2L3CA

Solution structure of adar2 dsrbm1 bound to lsl rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
total genus 16
structure length 74
sequence length 74
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3cA00
4DR6E 2LUPB 4M2ZA 3ADJA 2UXBE 2B7TA 1RQ0A 1YZ9A 2UXCE 4NXME 2UUCE 4DR7E 3ADIA 5CFFE 1WHNA 2YT4A 4DV4E 4JYAE 2LJHA 4JI3E 4DUZE 1T4NA 1EKZA 3P1XA 3VYYA 2UU9E 4DKKA 2JY9A 4KHPE 1ZBTA 2B7VA 4DV6E 4JI6E 1XNRE 5BR8E 1X47A 3HTXA 2L2MA 4DV0E 5LMNE 4YHHE 4DR3E 4K0KE 1J26A 1UILA 1FJGE 1RC7A 2LBSB 2RS7A 4JI0E 2HHHE 2DIXA 2L3CA 2RTXA 1O0WA 1IBLE 4LF7E 2B3TB 1T4LB 4DV7E 4JI5E 1PKPA 2VQFE 1N33E 2IHR1 1WHQA 2KHXA 3T1HE 4JI7E 1T4OA 4NXNE 4GKKE 4JI1E 4DR1E 3T1YE 2L2KB 4JI2E 4JI4E 4DR2E 1HNWE 2DB2A 1XMQE 4JV5E 1N32E 2F4VE 2UUAE 2UXDE 4AQYE 2EZ6A 1XNQE 4B3SE 2L3JA 4DUYE 2JVAA 4OOGC 2LTSA 3ADLA 2NUEA 4DV3E 1IBME 4B3RE 2E5LE 4LFCE 2NUGA 1QU6A 2VQEE 3LLHA 2DMYA 2MDRA 1N36E 1HR0E 1STUA 3ADGA 1DI2A 2L33A 3J7Yp 4B3ME 4LF6E 4DR4E 2CPNA 4WYQB 2NUFA 2LUQA 4X65E 3OTOE 1J5EE 4LF9E 1XMOE 2LTRA 2ZM6E 1IBKE 2RSMA 1FKAE 4WFTA 4DV5E 4M30A 1YYKA 1I94E 1N34E 4LF5E 3VYXA 4LFBE 1UHZA 2L2NA 2N3GA 3C4BA 4X64E 4YY3E 1X48A 2LRSA 4X8WA 4DR5E 4X66E 1HNZE 1X49A 1GQEA 5IWAE 2N3HA 3C4TA 1YYOA 2NA2A 1HNXE 4GKJE 4DV2E 4LFAE 4JI8E 4B3TE 4X62E 5LMUE 2UUBE 2RS6A 4LF8E 4OX9E 1YYWA 4LF4E 4DV1E
chains in the Genus database with same CATH superfamily
5KL5A 2EN6A 3ADJA 4BC7A 2JWOA 1GZ6A 4TUIA 3MHHC 4BHBA 2UUCE 1LLMC 2YTFA 3BF2A 2EPLX 4DV4E 3FIGA 4F9BB 2LJHA 2JXPA 5AE3A 3KZZA 4DKKA 4KHPE 4DV6E 2DGCA 2L2MA 5KL4A 4YHHE 2HC5A 1FJGE 2YU8A 3F6HA 4R2SA 2JPAA 2F8BA 4JI0E 4R2PA 2DIXA 1YUIA 1IBLE 2HGHA 2DLQA 4L8NA 4JI5E 2ELZA 3HQ1A 1N33E 3EPLA 2IHR1 1WHQA 1T4OA 1ZU1A 2EL6A 2L2KB 2EPMX 4NHRA 4R03A 4DR2E 2EQ1A 2LVHA 2K7IA 2EORA 3EQ1A 4HEIA 2EM5A 1N32E 2F4VE 2YSOA 1X6EA 2L8TA 1EH8A 2UUAE 1YUJA 2V89A 1XNQE 2V87A 2YTDA 2ENCA 2LO3A 1G2DC 2EM3A 2GHFA 4OOGC 3ADLA 4IJDA 4DV3E 1WXRA 1P47A 4LFCE 2M4IA 2NUGA 2H36X 2DMYA 1N36E 4B3ME 2EOIA 2I13A 4LF6E 3EPHA 4DR4E 2NUFA 2LUQA 2EJ4A 4R2RA 3C6KA 3HPSA 2L6MA 2A25A 2V83A 1T39A 2LJUA 2DRPA 2YRKA 3AV0A 4MLVA 2FGGA 2WBTA 4F54A 2JOBA 5AC5A 1I94E 4GEQB 2ODRC 3C4BA 1AAYA 1YFHA 3IWBA 1GQEA 2EOFA 4R2AA 1WJPA 2N3HA 3C4TA 2EE8A 1YYOA 1A1GA 2EOZA 2WZOA 3HPZA 3IWCA 2EMZA 1YPNA 2GPIA 5TSEA 5LMUE 2EQ3A 5A6KA 4WSPA 3LMLA 4P78A 5T6JA 1X3CA 3KZYA 3ZOQB 4WSGA 2D9HA 5A6JA 2CT1A 2E72A 2LUPB 4I8OA 4O5GA 2UXBE 2YTJA 5FLXC 4DR7E 5CFFE 2YT4A 4ZYGA 4JYAE 1A1KA 2YWQA 1GTKA 3L00A 5A6AA 4R2EA 2NABA 2JY9A 2B7VA 1JK1A 5BR8E 2EM8A 1X47A 3TQMA 4J8ZA 2YSPA 1J26A 2EOOA 1Z1BA 2YTGA 1RC7A 2RS7A 5KL2A 1NEIA 2HHHE 2RTXA 1O0WA 2YZTA 1NCSA 3C6MA 1PKPA 2EMFA 2KHXA 2RSIA 4JI7E 2EMGA 3DJWA 3T1YE 2EMLA 2JOXA 2EM2A 4JI4E 4LTYA 1SR9A 2EMXA 5AE2A 4JV5E 2YU5A 5LLQA 5A2QC 2EM6A 3RMPA 4TUGA 4B3SE 3UK3C 2ENHA 2MKDA 3MSWA 2CTDA 2ELYA 2V86A 1QU6A 2VQEE 1B69A 3THNA 1DI2A 1STUA 2BBGA 2CPNA 1IQOA 4R2QA 4X65E 2EMHA 2EPZA 4BMJA 2EMIA 4LF9E 2LTRA 1BBGA 2EM9A 2ZM6E 1IBKE 1FKAE 1DQ3A 4BBYA 2EOJA 4M30A 2R1FA 2EOXA 1YYKA 4LF5E 3VYXA 1DGCA 1PJQA 5F3WA 4X64E 2YTPA 4ZYHA 2LRSA 3EPJA 4F6MA 4M0VA 5IWAE 1BBOA 2JP9A 5KL6A 2EN7A 2EOHA 4ZYEA 4DMIA 4DV2E 2BB8A 4JI8E 4B3TE 5ADZA 2EMYA 2WBSA 4OX9E 4Q35B 2EOSA 2EOEA 4LFBE 4DR6E 4LU9A 3ECRA 2B7TA 2MDGA 1RQ0A 1YZ9A 2UXCE 4NXME 2EM4A 1A1JA 4R8OA 3ADIA 4DUZE 4O24A 1EKZA 5AE1A 1RMDA 4Q28A 2FTXB 4KWYA 5IXMB 2LMZA 1T38A 3HTXA 1IMUA 2WCC3 4DR3E 4K0KE 1UILA 4KZSA 3J7AG 2YTOA 2M7QA 4LF7E 4ZYDA 2B3TB 1T4LB 1YSAC 2EL5A 2EN1A 1A1LA 1BB8A 3T1HE 4JI1E 1F2IG 2M1SA 2EPNA 3JAMC 1JK2A 3THOB 2ENAA 2YTEA 3HXLA 1A1HA 4M9VC 1HNWE 1XMQE 2EPUA 1PJSA 2EMCA 5A6BD 2LV2A 2VF1A 2EN2A 1A1FA 1UBDC 2EM7A 1QNTA 4DUYE 2DMIA 2JVAA 2DLKA 2LTSA 4HTGA 2ADRA 2VE7C 4B3RE 1IQSA 4X9JA 5IV8B 2JR1A 3QG5C 1KJKA 1TF3A 4WXDA 3LLHA 2MDRA 2EN8A 1HR0E 2YTNA 2L33A 2EMWA 3J7Yp 3OMLA 3EPKA 4WYQB 5KL3A 3OTOE 4RH8A 4F6NA 2R76A 2EPRA 1XMOE 4R2CA 3DF6A 3BGHA 1PJTA 4DV1E 4BC9A 4BCAA 4DV5E 1SFEA 2LE2A 2KONA 3J81C 1N34E 2WBUA 2L92A 1A1IA 2L2NA 1N3GA 3JU0A 4X8WA 1KYQA 4DR5E 4X66E 4F9AB 1TN9A 4O43A 4N4RB 5LL6R 2NA2A 2EOQA 2G7HA 2ODRD 3H09A 1ZBQA 4LF8E 2RS6A 2MKNA 1G2FC 2YRMA 5AASA 2EPOA 3BIDA 4M2ZA 2M9AA 5A6BA 2EM0A 2EOMA 1PDAA 1WHNA 3M99B 4JI3E 1X6HA 1T4NA 2MC6A 4GZNC 3P1XA 3VYYA 3F6GA 4NZVA 2EN4A 2GLIA 2UU9E 1ZBTA 4WXCA 4JI6E 1WRJA 1XNRE 2YTQA 2EPPA 1L4SA 2V8QB 4DV0E 5LMNE 5IT9C 5DNYA 3JTZA 4O4KA 2LBSB 2EPAA 4MLQA 2L3CA 2EMAA 2YTIA 2RPCA 1EH6A 2EOYA 4DV7E 2RQLA 2VQFE 4IS1C 3VK6A 4NXNE 4GKKE 2I9IA 3AUZA 4DR1E 4RHBB 1MEYC 3BBGA 2V88A 2EN3A 4JI2E 4P7DA 2CSHA 2B9DA 2DB2A 2K4VA 2UXDE 2EL4A 4AQYE 2EZ6A 2EMBA 3VHTB 2L3JA 2PRTA 1MGTA 4R2DA 2FV4B 2NUEA 2EPXA 4FK5C 1IBME 2V85A 2E5LE 1ZR9A 4BS9A 2YPNA 2EPKX 2JYAA 3ADGA 2LCEA 2EP3A 2N8XA 1X6FA 1UN6B 1J5EE 2HJJA 3MHSC 2DSYA 2MC5A 2VRDA 2RSMA 2EPCA 4WFTA 1EH7A 2J7JA 2Q8UA 5KL7A 2E1MA 1UHZA 3J80C 4WPYA 2EWLA 2N3GA 4YY3E 1X48A 1X5WA 3IWDA 4L5NC 2EQ0A 1ZAAC 2LT7A 1X49A 4F9CB 1HNZE 4F2JC 2EMKA 5A69A 1HNXE 4GKJE 4LFAE 1TF6A 2YRHA 4X62E 2KOUA 2UUBE 5AC4A 4BHCA 1YYWA 4WX9A 3KWRA 1AH5A 4LF4E 3K6QA
chains in the Genus database with same CATH topology
4DR6E 4LU9A 2LUPB 4M2ZA 3ADJA 4BC7A 4I8OA 2JWOA 2UXBE 1GZ6A 2B7TA 4TUIA 1RQ0A 1YZ9A 2UXCE 4NXME 5FLXC 2UUCE 4R8OA 4DR7E 3ADIA 5CFFE 1WHNA 2YT4A 4DV4E 3FIGA 4JYAE 4F9BB 2LJHA 4JI3E 4DUZE 1T4NA 2MC6A 5AE3A 3P1XA 5AE1A 3VYYA 3F6GA 1EKZA 2UU9E 4DKKA 2JY9A 4Q28A 2FTXB 1ZBTA 2B7VA 4KHPE 4DV6E 4JI6E 1XNRE 5BR8E 1X47A 2LMZA 2V8QB 3HTXA 2L2MA 4J8ZA 4DV0E 5LMNE 4YHHE 4DR3E 4K0KE 1J26A 1UILA 1FJGE 5IT9C 4KZSA 3F6HA 1RC7A 5DNYA 2F8BA 3JTZA 2RS7A 2LBSB 4JI0E 3J7AG 2HHHE 2DIXA 2L3CA 2RTXA 1O0WA 2M7QA 1IBLE 4LF7E 2B3TB 1T4LB 2YZTA 4L8NA 4DV7E 4JI5E 1PKPA 3HQ1A 2VQFE 1N33E 2IHR1 1WHQA 2KHXA 3VK6A 4JI7E 1T4OA 3T1HE 4NXNE 4GKKE 4JI1E 3AUZA 2M1SA 4DR1E 3JAMC 3DJWA 3T1YE 2L2KB 2JOXA 2V88A 4JI2E 4P7DA 4R03A 4JI4E 3HXLA 4LTYA 4DR2E 2B9DA 1SR9A 1HNWE 2DB2A 5AE2A 1XMQE 2K4VA 4JV5E 1N32E 2F4VE 5A2QC 3RMPA 2UUAE 2L8TA 4TUGA 2UXDE 4AQYE 2VF1A 2EZ6A 2V89A 1XNQE 2V87A 4B3SE 2L3JA 4DUYE 2JVAA 2FV4B 2LTSA 4OOGC 2NUEA 3ADLA 4DV3E 2VE7C 1IBME 4B3RE 2V85A 5AASA 1WXRA 2E5LE 3MSWA 4LFCE 2JR1A 2V86A 2M4IA 4BS9A 2NUGA 1QU6A 2VQEE 2H36X 2DMYA 2MDRA 3LLHA 1N36E 1STUA 3ADGA 1HR0E 1DI2A 2L33A 3J7Yp 4B3ME 3OMLA 4LF6E 4DR4E 2CPNA 4WYQB 2NUFA 2LUQA 4X65E 3OTOE 1J5EE 4BMJA 3HPSA 4LF9E 2DSYA 2L6MA 2MC5A 2LTRA 2V83A 1XMOE 2ZM6E 1IBKE 3DF6A 2RSMA 1FKAE 1DQ3A 4DV1E 4BC9A 4WFTA 3AV0A 4BCAA 4DV5E 4BBYA 2LE2A 4M30A 2FGGA 2KONA 4F54A 3J81C 2JOBA 1YYKA 1I94E 1N34E 4LF5E 3VYXA 2E1MA 2L92A 4GEQB 4LFBE 1UHZA 3J80C 2L2NA 4WPYA 2EWLA 2N3GA 2ODRC 3C4BA 5F3WA 4X64E 4YY3E 1X48A 3JU0A 2LRSA 4L5NC 3IWDA 4X8WA 3IWBA 4DR5E 4X66E 1HNZE 1X49A 4F9CB 1GQEA 4M0VA 4F9AB 5IWAE 2N3HA 3C4TA 5LL6R 1YYOA 2NA2A 1HNXE 4GKJE 4DMIA 4DV2E 2WZOA 3HPZA 4LFAE 4JI8E 4B3TE 4X62E 3IWCA 2KOUA 2G7HA 2ODRD 5ADZA 3H09A 1ZBQA 5LMUE 2RS6A 2UUBE 4LF8E 4WSPA 3LMLA 4P78A 4OX9E 1YYWA 5T6JA 3KWRA 4LF4E 3K6QA 3ZOQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 E;  2LUP B;  4M2Z A;  3ADJ A;  2UXB E;  2B7T A;  1RQ0 A;  1YZ9 A;  2UXC E;  4NXM E;  2UUC E;  4DR7 E;  3ADI A;  5CFF E;  1WHN A;  2YT4 A;  4DV4 E;  4JYA E;  2LJH A;  4JI3 E;  4DUZ E;  1T4N A;  1EKZ A;  3P1X A;  3VYY A;  2UU9 E;  4DKK A;  2JY9 A;  4KHP E;  1ZBT A;  2B7V A;  4DV6 E;  4JI6 E;  1XNR E;  5BR8 E;  1X47 A;  3HTX A;  2L2M A;  4DV0 E;  5LMN E;  4YHH E;  4DR3 E;  4K0K E;  1J26 A;  1UIL A;  1FJG E;  1RC7 A;  2LBS B;  2RS7 A;  4JI0 E;  2HHH E;  2DIX A;  2L3C A;  2RTX A;  1O0W A;  1IBL E;  4LF7 E;  2B3T B;  1T4L B;  4DV7 E;  4JI5 E;  1PKP A;  2VQF E;  1N33 E;  2IHR 1;  1WHQ A;  2KHX A;  3T1H E;  4JI7 E;  1T4O A;  4NXN E;  4GKK E;  4JI1 E;  4DR1 E;  3T1Y E;  2L2K B;  4JI2 E;  4JI4 E;  4DR2 E;  1HNW E;  2DB2 A;  1XMQ E;  4JV5 E;  1N32 E;  2F4V E;  2UUA E;  2UXD E;  4AQY E;  2EZ6 A;  1XNQ E;  4B3S E;  2L3J A;  4DUY E;  2JVA A;  4OOG C;  2LTS A;  3ADL A;  2NUE A;  4DV3 E;  1IBM E;  4B3R E;  2E5L E;  4LFC E;  2NUG A;  1QU6 A;  2VQE E;  3LLH A;  2DMY A;  2MDR A;  1N36 E;  1HR0 E;  1STU A;  3ADG A;  1DI2 A;  2L33 A;  3J7Y p;  4B3M E;  4LF6 E;  4DR4 E;  2CPN A;  4WYQ B;  2NUF A;  2LUQ A;  4X65 E;  3OTO E;  1J5E E;  4LF9 E;  1XMO E;  2LTR A;  2ZM6 E;  1IBK E;  2RSM A;  1FKA E;  4WFT A;  4DV5 E;  4M30 A;  1YYK A;  1I94 E;  1N34 E;  4LF5 E;  3VYX A;  4LFB E;  1UHZ A;  2L2N A;  2N3G A;  3C4B A;  4X64 E;  4YY3 E;  1X48 A;  2LRS A;  4X8W A;  4DR5 E;  4X66 E;  1HNZ E;  1X49 A;  1GQE A;  5IWA E;  2N3H A;  3C4T A;  1YYO A;  2NA2 A;  1HNX E;  4GKJ E;  4DV2 E;  4LFA E;  4JI8 E;  4B3T E;  4X62 E;  5LMU E;  2UUB E;  2RS6 A;  4LF8 E;  4OX9 E;  1YYW A;  4LF4 E;  4DV1 E; 
#chains in the Genus database with same CATH topology
 5KL5 A;  2EN6 A;  3ADJ A;  4BC7 A;  2JWO A;  1GZ6 A;  4TUI A;  3MHH C;  4BHB A;  2UUC E;  1LLM C;  2YTF A;  3BF2 A;  2EPL X;  4DV4 E;  3FIG A;  4F9B B;  2LJH A;  2JXP A;  5AE3 A;  3KZZ A;  4DKK A;  4KHP E;  4DV6 E;  2DGC A;  2L2M A;  5KL4 A;  4YHH E;  2HC5 A;  1FJG E;  2YU8 A;  3F6H A;  4R2S A;  2JPA A;  2F8B A;  4JI0 E;  4R2P A;  2DIX A;  1YUI A;  1IBL E;  2HGH A;  2DLQ A;  4L8N A;  4JI5 E;  2ELZ A;  3HQ1 A;  1N33 E;  3EPL A;  2IHR 1;  1WHQ A;  1T4O A;  1ZU1 A;  2EL6 A;  2L2K B;  2EPM X;  4NHR A;  4R03 A;  4DR2 E;  2EQ1 A;  2LVH A;  2K7I A;  2EOR A;  3EQ1 A;  4HEI A;  2EM5 A;  1N32 E;  2F4V E;  2YSO A;  1X6E A;  2L8T A;  1EH8 A;  2UUA E;  1YUJ A;  2V89 A;  1XNQ E;  2V87 A;  2YTD A;  2ENC A;  2LO3 A;  1G2D C;  2EM3 A;  2GHF A;  4OOG C;  3ADL A;  4IJD A;  4DV3 E;  1WXR A;  1P47 A;  4LFC E;  2M4I A;  2NUG A;  2H36 X;  2DMY A;  1N36 E;  4B3M E;  2EOI A;  2I13 A;  4LF6 E;  3EPH A;  4DR4 E;  2NUF A;  2LUQ A;  2EJ4 A;  4R2R A;  3C6K A;  3HPS A;  2L6M A;  2A25 A;  2V83 A;  1T39 A;  2LJU A;  2DRP A;  2YRK A;  3AV0 A;  4MLV A;  2FGG A;  2WBT A;  4F54 A;  2JOB A;  5AC5 A;  1I94 E;  4GEQ B;  2ODR C;  3C4B A;  1AAY A;  1YFH A;  3IWB A;  1GQE A;  2EOF A;  4R2A A;  1WJP A;  2N3H A;  3C4T A;  2EE8 A;  1YYO A;  1A1G A;  2EOZ A;  2WZO A;  3HPZ A;  3IWC A;  2EMZ A;  1YPN A;  2GPI A;  5TSE A;  5LMU E;  2EQ3 A;  5A6K A;  4WSP A;  3LML A;  4P78 A;  5T6J A;  1X3C A;  3KZY A;  3ZOQ B;  4WSG A;  2D9H A;  5A6J A;  2CT1 A;  2E72 A;  2LUP B;  4I8O A;  4O5G A;  2UXB E;  2YTJ A;  5FLX C;  4DR7 E;  5CFF E;  2YT4 A;  4ZYG A;  4JYA E;  1A1K A;  2YWQ A;  1GTK A;  3L00 A;  5A6A A;  4R2E A;  2NAB A;  2JY9 A;  2B7V A;  1JK1 A;  5BR8 E;  2EM8 A;  1X47 A;  3TQM A;  4J8Z A;  2YSP A;  1J26 A;  2EOO A;  1Z1B A;  2YTG A;  1RC7 A;  2RS7 A;  5KL2 A;  1NEI A;  2HHH E;  2RTX A;  1O0W A;  2YZT A;  1NCS A;  3C6M A;  1PKP A;  2EMF A;  2KHX A;  2RSI A;  4JI7 E;  2EMG A;  3DJW A;  3T1Y E;  2EML A;  2JOX A;  2EM2 A;  4JI4 E;  4LTY A;  1SR9 A;  2EMX A;  5AE2 A;  4JV5 E;  2YU5 A;  5LLQ A;  5A2Q C;  2EM6 A;  3RMP A;  4TUG A;  4B3S E;  3UK3 C;  2ENH A;  2MKD A;  3MSW A;  2CTD A;  2ELY A;  2V86 A;  1QU6 A;  2VQE E;  1B69 A;  3THN A;  1DI2 A;  1STU A;  2BBG A;  2CPN A;  1IQO A;  4R2Q A;  4X65 E;  2EMH A;  2EPZ A;  4BMJ A;  2EMI A;  4LF9 E;  2LTR A;  1BBG A;  2EM9 A;  2ZM6 E;  1IBK E;  1FKA E;  1DQ3 A;  4BBY A;  2EOJ A;  4M30 A;  2R1F A;  2EOX A;  1YYK A;  4LF5 E;  3VYX A;  1DGC A;  1PJQ A;  5F3W A;  4X64 E;  2YTP A;  4ZYH A;  2LRS A;  3EPJ A;  4F6M A;  4M0V A;  5IWA E;  1BBO A;  2JP9 A;  5KL6 A;  2EN7 A;  2EOH A;  4ZYE A;  4DMI A;  4DV2 E;  2BB8 A;  4JI8 E;  4B3T E;  5ADZ A;  2EMY A;  2WBS A;  4OX9 E;  4Q35 B;  2EOS A;  2EOE A;  4LFB E;  4DR6 E;  4LU9 A;  3ECR A;  2B7T A;  2MDG A;  1RQ0 A;  1YZ9 A;  2UXC E;  4NXM E;  2EM4 A;  1A1J A;  4R8O A;  3ADI A;  4DUZ E;  4O24 A;  1EKZ A;  5AE1 A;  1RMD A;  4Q28 A;  2FTX B;  4KWY A;  5IXM B;  2LMZ A;  1T38 A;  3HTX A;  1IMU A;  2WCC 3;  4DR3 E;  4K0K E;  1UIL A;  4KZS A;  3J7A G;  2YTO A;  2M7Q A;  4LF7 E;  4ZYD A;  2B3T B;  1T4L B;  1YSA C;  2EL5 A;  2EN1 A;  1A1L A;  1BB8 A;  3T1H E;  4JI1 E;  1F2I G;  2M1S A;  2EPN A;  3JAM C;  1JK2 A;  3THO B;  2ENA A;  2YTE A;  3HXL A;  1A1H A;  4M9V C;  1HNW E;  1XMQ E;  2EPU A;  1PJS A;  2EMC A;  5A6B D;  2LV2 A;  2VF1 A;  2EN2 A;  1A1F A;  1UBD C;  2EM7 A;  1QNT A;  4DUY E;  2DMI A;  2JVA A;  2DLK A;  2LTS A;  4HTG A;  2ADR A;  2VE7 C;  4B3R E;  1IQS A;  4X9J A;  5IV8 B;  2JR1 A;  3QG5 C;  1KJK A;  1TF3 A;  4WXD A;  3LLH A;  2MDR A;  2EN8 A;  1HR0 E;  2YTN A;  2L33 A;  2EMW A;  3J7Y p;  3OML A;  3EPK A;  4WYQ B;  5KL3 A;  3OTO E;  4RH8 A;  4F6N A;  2R76 A;  2EPR A;  1XMO E;  4R2C A;  3DF6 A;  3BGH A;  1PJT A;  4DV1 E;  4BC9 A;  4BCA A;  4DV5 E;  1SFE A;  2LE2 A;  2KON A;  3J81 C;  1N34 E;  2WBU A;  2L92 A;  1A1I A;  2L2N A;  1N3G A;  3JU0 A;  4X8W A;  1KYQ A;  4DR5 E;  4X66 E;  4F9A B;  1TN9 A;  4O43 A;  4N4R B;  5LL6 R;  2NA2 A;  2EOQ A;  2G7H A;  2ODR D;  3H09 A;  1ZBQ A;  4LF8 E;  2RS6 A;  2MKN A;  1G2F C;  2YRM A;  5AAS A;  2EPO A;  3BID A;  4M2Z A;  2M9A A;  5A6B A;  2EM0 A;  2EOM A;  1PDA A;  1WHN A;  3M99 B;  4JI3 E;  1X6H A;  1T4N A;  2MC6 A;  4GZN C;  3P1X A;  3VYY A;  3F6G A;  4NZV A;  2EN4 A;  2GLI A;  2UU9 E;  1ZBT A;  4WXC A;  4JI6 E;  1WRJ A;  1XNR E;  2YTQ A;  2EPP A;  1L4S A;  2V8Q B;  4DV0 E;  5LMN E;  5IT9 C;  5DNY A;  3JTZ A;  4O4K A;  2LBS B;  2EPA A;  4MLQ A;  2L3C A;  2EMA A;  2YTI A;  2RPC A;  1EH6 A;  2EOY A;  4DV7 E;  2RQL A;  2VQF E;  4IS1 C;  3VK6 A;  4NXN E;  4GKK E;  2I9I A;  3AUZ A;  4DR1 E;  4RHB B;  1MEY C;  3BBG A;  2V88 A;  2EN3 A;  4JI2 E;  4P7D A;  2CSH A;  2B9D A;  2DB2 A;  2K4V A;  2UXD E;  2EL4 A;  4AQY E;  2EZ6 A;  2EMB A;  3VHT B;  2L3J A;  2PRT A;  1MGT A;  4R2D A;  2FV4 B;  2NUE A;  2EPX A;  4FK5 C;  1IBM E;  2V85 A;  2E5L E;  1ZR9 A;  4BS9 A;  2YPN A;  2EPK X;  2JYA A;  3ADG A;  2LCE A;  2EP3 A;  2N8X A;  1X6F A;  1UN6 B;  1J5E E;  2HJJ A;  3MHS C;  2DSY A;  2MC5 A;  2VRD A;  2RSM A;  2EPC A;  4WFT A;  1EH7 A;  2J7J A;  2Q8U A;  5KL7 A;  2E1M A;  1UHZ A;  3J80 C;  4WPY A;  2EWL A;  2N3G A;  4YY3 E;  1X48 A;  1X5W A;  3IWD A;  4L5N C;  2EQ0 A;  1ZAA C;  2LT7 A;  1X49 A;  4F9C B;  1HNZ E;  4F2J C;  2EMK A;  5A69 A;  1HNX E;  4GKJ E;  4LFA E;  1TF6 A;  2YRH A;  4X62 E;  2KOU A;  2UUB E;  5AC4 A;  4BHC A;  1YYW A;  4WX9 A;  3KWR A;  1AH5 A;  4LF4 E;  3K6Q A; 
#chains in the Genus database with same CATH homology
 4DR6 E;  4LU9 A;  2LUP B;  4M2Z A;  3ADJ A;  4BC7 A;  4I8O A;  2JWO A;  2UXB E;  1GZ6 A;  2B7T A;  4TUI A;  1RQ0 A;  1YZ9 A;  2UXC E;  4NXM E;  5FLX C;  2UUC E;  4R8O A;  4DR7 E;  3ADI A;  5CFF E;  1WHN A;  2YT4 A;  4DV4 E;  3FIG A;  4JYA E;  4F9B B;  2LJH A;  4JI3 E;  4DUZ E;  1T4N A;  2MC6 A;  5AE3 A;  3P1X A;  5AE1 A;  3VYY A;  3F6G A;  1EKZ A;  2UU9 E;  4DKK A;  2JY9 A;  4Q28 A;  2FTX B;  1ZBT A;  2B7V A;  4KHP E;  4DV6 E;  4JI6 E;  1XNR E;  5BR8 E;  1X47 A;  2LMZ A;  2V8Q B;  3HTX A;  2L2M A;  4J8Z A;  4DV0 E;  5LMN E;  4YHH E;  4DR3 E;  4K0K E;  1J26 A;  1UIL A;  1FJG E;  5IT9 C;  4KZS A;  3F6H A;  1RC7 A;  5DNY A;  2F8B A;  3JTZ A;  2RS7 A;  2LBS B;  4JI0 E;  3J7A G;  2HHH E;  2DIX A;  2L3C A;  2RTX A;  1O0W A;  2M7Q A;  1IBL E;  4LF7 E;  2B3T B;  1T4L B;  2YZT A;  4L8N A;  4DV7 E;  4JI5 E;  1PKP A;  3HQ1 A;  2VQF E;  1N33 E;  2IHR 1;  1WHQ A;  2KHX A;  3VK6 A;  4JI7 E;  1T4O A;  3T1H E;  4NXN E;  4GKK E;  4JI1 E;  3AUZ A;  2M1S A;  4DR1 E;  3JAM C;  3DJW A;  3T1Y E;  2L2K B;  2JOX A;  2V88 A;  4JI2 E;  4P7D A;  4R03 A;  4JI4 E;  3HXL A;  4LTY A;  4DR2 E;  2B9D A;  1SR9 A;  1HNW E;  2DB2 A;  5AE2 A;  1XMQ E;  2K4V A;  4JV5 E;  1N32 E;  2F4V E;  5A2Q C;  3RMP A;  2UUA E;  2L8T A;  4TUG A;  2UXD E;  4AQY E;  2VF1 A;  2EZ6 A;  2V89 A;  1XNQ E;  2V87 A;  4B3S E;  2L3J A;  4DUY E;  2JVA A;  2FV4 B;  2LTS A;  4OOG C;  2NUE A;  3ADL A;  4DV3 E;  2VE7 C;  1IBM E;  4B3R E;  2V85 A;  5AAS A;  1WXR A;  2E5L E;  3MSW A;  4LFC E;  2JR1 A;  2V86 A;  2M4I A;  4BS9 A;  2NUG A;  1QU6 A;  2VQE E;  2H36 X;  2DMY A;  2MDR A;  3LLH A;  1N36 E;  1STU A;  3ADG A;  1HR0 E;  1DI2 A;  2L33 A;  3J7Y p;  4B3M E;  3OML A;  4LF6 E;  4DR4 E;  2CPN A;  4WYQ B;  2NUF A;  2LUQ A;  4X65 E;  3OTO E;  1J5E E;  4BMJ A;  3HPS A;  4LF9 E;  2DSY A;  2L6M A;  2MC5 A;  2LTR A;  2V83 A;  1XMO E;  2ZM6 E;  1IBK E;  3DF6 A;  2RSM A;  1FKA E;  1DQ3 A;  4DV1 E;  4BC9 A;  4WFT A;  3AV0 A;  4BCA A;  4DV5 E;  4BBY A;  2LE2 A;  4M30 A;  2FGG A;  2KON A;  4F54 A;  3J81 C;  2JOB A;  1YYK A;  1I94 E;  1N34 E;  4LF5 E;  3VYX A;  2E1M A;  2L92 A;  4GEQ B;  4LFB E;  1UHZ A;  3J80 C;  2L2N A;  4WPY A;  2EWL A;  2N3G A;  2ODR C;  3C4B A;  5F3W A;  4X64 E;  4YY3 E;  1X48 A;  3JU0 A;  2LRS A;  4L5N C;  3IWD A;  4X8W A;  3IWB A;  4DR5 E;  4X66 E;  1HNZ E;  1X49 A;  4F9C B;  1GQE A;  4M0V A;  4F9A B;  5IWA E;  2N3H A;  3C4T A;  5LL6 R;  1YYO A;  2NA2 A;  1HNX E;  4GKJ E;  4DMI A;  4DV2 E;  2WZO A;  3HPZ A;  4LFA E;  4JI8 E;  4B3T E;  4X62 E;  3IWC A;  2KOU A;  2G7H A;  2ODR D;  5ADZ A;  3H09 A;  1ZBQ A;  5LMU E;  2RS6 A;  2UUB E;  4LF8 E;  4WSP A;  3LML A;  4P78 A;  4OX9 E;  1YYW A;  5T6J A;  3KWR A;  4LF4 E;  3K6Q A;  3ZOQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...