2L3CA

Solution structure of adar2 dsrbm1 bound to lsl rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
b'PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
total genus 16
structure length 74
sequence length 74
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3cA00
1IBME 1GQEA 3P1XA 2NUEA 4DKKA 2VQEE 4K0KE 2L3JA 4LF6E 2LJHA 1X49A 1EKZA 1J26A 2F4VE 4AQYE 4DV6E 4DR6E 2B7TA 4DR1E 2LBSB 4KHPE 3VYXA 3HTXA 2KHXA 4X65E 2UUBE 2LTSA 1PKPA 4JYAE 1N32E 2E5LE 1X48A 1ZBTA 2L2MA 2L33A 1YZ9A 1WHNA 4DUZE 4X64E 1I94E 4DV3E 2UU9E 4OX9E 2NA2A 2RSMA 2UUCE 1XNQE 2NUFA 1FJGE 2B7VA 2UXDE 1HNXE 4JV5E 4JI5E 3T1HE 3ADJA 2RS6A 1N33E 1X47A 1HNWE 1YYWA 2B3TB 4LF5E 4NXNE 4B3TE 2CPNA 1UILA 5LMUE 1DI2A 1WHQA 1FKAE 1HR0E 4GKKE 2VQFE 2ZM6E 1XMOE 1XMQE 3VYYA 4DR4E 1N34E 4M30A 2LTRA 4JI7E 2DIXA 4LF4E 4LFCE 5LMNE 5IWAE 1IBLE 2MDRA 4LF8E 3ADLA 2DB2A 2JY9A 2LUPB 2LRSA 3LLHA 3ADIA 4OOGC 1HNZE 1RC7A 1N36E 4JI1E 3C4TA 4YHHE 4B3SE 2RTXA 2EZ6A 4WYQB 2NUGA 4DV2E 2DMYA 2UXCE 2L2NA 4DR2E 4LF9E 1XNRE 4DV5E 2IHR1 1T4NA 4X8WA 1YYKA 3ADGA 1UHZA 1O0WA 4JI4E 1T4OA 1RQ0A 1T4LB 1J5EE 4B3ME 4DV4E 4X66E 2RS7A 2LUQA 3C4BA 2L2KB 5CFFE 1QU6A 2YT4A 4JI2E 2UXBE 4WFTA 4DV7E 4DR7E 5BR8E 2JVAA 4JI3E 4JI0E 2UUAE 4LFBE 3T1YE 1YYOA 3J7Yp 4DUYE 2N3HA 4YY3E 4B3RE 4GKJE 4LFAE 4DR5E 2HHHE 4LF7E 3OTOE 4DR3E 4DV0E 2N3GA 4M2ZA 4DV1E 4JI6E 1IBKE 2L3CA 1STUA 4X62E 4JI8E 4NXME
chains in the Genus database with same CATH superfamily
1X6EA 4WXCA 2L3JA 1AH5A 2ODRD 2FGGA 2WBTA 4R2DA 2EOSA 2F4VE 4AQYE 5KL6A 4DR6E 2B7TA 2HC5A 2EL4A 2MC6A 2KHXA 5LL6R 4KWYA 1SFEA 1N32E 1TN9A 1X48A 2L2MA 2BB8A 1WHNA 5AE3A 4DUZE 2D9HA 1TF6A 2UUCE 2WBSA 2NUFA 3RMPA 2UXDE 2VRDA 3C6KA 1A1GA 1ZU1A 3ADJA 4P78A 2EOXA 5A6BD 4LTYA 2DMIA 1A1JA 4R2PA 5FLXC 1B69A 2B3TB 1T39A 4NXNE 3BGHA 3J81C 2MKNA 1X5WA 2M1SA 5A2QC 3MHHC 2VQFE 4BC7A 2ZM6E 1XMQE 2LCEA 4M30A 4LFCE 2E72A 3ADLA 5T6JA 4ZYEA 2LUPB 4OOGC 4BS9A 1HNZE 5KL2A 4JI1E 3C4TA 2EMIA 2EM5A 3QG5C 2B9DA 1A1LA 2NUGA 1UBDC 2L2NA 4DR2E 1XNRE 4R2QA 2LT7A 1WXRA 5A6KA 2EN3A 4X8WA 1O0WA 1YPNA 1T4LB 1G2DC 3KZYA 4DV4E 4X9JA 2RS7A 1F2IG 4P7DA 2L2KB 4Q35B 1LLMC 4DV7E 1NCSA 2I13A 2YTIA 2JVAA 2LV2A 4JI3E 4F9BB 2RSIA 3EPKA 3T1YE 3BF2A 2N3HA 2L8TA 2N8XA 2YRMA 4LFAE 2HHHE 2EMGA 2EMKA 4F6MA 3C6MA 4DV0E 2H36X 2DLQA 4GZNC 4HTGA 2YRHA 2V85A 2YPNA 4X62E 2L3CA 2EOJA 1L4SA 3JTZA 1GQEA 3P1XA 2VQEE 1EH7A 5A69A 2EOOA 2F8BA 1IMUA 4RH8A 2YTGA 1EKZA 1J26A 2EMLA 3IWCA 2EPAA 1ZR9A 2V8QB 4WXDA 1IQOA 2YTNA 4F9CB 3JU0A 1KJKA 2GHFA 2EM7A 3HTXA 2EN6A 1PKPA 2RPCA 2EN2A 1YZ9A 2EPMX 1T38A 4BHCA 2V89A 3DF6A 2RSMA 2ELZA 2VE7C 3IWBA 2EM9A 4JV5E 4JI5E 2EM4A 1MGTA 4TUGA 4J8ZA 4NZVA 3ECRA 2CPNA 5LMUE 1WHQA 1FKAE 1WRJA 4N4RB 1A1FA 2JXPA 2DLKA 4GKKE 4I8OA 4L8NA 2YSOA 4DR4E 2YTDA 1N34E 2FV4B 4GEQB 2JY9A 2LRSA 2EL6A 2JOBA 3BIDA 2JP9A 1RC7A 5IV8B 2CT1A 2MKDA 2RTXA 4WYQB 4DV2E 4MLQA 1A1IA 3HPSA 4LF9E 2ADRA 2Q8UA 2EM3A 1T4NA 4LU9A 2PRTA 1YYKA 1UHZA 1QNTA 2LVHA 2K4VA 2EPCA 5AE1A 3F6HA 3EPJA 5KL7A 4O5GA 1Z1BA 1X6HA 2EMHA 2EMBA 1ZBQA 2V83A 2JOXA 1ZAAC 2YRKA 2EM8A 4BHBA 4WX9A 2ENHA 5LLQA 1YYOA 4MLVA 4DUYE 2HGHA 4R8OA 4YY3E 1A1HA 4R2RA 2LO3A 2JYAA 4LF7E 1DQ3A 2YTFA 4JI6E 1STUA 2EMWA 1SR9A 4FK5C 1AAYA 2R76A 2FTXB 3ZOQB 3HXLA 2NUEA 3FIGA 1YFHA 5ADZA 1JK2A 2EMXA 2LJHA 5KL3A 4ZYGA 2EMAA 1YSAC 2K7IA 2EPPA 2EN4A 2L92A 1UN6B 4WSPA 3VYXA 4KHPE 2M4IA 1GZ6A 5KL5A 4X65E 3KWRA 2UUBE 2YZTA 4JYAE 2LJUA 1EH8A 4X64E 4DV3E 2UU9E 2EOQA 2EPUA 1XNQE 2EORA 2M7QA 3J80C 3MHSC 2V88A 4R2AA 1HNXE 2GLIA 3J7AG 2CTDA 4O43A 2YTOA 4R2CA 2RS6A 1N33E 2MDGA 1X47A 4O4KA 4F54A 3OMLA 5AC5A 5AC4A 4BC9A 3H09A 1X6FA 1WJPA 1HR0E 5A6AA 3TQMA 2MC5A 1KYQA 2EWLA 5IWAE 4LF8E 4R03A 2EM6A 1G2FC 4NHRA 2JWOA 3AV0A 2EPRA 3LLHA 2HJJA 3ADIA 4R2EA 4IJDA 1P47A 4YHHE 3AUZA 2DSYA 3UK3C 2EQ3A 4DV5E 2IHR1 2JPAA 5IT9C 2EQ0A 4JI4E 1RQ0A 1J5EE 1JK1A 5DNYA 4B3ME 5F3WA 2EOHA 5CFFE 2ELYA 2YT4A 2UXBE 1GTKA 4DR7E 4BBYA 4TUIA 1BBGA 4LFBE 2LMZA 2YTPA 1YUIA 1DGCA 1NEIA 2CSHA 2EL5A 2EPOA 4DR5E 4RHBB 2EPNA 2WZOA 2R1FA 2EOMA 3OTOE 1PJSA 4DR3E 4M2ZA 2EM2A 1IBKE 2G7HA 2I9IA 1PDAA 2ENAA 5A6JA 1IBME 1YUJA 2V87A 4DKKA 4K0KE 2EOIA 4LF6E 2EN7A 2VF1A 3L00A 1X49A 3K6QA 4WPYA 2J7JA 2YU8A 4DV6E 2EQ1A 5TSEA 4DR1E 2LBSB 4F2JC 2KOUA 4F6NA 2EOFA 3THNA 4BCAA 2EPZA 1MEYC 4O24A 2LTSA 2EOZA 4IS1C 1TF3A 2E5LE 2YSPA 1ZBTA 2L33A 4KZSA 4L5NC 2EN1A 1I94E 2WBUA 4OX9E 2NA2A 3KZZA 3EPLA 1FJGE 2B7VA 4HEIA 1X3CA 3IWDA 3EPHA 2EMCA 2YTJA 3T1HE 2EOYA 3M99B 1PJQA 1HNWE 1YYWA 4ZYDA 2EN8A 4LF5E 2YU5A 4B3TE 1UILA 2EPKX 1DI2A 2L6MA 1BB8A 3HPZA 1A1KA 2E1MA 2EOEA 1XMOE 3VYYA 2LTRA 4JI7E 2DIXA 2EMYA 4LF4E 5LMNE 2EJ4A 2MDRA 1IBLE 2DB2A 1BBOA 3THOB 3JAMC 4ZYHA 1IQSA 4Q28A 5AASA 1N36E 2NABA 5IXMB 2EMFA 1RMDA 3EQ1A 2YTEA 4R2SA 2ODRC 4DMIA 3DJWA 2EPXA 2BBGA 2M9AA 4B3SE 3VHTB 2EZ6A 2DMYA 4M9VC 2UXCE 2KONA 3F6GA 4WSGA 3ADGA 2YTQA 1T4OA 2JR1A 3VK6A 2YWQA 2V86A 4X66E 2LUQA 3C4BA 4BMJA 1QU6A 2GPIA 4F9AB 4JI2E 2ENCA 4WFTA 5BR8E 1EH6A 3LMLA 5A6BA 4JI0E 5KL4A 2UUAE 3J7Yp 3MSWA 2A25A 2EM0A 4B3RE 4GKJE 2EE8A 2LE2A 2EMZA 2RQLA 2DRPA 5AE2A 3HQ1A 1N3GA 2N3GA 2EPLX 3BBGA 2DGCA 4DV1E 2WCC3 4JI8E 1PJTA 2EP3A 4NXME 4M0VA
chains in the Genus database with same CATH topology
3ZOQB 1IBME 1GQEA 2V87A 3HXLA 3P1XA 2NUEA 4DKKA 2VQEE 4K0KE 3FIGA 2L3JA 4LF6E 5ADZA 2F8BA 2LJHA 2ODRD 2VF1A 2FGGA 1X49A 1EKZA 1J26A 3K6QA 3IWCA 4WPYA 2F4VE 4AQYE 2V8QB 4DV6E 4DR6E 2L92A 4F9CB 2B7TA 4DR1E 2LBSB 3JTZA 2KOUA 3JU0A 4WSPA 3VYXA 4KHPE 2M4IA 1GZ6A 4BCAA 2MC6A 3HTXA 2KHXA 4X65E 3KWRA 2UUBE 5LL6R 2LTSA 1PKPA 2YZTA 4JYAE 1N32E 2E5LE 1X48A 1ZBTA 2L2MA 2L33A 4KZSA 1YZ9A 4L5NC 1WHNA 5AE3A 4DUZE 4X64E 1I94E 4DV3E 2V89A 2UU9E 3DF6A 4OX9E 2NA2A 2RSMA 2VE7C 2UUCE 1XNQE 2NUFA 1FJGE 2B7VA 3IWBA 2M7QA 3J80C 3RMPA 2V88A 1HNXE 4JV5E 2UXDE 3IWDA 4JI5E 3J7AG 3T1HE 3ADJA 4P78A 2RS6A 1N33E 4LTYA 1X47A 4F54A 1HNWE 1YYWA 4TUGA 3OMLA 5FLXC 2B3TB 4J8ZA 4LF5E 4NXNE 4B3TE 2CPNA 1UILA 5LMUE 1DI2A 2L6MA 1WHQA 3J81C 4BC9A 3H09A 1FKAE 2M1SA 3HPZA 5A2QC 1HR0E 2E1MA 4I8OA 4BC7A 4L8NA 2ZM6E 2VQFE 3VYYA 1XMOE 1XMQE 4DR4E 1N34E 2FV4B 4M30A 2LTRA 4JI7E 4GEQB 2DIXA 4LF4E 4LFCE 5LMNE 2MC5A 5IWAE 2EWLA 2MDRA 1IBLE 4R03A 4LF8E 3ADLA 2DB2A 5T6JA 2JWOA 2JY9A 3AV0A 2LUPB 2LRSA 3LLHA 3JAMC 2JOBA 3ADIA 4OOGC 4BS9A 1HNZE 4Q28A 5AASA 1RC7A 1N36E 4JI1E 3C4TA 2ODRC 3AUZA 3DJWA 4DMIA 4YHHE 4B3SE 2B9DA 2DSYA 2RTXA 2EZ6A 4WYQB 2NUGA 4DV2E 2DMYA 2UXCE 2L2NA 4DR2E 4GKKE 3HPSA 4LF9E 1XNRE 4DV5E 2KONA 2IHR1 1WXRA 1T4NA 4LU9A 3F6GA 4X8WA 5IT9C 1YYKA 3ADGA 1UHZA 1O0WA 4JI4E 1T4OA 2JR1A 2K4VA 1RQ0A 3VK6A 1T4LB 1J5EE 5AE1A 3F6HA 5DNYA 5F3WA 4B3ME 2V86A 4DV4E 2RS7A 4X66E 2LUQA 3C4BA 4P7DA 2L2KB 1ZBQA 4BMJA 5CFFE 1QU6A 2YT4A 2V83A 2JOXA 4F9AB 4JI2E 4WFTA 2UXBE 4DV7E 4DR7E 5BR8E 4BBYA 4TUIA 3LMLA 2JVAA 4JI3E 4F9BB 4JI0E 2UUAE 4LFBE 3T1YE 1YYOA 2LMZA 3J7Yp 3MSWA 4DUYE 2N3HA 4R8OA 4YY3E 2L8TA 4B3RE 4GKJE 4LFAE 4DR5E 2LE2A 2HHHE 5AE2A 3HQ1A 2WZOA 4LF7E 3OTOE 4DR3E 4DV0E 1DQ3A 2N3GA 4M2ZA 2H36X 4DV1E 4JI6E 1IBKE 2G7HA 2V85A 1STUA 4X62E 4JI8E 1SR9A 2L3CA 4NXME 4M0VA 2FTXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM E;  1GQE A;  3P1X A;  2NUE A;  4DKK A;  2VQE E;  4K0K E;  2L3J A;  4LF6 E;  2LJH A;  1X49 A;  1EKZ A;  1J26 A;  2F4V E;  4AQY E;  4DV6 E;  4DR6 E;  2B7T A;  4DR1 E;  2LBS B;  4KHP E;  3VYX A;  3HTX A;  2KHX A;  4X65 E;  2UUB E;  2LTS A;  1PKP A;  4JYA E;  1N32 E;  2E5L E;  1X48 A;  1ZBT A;  2L2M A;  2L33 A;  1YZ9 A;  1WHN A;  4DUZ E;  4X64 E;  1I94 E;  4DV3 E;  2UU9 E;  4OX9 E;  2NA2 A;  2RSM A;  2UUC E;  1XNQ E;  2NUF A;  1FJG E;  2B7V A;  2UXD E;  1HNX E;  4JV5 E;  4JI5 E;  3T1H E;  3ADJ A;  2RS6 A;  1N33 E;  1X47 A;  1HNW E;  1YYW A;  2B3T B;  4LF5 E;  4NXN E;  4B3T E;  2CPN A;  1UIL A;  5LMU E;  1DI2 A;  1WHQ A;  1FKA E;  1HR0 E;  4GKK E;  2VQF E;  2ZM6 E;  1XMO E;  1XMQ E;  3VYY A;  4DR4 E;  1N34 E;  4M30 A;  2LTR A;  4JI7 E;  2DIX A;  4LF4 E;  4LFC E;  5LMN E;  5IWA E;  1IBL E;  2MDR A;  4LF8 E;  3ADL A;  2DB2 A;  2JY9 A;  2LUP B;  2LRS A;  3LLH A;  3ADI A;  4OOG C;  1HNZ E;  1RC7 A;  1N36 E;  4JI1 E;  3C4T A;  4YHH E;  4B3S E;  2RTX A;  2EZ6 A;  4WYQ B;  2NUG A;  4DV2 E;  2DMY A;  2UXC E;  2L2N A;  4DR2 E;  4LF9 E;  1XNR E;  4DV5 E;  2IHR 1;  1T4N A;  4X8W A;  1YYK A;  3ADG A;  1UHZ A;  1O0W A;  4JI4 E;  1T4O A;  1RQ0 A;  1T4L B;  1J5E E;  4B3M E;  4DV4 E;  4X66 E;  2RS7 A;  2LUQ A;  3C4B A;  2L2K B;  5CFF E;  1QU6 A;  2YT4 A;  4JI2 E;  2UXB E;  4WFT A;  4DV7 E;  4DR7 E;  5BR8 E;  2JVA A;  4JI3 E;  4JI0 E;  2UUA E;  4LFB E;  3T1Y E;  1YYO A;  3J7Y p;  4DUY E;  2N3H A;  4YY3 E;  4B3R E;  4GKJ E;  4LFA E;  4DR5 E;  2HHH E;  4LF7 E;  3OTO E;  4DR3 E;  4DV0 E;  2N3G A;  4M2Z A;  4DV1 E;  4JI6 E;  1IBK E;  2L3C A;  1STU A;  4X62 E;  4JI8 E;  4NXM E; 
#chains in the Genus database with same CATH topology
 1X6E A;  4WXC A;  2L3J A;  1AH5 A;  2ODR D;  2FGG A;  2WBT A;  4R2D A;  2EOS A;  2F4V E;  4AQY E;  5KL6 A;  4DR6 E;  2B7T A;  2HC5 A;  2EL4 A;  2MC6 A;  2KHX A;  5LL6 R;  4KWY A;  1SFE A;  1N32 E;  1TN9 A;  1X48 A;  2L2M A;  2BB8 A;  1WHN A;  5AE3 A;  4DUZ E;  2D9H A;  1TF6 A;  2UUC E;  2WBS A;  2NUF A;  3RMP A;  2UXD E;  2VRD A;  3C6K A;  1A1G A;  1ZU1 A;  3ADJ A;  4P78 A;  2EOX A;  5A6B D;  4LTY A;  2DMI A;  1A1J A;  4R2P A;  5FLX C;  1B69 A;  2B3T B;  1T39 A;  4NXN E;  3BGH A;  3J81 C;  2MKN A;  1X5W A;  2M1S A;  5A2Q C;  3MHH C;  2VQF E;  4BC7 A;  2ZM6 E;  1XMQ E;  2LCE A;  4M30 A;  4LFC E;  2E72 A;  3ADL A;  5T6J A;  4ZYE A;  2LUP B;  4OOG C;  4BS9 A;  1HNZ E;  5KL2 A;  4JI1 E;  3C4T A;  2EMI A;  2EM5 A;  3QG5 C;  2B9D A;  1A1L A;  2NUG A;  1UBD C;  2L2N A;  4DR2 E;  1XNR E;  4R2Q A;  2LT7 A;  1WXR A;  5A6K A;  2EN3 A;  4X8W A;  1O0W A;  1YPN A;  1T4L B;  1G2D C;  3KZY A;  4DV4 E;  4X9J A;  2RS7 A;  1F2I G;  4P7D A;  2L2K B;  4Q35 B;  1LLM C;  4DV7 E;  1NCS A;  2I13 A;  2YTI A;  2JVA A;  2LV2 A;  4JI3 E;  4F9B B;  2RSI A;  3EPK A;  3T1Y E;  3BF2 A;  2N3H A;  2L8T A;  2N8X A;  2YRM A;  4LFA E;  2HHH E;  2EMG A;  2EMK A;  4F6M A;  3C6M A;  4DV0 E;  2H36 X;  2DLQ A;  4GZN C;  4HTG A;  2YRH A;  2V85 A;  2YPN A;  4X62 E;  2L3C A;  2EOJ A;  1L4S A;  3JTZ A;  1GQE A;  3P1X A;  2VQE E;  1EH7 A;  5A69 A;  2EOO A;  2F8B A;  1IMU A;  4RH8 A;  2YTG A;  1EKZ A;  1J26 A;  2EML A;  3IWC A;  2EPA A;  1ZR9 A;  2V8Q B;  4WXD A;  1IQO A;  2YTN A;  4F9C B;  3JU0 A;  1KJK A;  2GHF A;  2EM7 A;  3HTX A;  2EN6 A;  1PKP A;  2RPC A;  2EN2 A;  1YZ9 A;  2EPM X;  1T38 A;  4BHC A;  2V89 A;  3DF6 A;  2RSM A;  2ELZ A;  2VE7 C;  3IWB A;  2EM9 A;  4JV5 E;  4JI5 E;  2EM4 A;  1MGT A;  4TUG A;  4J8Z A;  4NZV A;  3ECR A;  2CPN A;  5LMU E;  1WHQ A;  1FKA E;  1WRJ A;  4N4R B;  1A1F A;  2JXP A;  2DLK A;  4GKK E;  4I8O A;  4L8N A;  2YSO A;  4DR4 E;  2YTD A;  1N34 E;  2FV4 B;  4GEQ B;  2JY9 A;  2LRS A;  2EL6 A;  2JOB A;  3BID A;  2JP9 A;  1RC7 A;  5IV8 B;  2CT1 A;  2MKD A;  2RTX A;  4WYQ B;  4DV2 E;  4MLQ A;  1A1I A;  3HPS A;  4LF9 E;  2ADR A;  2Q8U A;  2EM3 A;  1T4N A;  4LU9 A;  2PRT A;  1YYK A;  1UHZ A;  1QNT A;  2LVH A;  2K4V A;  2EPC A;  5AE1 A;  3F6H A;  3EPJ A;  5KL7 A;  4O5G A;  1Z1B A;  1X6H A;  2EMH A;  2EMB A;  1ZBQ A;  2V83 A;  2JOX A;  1ZAA C;  2YRK A;  2EM8 A;  4BHB A;  4WX9 A;  2ENH A;  5LLQ A;  1YYO A;  4MLV A;  4DUY E;  2HGH A;  4R8O A;  4YY3 E;  1A1H A;  4R2R A;  2LO3 A;  2JYA A;  4LF7 E;  1DQ3 A;  2YTF A;  4JI6 E;  1STU A;  2EMW A;  1SR9 A;  4FK5 C;  1AAY A;  2R76 A;  2FTX B;  3ZOQ B;  3HXL A;  2NUE A;  3FIG A;  1YFH A;  5ADZ A;  1JK2 A;  2EMX A;  2LJH A;  5KL3 A;  4ZYG A;  2EMA A;  1YSA C;  2K7I A;  2EPP A;  2EN4 A;  2L92 A;  1UN6 B;  4WSP A;  3VYX A;  4KHP E;  2M4I A;  1GZ6 A;  5KL5 A;  4X65 E;  3KWR A;  2UUB E;  2YZT A;  4JYA E;  2LJU A;  1EH8 A;  4X64 E;  4DV3 E;  2UU9 E;  2EOQ A;  2EPU A;  1XNQ E;  2EOR A;  2M7Q A;  3J80 C;  3MHS C;  2V88 A;  4R2A A;  1HNX E;  2GLI A;  3J7A G;  2CTD A;  4O43 A;  2YTO A;  4R2C A;  2RS6 A;  1N33 E;  2MDG A;  1X47 A;  4O4K A;  4F54 A;  3OML A;  5AC5 A;  5AC4 A;  4BC9 A;  3H09 A;  1X6F A;  1WJP A;  1HR0 E;  5A6A A;  3TQM A;  2MC5 A;  1KYQ A;  2EWL A;  5IWA E;  4LF8 E;  4R03 A;  2EM6 A;  1G2F C;  4NHR A;  2JWO A;  3AV0 A;  2EPR A;  3LLH A;  2HJJ A;  3ADI A;  4R2E A;  4IJD A;  1P47 A;  4YHH E;  3AUZ A;  2DSY A;  3UK3 C;  2EQ3 A;  4DV5 E;  2IHR 1;  2JPA A;  5IT9 C;  2EQ0 A;  4JI4 E;  1RQ0 A;  1J5E E;  1JK1 A;  5DNY A;  4B3M E;  5F3W A;  2EOH A;  5CFF E;  2ELY A;  2YT4 A;  2UXB E;  1GTK A;  4DR7 E;  4BBY A;  4TUI A;  1BBG A;  4LFB E;  2LMZ A;  2YTP A;  1YUI A;  1DGC A;  1NEI A;  2CSH A;  2EL5 A;  2EPO A;  4DR5 E;  4RHB B;  2EPN A;  2WZO A;  2R1F A;  2EOM A;  3OTO E;  1PJS A;  4DR3 E;  4M2Z A;  2EM2 A;  1IBK E;  2G7H A;  2I9I A;  1PDA A;  2ENA A;  5A6J A;  1IBM E;  1YUJ A;  2V87 A;  4DKK A;  4K0K E;  2EOI A;  4LF6 E;  2EN7 A;  2VF1 A;  3L00 A;  1X49 A;  3K6Q A;  4WPY A;  2J7J A;  2YU8 A;  4DV6 E;  2EQ1 A;  5TSE A;  4DR1 E;  2LBS B;  4F2J C;  2KOU A;  4F6N A;  2EOF A;  3THN A;  4BCA A;  2EPZ A;  1MEY C;  4O24 A;  2LTS A;  2EOZ A;  4IS1 C;  1TF3 A;  2E5L E;  2YSP A;  1ZBT A;  2L33 A;  4KZS A;  4L5N C;  2EN1 A;  1I94 E;  2WBU A;  4OX9 E;  2NA2 A;  3KZZ A;  3EPL A;  1FJG E;  2B7V A;  4HEI A;  1X3C A;  3IWD A;  3EPH A;  2EMC A;  2YTJ A;  3T1H E;  2EOY A;  3M99 B;  1PJQ A;  1HNW E;  1YYW A;  4ZYD A;  2EN8 A;  4LF5 E;  2YU5 A;  4B3T E;  1UIL A;  2EPK X;  1DI2 A;  2L6M A;  1BB8 A;  3HPZ A;  1A1K A;  2E1M A;  2EOE A;  1XMO E;  3VYY A;  2LTR A;  4JI7 E;  2DIX A;  2EMY A;  4LF4 E;  5LMN E;  2EJ4 A;  2MDR A;  1IBL E;  2DB2 A;  1BBO A;  3THO B;  3JAM C;  4ZYH A;  1IQS A;  4Q28 A;  5AAS A;  1N36 E;  2NAB A;  5IXM B;  2EMF A;  1RMD A;  3EQ1 A;  2YTE A;  4R2S A;  2ODR C;  4DMI A;  3DJW A;  2EPX A;  2BBG A;  2M9A A;  4B3S E;  3VHT B;  2EZ6 A;  2DMY A;  4M9V C;  2UXC E;  2KON A;  3F6G A;  4WSG A;  3ADG A;  2YTQ A;  1T4O A;  2JR1 A;  3VK6 A;  2YWQ A;  2V86 A;  4X66 E;  2LUQ A;  3C4B A;  4BMJ A;  1QU6 A;  2GPI A;  4F9A B;  4JI2 E;  2ENC A;  4WFT A;  5BR8 E;  1EH6 A;  3LML A;  5A6B A;  4JI0 E;  5KL4 A;  2UUA E;  3J7Y p;  3MSW A;  2A25 A;  2EM0 A;  4B3R E;  4GKJ E;  2EE8 A;  2LE2 A;  2EMZ A;  2RQL A;  2DRP A;  5AE2 A;  3HQ1 A;  1N3G A;  2N3G A;  2EPL X;  3BBG A;  2DGC A;  4DV1 E;  2WCC 3;  4JI8 E;  1PJT A;  2EP3 A;  4NXM E;  4M0V A; 
#chains in the Genus database with same CATH homology
 3ZOQ B;  1IBM E;  1GQE A;  2V87 A;  3HXL A;  3P1X A;  2NUE A;  4DKK A;  2VQE E;  4K0K E;  3FIG A;  2L3J A;  4LF6 E;  5ADZ A;  2F8B A;  2LJH A;  2ODR D;  2VF1 A;  2FGG A;  1X49 A;  1EKZ A;  1J26 A;  3K6Q A;  3IWC A;  4WPY A;  2F4V E;  4AQY E;  2V8Q B;  4DV6 E;  4DR6 E;  2L92 A;  4F9C B;  2B7T A;  4DR1 E;  2LBS B;  3JTZ A;  2KOU A;  3JU0 A;  4WSP A;  3VYX A;  4KHP E;  2M4I A;  1GZ6 A;  4BCA A;  2MC6 A;  3HTX A;  2KHX A;  4X65 E;  3KWR A;  2UUB E;  5LL6 R;  2LTS A;  1PKP A;  2YZT A;  4JYA E;  1N32 E;  2E5L E;  1X48 A;  1ZBT A;  2L2M A;  2L33 A;  4KZS A;  1YZ9 A;  4L5N C;  1WHN A;  5AE3 A;  4DUZ E;  4X64 E;  1I94 E;  4DV3 E;  2V89 A;  2UU9 E;  3DF6 A;  4OX9 E;  2NA2 A;  2RSM A;  2VE7 C;  2UUC E;  1XNQ E;  2NUF A;  1FJG E;  2B7V A;  3IWB A;  2M7Q A;  3J80 C;  3RMP A;  2V88 A;  1HNX E;  4JV5 E;  2UXD E;  3IWD A;  4JI5 E;  3J7A G;  3T1H E;  3ADJ A;  4P78 A;  2RS6 A;  1N33 E;  4LTY A;  1X47 A;  4F54 A;  1HNW E;  1YYW A;  4TUG A;  3OML A;  5FLX C;  2B3T B;  4J8Z A;  4LF5 E;  4NXN E;  4B3T E;  2CPN A;  1UIL A;  5LMU E;  1DI2 A;  2L6M A;  1WHQ A;  3J81 C;  4BC9 A;  3H09 A;  1FKA E;  2M1S A;  3HPZ A;  5A2Q C;  1HR0 E;  2E1M A;  4I8O A;  4BC7 A;  4L8N A;  2ZM6 E;  2VQF E;  3VYY A;  1XMO E;  1XMQ E;  4DR4 E;  1N34 E;  2FV4 B;  4M30 A;  2LTR A;  4JI7 E;  4GEQ B;  2DIX A;  4LF4 E;  4LFC E;  5LMN E;  2MC5 A;  5IWA E;  2EWL A;  2MDR A;  1IBL E;  4R03 A;  4LF8 E;  3ADL A;  2DB2 A;  5T6J A;  2JWO A;  2JY9 A;  3AV0 A;  2LUP B;  2LRS A;  3LLH A;  3JAM C;  2JOB A;  3ADI A;  4OOG C;  4BS9 A;  1HNZ E;  4Q28 A;  5AAS A;  1RC7 A;  1N36 E;  4JI1 E;  3C4T A;  2ODR C;  3AUZ A;  3DJW A;  4DMI A;  4YHH E;  4B3S E;  2B9D A;  2DSY A;  2RTX A;  2EZ6 A;  4WYQ B;  2NUG A;  4DV2 E;  2DMY A;  2UXC E;  2L2N A;  4DR2 E;  4GKK E;  3HPS A;  4LF9 E;  1XNR E;  4DV5 E;  2KON A;  2IHR 1;  1WXR A;  1T4N A;  4LU9 A;  3F6G A;  4X8W A;  5IT9 C;  1YYK A;  3ADG A;  1UHZ A;  1O0W A;  4JI4 E;  1T4O A;  2JR1 A;  2K4V A;  1RQ0 A;  3VK6 A;  1T4L B;  1J5E E;  5AE1 A;  3F6H A;  5DNY A;  5F3W A;  4B3M E;  2V86 A;  4DV4 E;  2RS7 A;  4X66 E;  2LUQ A;  3C4B A;  4P7D A;  2L2K B;  1ZBQ A;  4BMJ A;  5CFF E;  1QU6 A;  2YT4 A;  2V83 A;  2JOX A;  4F9A B;  4JI2 E;  4WFT A;  2UXB E;  4DV7 E;  4DR7 E;  5BR8 E;  4BBY A;  4TUI A;  3LML A;  2JVA A;  4JI3 E;  4F9B B;  4JI0 E;  2UUA E;  4LFB E;  3T1Y E;  1YYO A;  2LMZ A;  3J7Y p;  3MSW A;  4DUY E;  2N3H A;  4R8O A;  4YY3 E;  2L8T A;  4B3R E;  4GKJ E;  4LFA E;  4DR5 E;  2LE2 A;  2HHH E;  5AE2 A;  3HQ1 A;  2WZO A;  4LF7 E;  3OTO E;  4DR3 E;  4DV0 E;  1DQ3 A;  2N3G A;  4M2Z A;  2H36 X;  4DV1 E;  4JI6 E;  1IBK E;  2G7H A;  2V85 A;  1STU A;  4X62 E;  4JI8 E;  1SR9 A;  2L3C A;  4NXM E;  4M0V A;  2FTX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...