;  2M7Q A;  2CPN A;  4BBY A;  2LJH A;  2V86 A;  4WYQ B;  4JI4 E;  4WFT A;  3F6G A;  1HNZ E;  2F4V E;  1HNW E;  4WPY A;  4LFA E;  2V87 A;  4R8O A;  2UUC E;  2KOU A;  4LF8 E;  1DQ3 A;  1HR0 E;  4YY3 E;  4KHP E;  1X47 A;  1ZBQ A;  1T4O A;  3JAM C;  4TUI A;  3K6Q A;  2UXB E;  2L3C A;  4DV6 E;  1X48 A;  2V85 A;  1IBM E;  3ADI A;  2K4V A;  3C4T A;  3T1H E;  4DR2 E;  2FGG A;  2E1M A;  2L2K B;  1N34 E;  4DR5 E;  1UHZ A;  5LMU E;  2L3J A;  4WSP A;  4LF6 E;  2UUA E;  3RMP A;  4JI1 E;  1XNQ E;  3HTX A;  4F54 A;  2UXD E;  3ZOQ B;  1YYO A;  4JI6 E;  2VF1 A;  2MC5 A;  5DNY A;  2MC6 A;  4B3M E;  4LFC E;  2NUG A;  2KON A;  2B7V A;  1O0W A;  3F6H A;  3T1Y E;  1IBK E;  4M2Z A;  1FJG E;  4L8N A;  4NXN E;  3P1X A;  4OOG C;  2RS7 A;  3VK6 A;  4DR3 E;  2JOX A;  2V8Q B;  4X8W A;  3VYX A;  1J26 A;  3HPS A;  2DSY A;  1HNX E;  4DV1 E;  3DF6 A;  4J8Z A;  1WXR A;  4OX9 E;  1XNR E;  2JR1 A;  4JI5 E;  4LTY A;  2G7H A;  5ADZ A;  4B3S E;  4I8O A;  2V89 A;  2VQE E;  4LFB E;  3MSW A;  1YYK A;  3ADG A;  2JVA A;  1N32 E;  1STU A;  5AE1 A;  4X65 E;  1RQ0 A;  3AV0 A;  2ODR D;  2UXC E;  4BS9 A;  2JWO A;  2LTS A;  2YT4 A;  4DV2 E;  4DV4 E;  1FKA E;  1XMQ E;  2NUF A;  2IHR 1;  2YZT A;  3AUZ A;  2HHH E;  4DUY E;  2LE2 A;  3HQ1 A;  4DV3 E;  2RTX A;  3J7Y p;  2E5L E;  1N33 E;  3J7A G;  2JOB A;  2WZO A;  4B3R E;  3IWC A;  4X64 E;  3LML A;  3J81 C;  4F9A B;  2LMZ A;  5AAS A;  4M30 A;  4KZS A;  4DV5 E;  4JI0 E;  2N3H A;  2DIX A;  4BC7 A;  2DB2 A;  4TUG A;  4BMJ A;  3FIG A;  1YYW A;  5AE2 A;  5F3W A;  1T4L B;  4F9B B;  4BC9 A;  2VE7 C;  4DMI A;  3IWD A;  5LL6 R;  5IWA E;  3JTZ A;  5IT9 C;  1GQE A;  4BCA A;  4F9C B;  3VYY A;  4JV5 E;  2ZM6 E;  4DV0 E;  3HXL A;  3C4B A;  3LLH A;  4DKK A;  1QU6 A;  5T6J A;  5BR8 E;  4DV7 E;  2UU9 E;  2L2M A;  3HPZ A;  4K0K E;  2FTX B;  2KHX A;  1WHN A;  3ADJ A;  3JU0 A;  4DUZ E;  2LBS B;  1J5E E;  4JI2 E;  4P78 A;  3ADL A;  1RC7 A;  4DR6 E;  5A2Q C;  2RS6 A;  2M4I A;  2RSM A;  2LUQ A;  1T4N A;  2H36 X;  1PKP A;  2VQF E;  4LU9 A;  2UUB E;  2L92 A;  2EZ6 A;  1SR9 A;  5FLX C;  2L8T A;  4LF7 E;  1WHQ A;  2DMY A;  4JI3 E;  2FV4 B;  1ZBT A;  2LUP B;  4M0V A;  3KWR A;  2B7T A;  4X66 E;  5LMN E;  2L33 A;  2N3G A;  3DJW A;  2ODR C;  2V88 A;  4LF4 E;  3H09 A;  5AE3 A;  4DR1 E;  4L5N C;  1YZ9 A;  2NUE A;  4GEQ B;  1GZ6 A;  4GKJ E;  3OTO E;  2L6M A;  4B3T E;  4LF5 E;  2B3T B;  1N36 E;  4X62 E;  2EWL A;  4LF9 E;  4JI8 E;  4DR7 E;  1UIL A;  3IWB A;  5CFF E;  2B9D A;  1X49 A;  4JI7 E;  4AQY E;  4JYA E;  2LRS A;  3OML A;  4GKK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...