2L3CA

Solution structure of adar2 dsrbm1 bound to lsl rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/rna
total genus 16
structure length 74
sequence length 74
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3cA00
1RQ0A 2F4VE 4LFCE 1FJGE 4DV2E 4LF5E 2E5LE 1EKZA 1WHNA 3P1XA 4DR1E 3VYYA 3ADLA 4DR7E 4DV7E 3ADGA 1QU6A 2UXBE 3C4TA 4YY3E 1GQEA 2DB2A 3VYXA 1XMOE 4JI1E 4DR5E 1HR0E 1X48A 4DV6E 1RC7A 1N33E 2L33A 1T4LB 2B3TB 4OOGC 2B7TA 1N32E 2NUGA 4JI8E 1O0WA 1IBME 3C4BA 2N3GA 4B3ME 2NUFA 1WHQA 4AQYE 4JI4E 1N34E 2LUPB 4DKKA 2HHHE 2B7VA 3OTOE 2LRSA 4LFBE 5LMUE 4DR4E 4GKKE 3T1YE 1STUA 1X47A 2YT4A 4X8WA 3LLHA 4DUYE 4DV1E 4DV3E 2JVAA 4JV5E 2RS7A 4DR6E 4DUZE 1X49A 4WYQB 4B3TE 2JY9A 4B3RE 2RTXA 1T4OA 2UXCE 5BR8E 2KHXA 2UU9E 4JI2E 4B3SE 3J7Yp 4NXNE 2LJHA 3ADJA 2LBSB 1IBLE 2L3JA 3T1HE 2UUCE 2RS6A 2CPNA 4LF6E 4DV5E 2RSMA 2L3CA 4DR3E 4JI7E 1XNQE 1YZ9A 4X65E 4JI5E 4GKJE 1J26A 2LTRA 5CFFE 4LF9E 2LUQA 4M2ZA 2MDRA 1IBKE 4JI3E 4NXME 1XNRE 1HNWE 4DV0E 1DI2A 1J5EE 4X64E 2DMYA 1YYOA 4LF4E 1UHZA 1ZBTA 2L2MA 4X66E 4DR2E 1HNZE 4LF7E 1YYKA 1HNXE 2IHR1 2VQEE 2LTSA 3ADIA 5LMNE 1FKAE 2UXDE 2L2NA 2DIXA 2VQFE 1YYWA 2EZ6A 1I94E 4K0KE 4JI0E 1T4NA 2ZM6E 2UUBE 2L2KB 2NUEA 4LF8E 4M30A 1N36E 1PKPA 4WFTA 2UUAE 4DV4E 1XMQE 4X62E 4JI6E 2NA2A 5IWAE 4YHHE 4KHPE 4OX9E 2N3HA 1UILA 4JYAE 4LFAE 3HTXA
chains in the Genus database with same CATH superfamily
4WSPA 2EMIA 2EPLX 4J8ZA 4DR1E 2JOXA 3MSWA 2EM4A 3ADGA 1QU6A 2EORA 2YSOA 1JK2A 1AAYA 1YSAC 2DGCA 2EMWA 2UXBE 4F9CB 4R2EA 3OMLA 3HPSA 2DRPA 1X48A 4DV6E 4BC7A 2EWLA 2B3TB 2CTDA 1N32E 2NUGA 1IBME 2A25A 2EPCA 5IV8B 2LMZA 2M7QA 2EL5A 4JI4E 5A6KA 2LUPB 5A69A 2EPOA 4DR4E 4GKKE 3T1YE 1STUA 1X47A 2EOIA 4O5GA 5AE2A 2VF1A 2V88A 2JP9A 2R1FA 5ADZA 2EPXA 3KWRA 1LLMC 1A1IA 4DUZE 4JV5E 4B3TE 2FTXB 2EQ0A 2G7HA 2RTXA 3K6QA 1T4OA 3AUZA 2KHXA 2EOHA 1PDAA 4WXDA 2LJHA 2FV4B 2LBSB 1IBLE 2EE8A 4NZVA 2LJUA 2CPNA 2DSYA 3BIDA 4DV5E 3AV0A 4JI7E 1A1GA 1ZAAC 3EPKA 5AASA 1TF6A 2LT7A 1DQ3A 2JWOA 4F9AB 1WRJA 1EH7A 2EMCA 4I8OA 2LTRA 3KZZA 4IJDA 2EMYA 4NXME 2L8TA 2V83A 1J5EE 2EOEA 4X64E 2VRDA 4P78A 1MEYC 2DMYA 1YYOA 4LF4E 1UHZA 1ZBTA 4DR2E 1HNZE 4LF7E 1YYKA 2IHR1 1X5WA 4JI0E 2EM5A 4M30A 3BBGA 4WFTA 2UUAE 2VE7C 1A1KA 4X62E 2PRTA 5KL3A 3J80C 2V87A 5TSEA 4YHHE 4O24A 4KHPE 4OX9E 1UILA 2N8XA 4LFAE 3EQ1A 2V85A 3TQMA 1FJGE 4DV2E 4R2RA 4LF5E 4BMJA 3VYYA 2LE2A 4HTGA 3THNA 1PJSA 3C4TA 3F6GA 3J7AG 4BHCA 4YY3E 1AH5A 4JI1E 2YSPA 1HR0E 1RC7A 3VK6A 2EM3A 2L33A 4FK5C 1T4LB 2EN1A 2B7TA 2ENAA 1KYQA 1O0WA 1X6FA 3C4BA 2N3GA 2EQ1A 4L5NC 2D9HA 2NUFA 1WHQA 2LRSA 3DJWA 2YT4A 4R2AA 4X8WA 2EPAA 3LLHA 4F6MA 5IXMB 4R2CA 1SFEA 2M1SA 4HEIA 1SR9A 1X49A 4R03A 4WYQB 4BC9A 2E72A 4LU9A 5BR8E 2UU9E 4B3SE 3J7Yp 2MKNA 4LTYA 2L92A 4F54A 4ZYGA 5F3WA 3THOB 5IT9C 3ECRA 2UUCE 2RPCA 5A6JA 4X9JA 4NHRA 5KL7A 1BBOA 1XNQE 3IWBA 3M99B 2YPNA 1J26A 2EM0A 2WZOA 1T39A 2EMFA 2JYAA 2YTDA 3HXLA 4WXCA 4Q28A 2L2MA 1HNXE 2VQEE 2EM6A 3UK3C 2MC5A 1FKAE 2YTPA 1G2FC 2V8QB 2V89A 2VQFE 4K0KE 2YTNA 2E1MA 2L2KB 2EN2A 4KWYA 1XMQE 3RMPA 4O43A 4BS9A 2ELYA 5DNYA 2NA2A 2EM8A 2DLKA 4JYAE 2DLQA 3HTXA 2CT1A 2YTIA 1WXRA 1ZBQA 3MHSC 2ODRC 4BHBA 2DMIA 2E5LE 1EKZA 2ENCA 3F6HA 2K4VA 2WBSA 4R2PA 2EOJA 1JK1A 1TN9A 3L00A 1GQEA 2EPMX 2EPNA 2YU8A 2BBGA 4N4RB 1F2IG 2ODRD 3JAMC 4JI8E 3ZOQB 2F8BA 2GPIA 3KZYA 4B3ME 2K7IA 4R8OA 3C6KA 3JU0A 4AQYE 2EMKA 1GTKA 2JOBA 4RHBB 3HQ1A 4DKKA 2HHHE 2B7VA 2EN4A 3OTOE 2JR1A 4DUYE 4DV1E 1PJTA 4DMIA 4DV3E 2YTGA 1A1FA 2JVAA 3IWCA 1IQOA 2RS7A 2MC6A 1NEIA 3C6MA 2I9IA 2EQ3A 2EMLA 4WPYA 2H36X 5KL6A 2EOZA 1L4SA 2LV2A 4NXNE 2JXPA 2YRMA 3ADJA 2L3JA 3LMLA 2RSMA 4R2DA 2L3CA 4P7DA 2JPAA 4KZSA 2EOQA 1QNTA 4F9BB 1YZ9A 1IMUA 4X65E 4M0VA 2EJ4A 1IQSA 1YUJA 2YRHA 2GHFA 4GKJE 5CFFE 2LUQA 2MDRA 1IBKE 4JI3E 1HNWE 4M9VC 2J7JA 4ZYEA 4GEQB 1ZR9A 2YWQA 1UN6B 5A6AA 5AE1A 1G2DC 1RMDA 2ENHA 4BCAA 5LL6R 2LTSA 2WBTA 2EPKX 5A6BD 3ADIA 2YTJA 2ADRA 3EPLA 5LMNE 2YTOA 3BF2A 4TUIA 2YTQA 2L2NA 2DIXA 4GZNC 1ZU1A 2EMBA 4WX9A 1I94E 1YYWA 2UXDE 1T4NA 2EN3A 4IS1C 3IWDA 4LF8E 1WJPA 2FGGA 1N36E 2EL4A 1X6EA 5T6JA 2WCC3 4DV4E 2RSIA 1N3GA 2WBUA 2EN7A 3HPZA 1B69A 2N3HA 4ZYHA 3J81C 1EH6A 1A1HA 1RQ0A 2F4VE 2EM7A 2HC5A 1YFHA 4LFCE 2EOXA 2MKDA 1WHNA 2EOFA 3P1XA 2LVHA 3ADLA 4BBYA 4DR7E 3EPJA 4R2QA 4DV7E 5AE3A 1BBGA 5LLQA 4F6NA 2DB2A 3VYXA 2BB8A 1XMOE 4TUGA 1UBDC 3DF6A 4DR5E 1N33E 2LCEA 4OOGC 5AC4A 4MLQA 2KOUA 2EMXA 2EN6A 1X3CA 1YUIA 2EPUA 3QG5C 1T38A 1N34E 2LO3A 1A1LA 4LFBE 5LMUE 2HJJA 5KL2A 2RQLA 2CSHA 2EOYA 2EP3A 4RH8A 1MGTA 4MLVA 4DR6E 2JY9A 3FIGA 1TF3A 4B3RE 4WSGA 2EMZA 2V86A 2UXCE 2EMAA 2YRKA 2HGHA 4JI2E 2EOSA 4Q35B 2EPPA 2EMGA 2EPZA 3T1HE 2EOOA 2RS6A 4LF6E 1KJKA 4DR3E 2I13A 4F2JC 4R2SA 2YTEA 3BGHA 2MDGA 4JI5E 3EPHA 4L8NA 4LF9E 4M2ZA 2GLIA 2R76A 1XNRE 4DV0E 5FLXC 1DI2A 2EM9A 2EMHA 2EPRA 5AC5A 4X66E 2ELZA 5A2QC 2B9DA 3VHTB 1GZ6A 1Z1BA 2EOMA 2M4IA 3MHHC 1BB8A 1X6HA 2EM2A 2KONA 5KL5A 2EZ6A 2YTFA 2YU5A 2ZM6E 2UUBE 1P47A 1A1JA 2NUEA 5A6BA 3JTZA 1PKPA 2EL6A 5KL4A 2L6MA 4O4KA 1NCSA 4JI6E 2Q8UA 2YZTA 3H09A 4ZYDA 2M9AA 1EH8A 2EN8A 5IWAE 1PJQA 2NABA 1DGCA 1YPNA
chains in the Genus database with same CATH topology
1RQ0A 2F4VE 1WXRA 1ZBQA 4LFCE 2V85A 4WSPA 1FJGE 2ODRC 4DV2E 4LF5E 2E5LE 1EKZA 1WHNA 3F6HA 3P1XA 2K4VA 2JOXA 3MSWA 4J8ZA 4BMJA 4DR1E 3VYYA 3ADLA 2LE2A 4BBYA 4DR7E 4DV7E 3ADGA 1QU6A 5AE3A 2UXBE 3C4TA 3F6GA 3J7AG 4F9CB 4YY3E 1GQEA 2DB2A 3VYXA 1XMOE 4TUGA 3OMLA 3DF6A 3HPSA 4DR5E 1HR0E 1X48A 4DV6E 4JI1E 1RC7A 4BC7A 1N33E 3VK6A 2L33A 1T4LB 2EWLA 2B3TB 4OOGC 2B7TA 1N32E 2ODRD 3JAMC 2NUGA 2KOUA 1O0WA 4JI8E 3ZOQB 1IBME 3C4BA 2F8BA 2N3GA 4L5NC 4B3ME 4R8OA 2LMZA 2NUFA 1WHQA 3JU0A 2M7QA 4AQYE 4JI4E 2JOBA 1N34E 2LUPB 3HQ1A 4DKKA 2HHHE 2B7VA 3OTOE 2LRSA 4LFBE 5LMUE 4DR4E 4GKKE 3DJWA 3T1YE 1STUA 1X47A 2JR1A 2YT4A 3LLHA 4X8WA 4DMIA 5AE2A 4DUYE 2VF1A 4DV3E 2V88A 2JVAA 5ADZA 3IWCA 3KWRA 4JV5E 2M1SA 2RS7A 2MC6A 1SR9A 1X49A 4R03A 4WYQB 4BC9A 4DUZE 4B3TE 2JY9A 3FIGA 2FTXB 4B3RE 2G7HA 2RTXA 2V86A 3K6QA 1T4OA 3AUZA 4LU9A 5BR8E 2KHXA 2UU9E 4WPYA 2H36X 4JI2E 4B3SE 2UXCE 3J7Yp 4LTYA 4DV1E 2L92A 4F54A 5F3WA 4NXNE 2LJHA 2FV4B 5IT9C 3ADJA 2LBSB 1IBLE 2L3JA 3T1HE 4DR6E 2UUCE 2RS6A 2CPNA 2DSYA 4LF6E 4DV5E 3LMLA 2RSMA 3AV0A 2L3CA 4P7DA 4JI7E 4DR3E 5AASA 4KZSA 1XNQE 1DQ3A 2JWOA 4F9AB 4F9BB 1YZ9A 4X65E 4M0VA 3IWBA 4JI5E 4L8NA 4GKJE 4I8OA 1J26A 2LTRA 5CFFE 4LF9E 2LUQA 4M2ZA 2MDRA 2WZOA 1IBKE 4JI3E 4NXME 1XNRE 1HNWE 2L8TA 5FLXC 2V83A 4DV0E 1J5EE 1DI2A 4GEQB 3HXLA 4P78A 4X64E 2DMYA 1YYOA 4LF4E 1UHZA 1ZBTA 2L2MA 4Q28A 5AE1A 4X66E 5A2QC 2B9DA 4DR2E 1HNZE 4LF7E 1YYKA 4BCAA 1GZ6A 1HNXE 2IHR1 5LL6R 2VQEE 2LTSA 2M4IA 3ADIA 5LMNE 2MC5A 1FKAE 4TUIA 2UXDE 2L2NA 2DIXA 2V8QB 2KONA 2V89A 2VQFE 1I94E 1YYWA 2EZ6A 4JI0E 4K0KE 1T4NA 2ZM6E 2UUBE 2E1MA 2L2KB 3IWDA 4LF8E 2NUEA 4M30A 2FGGA 3JTZA 1N36E 1PKPA 4WFTA 5T6JA 2UUAE 2L6MA 4DV4E 2VE7C 1XMQE 3RMPA 4X62E 4JI6E 2YZTA 3H09A 4BS9A 3J80C 2V87A 5DNYA 2NA2A 5IWAE 4YHHE 3HPZA 4KHPE 4OX9E 2N3HA 1UILA 4JYAE 4LFAE 3HTXA 3J81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQ0 A;  2F4V E;  4LFC E;  1FJG E;  4DV2 E;  4LF5 E;  2E5L E;  1EKZ A;  1WHN A;  3P1X A;  4DR1 E;  3VYY A;  3ADL A;  4DR7 E;  4DV7 E;  3ADG A;  1QU6 A;  2UXB E;  3C4T A;  4YY3 E;  1GQE A;  2DB2 A;  3VYX A;  1XMO E;  4JI1 E;  4DR5 E;  1HR0 E;  1X48 A;  4DV6 E;  1RC7 A;  1N33 E;  2L33 A;  1T4L B;  2B3T B;  4OOG C;  2B7T A;  1N32 E;  2NUG A;  4JI8 E;  1O0W A;  1IBM E;  3C4B A;  2N3G A;  4B3M E;  2NUF A;  1WHQ A;  4AQY E;  4JI4 E;  1N34 E;  2LUP B;  4DKK A;  2HHH E;  2B7V A;  3OTO E;  2LRS A;  4LFB E;  5LMU E;  4DR4 E;  4GKK E;  3T1Y E;  1STU A;  1X47 A;  2YT4 A;  4X8W A;  3LLH A;  4DUY E;  4DV1 E;  4DV3 E;  2JVA A;  4JV5 E;  2RS7 A;  4DR6 E;  4DUZ E;  1X49 A;  4WYQ B;  4B3T E;  2JY9 A;  4B3R E;  2RTX A;  1T4O A;  2UXC E;  5BR8 E;  2KHX A;  2UU9 E;  4JI2 E;  4B3S E;  3J7Y p;  4NXN E;  2LJH A;  3ADJ A;  2LBS B;  1IBL E;  2L3J A;  3T1H E;  2UUC E;  2RS6 A;  2CPN A;  4LF6 E;  4DV5 E;  2RSM A;  2L3C A;  4DR3 E;  4JI7 E;  1XNQ E;  1YZ9 A;  4X65 E;  4JI5 E;  4GKJ E;  1J26 A;  2LTR A;  5CFF E;  4LF9 E;  2LUQ A;  4M2Z A;  2MDR A;  1IBK E;  4JI3 E;  4NXM E;  1XNR E;  1HNW E;  4DV0 E;  1DI2 A;  1J5E E;  4X64 E;  2DMY A;  1YYO A;  4LF4 E;  1UHZ A;  1ZBT A;  2L2M A;  4X66 E;  4DR2 E;  1HNZ E;  4LF7 E;  1YYK A;  1HNX E;  2IHR 1;  2VQE E;  2LTS A;  3ADI A;  5LMN E;  1FKA E;  2UXD E;  2L2N A;  2DIX A;  2VQF E;  1YYW A;  2EZ6 A;  1I94 E;  4K0K E;  4JI0 E;  1T4N A;  2ZM6 E;  2UUB E;  2L2K B;  2NUE A;  4LF8 E;  4M30 A;  1N36 E;  1PKP A;  4WFT A;  2UUA E;  4DV4 E;  1XMQ E;  4X62 E;  4JI6 E;  2NA2 A;  5IWA E;  4YHH E;  4KHP E;  4OX9 E;  2N3H A;  1UIL A;  4JYA E;  4LFA E;  3HTX A; 
#chains in the Genus database with same CATH topology
 4WSP A;  2EMI A;  2EPL X;  4J8Z A;  4DR1 E;  2JOX A;  3MSW A;  2EM4 A;  3ADG A;  1QU6 A;  2EOR A;  2YSO A;  1JK2 A;  1AAY A;  1YSA C;  2DGC A;  2EMW A;  2UXB E;  4F9C B;  4R2E A;  3OML A;  3HPS A;  2DRP A;  1X48 A;  4DV6 E;  4BC7 A;  2EWL A;  2B3T B;  2CTD A;  1N32 E;  2NUG A;  1IBM E;  2A25 A;  2EPC A;  5IV8 B;  2LMZ A;  2M7Q A;  2EL5 A;  4JI4 E;  5A6K A;  2LUP B;  5A69 A;  2EPO A;  4DR4 E;  4GKK E;  3T1Y E;  1STU A;  1X47 A;  2EOI A;  4O5G A;  5AE2 A;  2VF1 A;  2V88 A;  2JP9 A;  2R1F A;  5ADZ A;  2EPX A;  3KWR A;  1LLM C;  1A1I A;  4DUZ E;  4JV5 E;  4B3T E;  2FTX B;  2EQ0 A;  2G7H A;  2RTX A;  3K6Q A;  1T4O A;  3AUZ A;  2KHX A;  2EOH A;  1PDA A;  4WXD A;  2LJH A;  2FV4 B;  2LBS B;  1IBL E;  2EE8 A;  4NZV A;  2LJU A;  2CPN A;  2DSY A;  3BID A;  4DV5 E;  3AV0 A;  4JI7 E;  1A1G A;  1ZAA C;  3EPK A;  5AAS A;  1TF6 A;  2LT7 A;  1DQ3 A;  2JWO A;  4F9A B;  1WRJ A;  1EH7 A;  2EMC A;  4I8O A;  2LTR A;  3KZZ A;  4IJD A;  2EMY A;  4NXM E;  2L8T A;  2V83 A;  1J5E E;  2EOE A;  4X64 E;  2VRD A;  4P78 A;  1MEY C;  2DMY A;  1YYO A;  4LF4 E;  1UHZ A;  1ZBT A;  4DR2 E;  1HNZ E;  4LF7 E;  1YYK A;  2IHR 1;  1X5W A;  4JI0 E;  2EM5 A;  4M30 A;  3BBG A;  4WFT A;  2UUA E;  2VE7 C;  1A1K A;  4X62 E;  2PRT A;  5KL3 A;  3J80 C;  2V87 A;  5TSE A;  4YHH E;  4O24 A;  4KHP E;  4OX9 E;  1UIL A;  2N8X A;  4LFA E;  3EQ1 A;  2V85 A;  3TQM A;  1FJG E;  4DV2 E;  4R2R A;  4LF5 E;  4BMJ A;  3VYY A;  2LE2 A;  4HTG A;  3THN A;  1PJS A;  3C4T A;  3F6G A;  3J7A G;  4BHC A;  4YY3 E;  1AH5 A;  4JI1 E;  2YSP A;  1HR0 E;  1RC7 A;  3VK6 A;  2EM3 A;  2L33 A;  4FK5 C;  1T4L B;  2EN1 A;  2B7T A;  2ENA A;  1KYQ A;  1O0W A;  1X6F A;  3C4B A;  2N3G A;  2EQ1 A;  4L5N C;  2D9H A;  2NUF A;  1WHQ A;  2LRS A;  3DJW A;  2YT4 A;  4R2A A;  4X8W A;  2EPA A;  3LLH A;  4F6M A;  5IXM B;  4R2C A;  1SFE A;  2M1S A;  4HEI A;  1SR9 A;  1X49 A;  4R03 A;  4WYQ B;  4BC9 A;  2E72 A;  4LU9 A;  5BR8 E;  2UU9 E;  4B3S E;  3J7Y p;  2MKN A;  4LTY A;  2L92 A;  4F54 A;  4ZYG A;  5F3W A;  3THO B;  5IT9 C;  3ECR A;  2UUC E;  2RPC A;  5A6J A;  4X9J A;  4NHR A;  5KL7 A;  1BBO A;  1XNQ E;  3IWB A;  3M99 B;  2YPN A;  1J26 A;  2EM0 A;  2WZO A;  1T39 A;  2EMF A;  2JYA A;  2YTD A;  3HXL A;  4WXC A;  4Q28 A;  2L2M A;  1HNX E;  2VQE E;  2EM6 A;  3UK3 C;  2MC5 A;  1FKA E;  2YTP A;  1G2F C;  2V8Q B;  2V89 A;  2VQF E;  4K0K E;  2YTN A;  2E1M A;  2L2K B;  2EN2 A;  4KWY A;  1XMQ E;  3RMP A;  4O43 A;  4BS9 A;  2ELY A;  5DNY A;  2NA2 A;  2EM8 A;  2DLK A;  4JYA E;  2DLQ A;  3HTX A;  2CT1 A;  2YTI A;  1WXR A;  1ZBQ A;  3MHS C;  2ODR C;  4BHB A;  2DMI A;  2E5L E;  1EKZ A;  2ENC A;  3F6H A;  2K4V A;  2WBS A;  4R2P A;  2EOJ A;  1JK1 A;  1TN9 A;  3L00 A;  1GQE A;  2EPM X;  2EPN A;  2YU8 A;  2BBG A;  4N4R B;  1F2I G;  2ODR D;  3JAM C;  4JI8 E;  3ZOQ B;  2F8B A;  2GPI A;  3KZY A;  4B3M E;  2K7I A;  4R8O A;  3C6K A;  3JU0 A;  4AQY E;  2EMK A;  1GTK A;  2JOB A;  4RHB B;  3HQ1 A;  4DKK A;  2HHH E;  2B7V A;  2EN4 A;  3OTO E;  2JR1 A;  4DUY E;  4DV1 E;  1PJT A;  4DMI A;  4DV3 E;  2YTG A;  1A1F A;  2JVA A;  3IWC A;  1IQO A;  2RS7 A;  2MC6 A;  1NEI A;  3C6M A;  2I9I A;  2EQ3 A;  2EML A;  4WPY A;  2H36 X;  5KL6 A;  2EOZ A;  1L4S A;  2LV2 A;  4NXN E;  2JXP A;  2YRM A;  3ADJ A;  2L3J A;  3LML A;  2RSM A;  4R2D A;  2L3C A;  4P7D A;  2JPA A;  4KZS A;  2EOQ A;  1QNT A;  4F9B B;  1YZ9 A;  1IMU A;  4X65 E;  4M0V A;  2EJ4 A;  1IQS A;  1YUJ A;  2YRH A;  2GHF A;  4GKJ E;  5CFF E;  2LUQ A;  2MDR A;  1IBK E;  4JI3 E;  1HNW E;  4M9V C;  2J7J A;  4ZYE A;  4GEQ B;  1ZR9 A;  2YWQ A;  1UN6 B;  5A6A A;  5AE1 A;  1G2D C;  1RMD A;  2ENH A;  4BCA A;  5LL6 R;  2LTS A;  2WBT A;  2EPK X;  5A6B D;  3ADI A;  2YTJ A;  2ADR A;  3EPL A;  5LMN E;  2YTO A;  3BF2 A;  4TUI A;  2YTQ A;  2L2N A;  2DIX A;  4GZN C;  1ZU1 A;  2EMB A;  4WX9 A;  1I94 E;  1YYW A;  2UXD E;  1T4N A;  2EN3 A;  4IS1 C;  3IWD A;  4LF8 E;  1WJP A;  2FGG A;  1N36 E;  2EL4 A;  1X6E A;  5T6J A;  2WCC 3;  4DV4 E;  2RSI A;  1N3G A;  2WBU A;  2EN7 A;  3HPZ A;  1B69 A;  2N3H A;  4ZYH A;  3J81 C;  1EH6 A;  1A1H A;  1RQ0 A;  2F4V E;  2EM7 A;  2HC5 A;  1YFH A;  4LFC E;  2EOX A;  2MKD A;  1WHN A;  2EOF A;  3P1X A;  2LVH A;  3ADL A;  4BBY A;  4DR7 E;  3EPJ A;  4R2Q A;  4DV7 E;  5AE3 A;  1BBG A;  5LLQ A;  4F6N A;  2DB2 A;  3VYX A;  2BB8 A;  1XMO E;  4TUG A;  1UBD C;  3DF6 A;  4DR5 E;  1N33 E;  2LCE A;  4OOG C;  5AC4 A;  4MLQ A;  2KOU A;  2EMX A;  2EN6 A;  1X3C A;  1YUI A;  2EPU A;  3QG5 C;  1T38 A;  1N34 E;  2LO3 A;  1A1L A;  4LFB E;  5LMU E;  2HJJ A;  5KL2 A;  2RQL A;  2CSH A;  2EOY A;  2EP3 A;  4RH8 A;  1MGT A;  4MLV A;  4DR6 E;  2JY9 A;  3FIG A;  1TF3 A;  4B3R E;  4WSG A;  2EMZ A;  2V86 A;  2UXC E;  2EMA A;  2YRK A;  2HGH A;  4JI2 E;  2EOS A;  4Q35 B;  2EPP A;  2EMG A;  2EPZ A;  3T1H E;  2EOO A;  2RS6 A;  4LF6 E;  1KJK A;  4DR3 E;  2I13 A;  4F2J C;  4R2S A;  2YTE A;  3BGH A;  2MDG A;  4JI5 E;  3EPH A;  4L8N A;  4LF9 E;  4M2Z A;  2GLI A;  2R76 A;  1XNR E;  4DV0 E;  5FLX C;  1DI2 A;  2EM9 A;  2EMH A;  2EPR A;  5AC5 A;  4X66 E;  2ELZ A;  5A2Q C;  2B9D A;  3VHT B;  1GZ6 A;  1Z1B A;  2EOM A;  2M4I A;  3MHH C;  1BB8 A;  1X6H A;  2EM2 A;  2KON A;  5KL5 A;  2EZ6 A;  2YTF A;  2YU5 A;  2ZM6 E;  2UUB E;  1P47 A;  1A1J A;  2NUE A;  5A6B A;  3JTZ A;  1PKP A;  2EL6 A;  5KL4 A;  2L6M A;  4O4K A;  1NCS A;  4JI6 E;  2Q8U A;  2YZT A;  3H09 A;  4ZYD A;  2M9A A;  1EH8 A;  2EN8 A;  5IWA E;  1PJQ A;  2NAB A;  1DGC A;  1YPN A; 
#chains in the Genus database with same CATH homology
 1RQ0 A;  2F4V E;  1WXR A;  1ZBQ A;  4LFC E;  2V85 A;  4WSP A;  1FJG E;  2ODR C;  4DV2 E;  4LF5 E;  2E5L E;  1EKZ A;  1WHN A;  3F6H A;  3P1X A;  2K4V A;  2JOX A;  3MSW A;  4J8Z A;  4BMJ A;  4DR1 E;  3VYY A;  3ADL A;  2LE2 A;  4BBY A;  4DR7 E;  4DV7 E;  3ADG A;  1QU6 A;  5AE3 A;  2UXB E;  3C4T A;  3F6G A;  3J7A G;  4F9C B;  4YY3 E;  1GQE A;  2DB2 A;  3VYX A;  1XMO E;  4TUG A;  3OML A;  3DF6 A;  3HPS A;  4DR5 E;  1HR0 E;  1X48 A;  4DV6 E;  4JI1 E;  1RC7 A;  4BC7 A;  1N33 E;  3VK6 A;  2L33 A;  1T4L B;  2EWL A;  2B3T B;  4OOG C;  2B7T A;  1N32 E;  2ODR D;  3JAM C;  2NUG A;  2KOU A;  1O0W A;  4JI8 E;  3ZOQ B;  1IBM E;  3C4B A;  2F8B A;  2N3G A;  4L5N C;  4B3M E;  4R8O A;  2LMZ A;  2NUF A;  1WHQ A;  3JU0 A;  2M7Q A;  4AQY E;  4JI4 E;  2JOB A;  1N34 E;  2LUP B;  3HQ1 A;  4DKK A;  2HHH E;  2B7V A;  3OTO E;  2LRS A;  4LFB E;  5LMU E;  4DR4 E;  4GKK E;  3DJW A;  3T1Y E;  1STU A;  1X47 A;  2JR1 A;  2YT4 A;  3LLH A;  4X8W A;  4DMI A;  5AE2 A;  4DUY E;  2VF1 A;  4DV3 E;  2V88 A;  2JVA A;  5ADZ A;  3IWC A;  3KWR A;  4JV5 E;  2M1S A;  2RS7 A;  2MC6 A;  1SR9 A;  1X49 A;  4R03 A;  4WYQ B;  4BC9 A;  4DUZ E;  4B3T E;  2JY9 A;  3FIG A;  2FTX B;  4B3R E;  2G7H A;  2RTX A;  2V86 A;  3K6Q A;  1T4O A;  3AUZ A;  4LU9 A;  5BR8 E;  2KHX A;  2UU9 E;  4WPY A;  2H36 X;  4JI2 E;  4B3S E;  2UXC E;  3J7Y p;  4LTY A;  4DV1 E;  2L92 A;  4F54 A;  5F3W A;  4NXN E;  2LJH A;  2FV4 B;  5IT9 C;  3ADJ A;  2LBS B;  1IBL E;  2L3J A;  3T1H E;  4DR6 E;  2UUC E;  2RS6 A;  2CPN A;  2DSY A;  4LF6 E;  4DV5 E;  3LML A;  2RSM A;  3AV0 A;  2L3C A;  4P7D A;  4JI7 E;  4DR3 E;  5AAS A;  4KZS A;  1XNQ E;  1DQ3 A;  2JWO A;  4F9A B;  4F9B B;  1YZ9 A;  4X65 E;  4M0V A;  3IWB A;  4JI5 E;  4L8N A;  4GKJ E;  4I8O A;  1J26 A;  2LTR A;  5CFF E;  4LF9 E;  2LUQ A;  4M2Z A;  2MDR A;  2WZO A;  1IBK E;  4JI3 E;  4NXM E;  1XNR E;  1HNW E;  2L8T A;  5FLX C;  2V83 A;  4DV0 E;  1J5E E;  1DI2 A;  4GEQ B;  3HXL A;  4P78 A;  4X64 E;  2DMY A;  1YYO A;  4LF4 E;  1UHZ A;  1ZBT A;  2L2M A;  4Q28 A;  5AE1 A;  4X66 E;  5A2Q C;  2B9D A;  4DR2 E;  1HNZ E;  4LF7 E;  1YYK A;  4BCA A;  1GZ6 A;  1HNX E;  2IHR 1;  5LL6 R;  2VQE E;  2LTS A;  2M4I A;  3ADI A;  5LMN E;  2MC5 A;  1FKA E;  4TUI A;  2UXD E;  2L2N A;  2DIX A;  2V8Q B;  2KON A;  2V89 A;  2VQF E;  1I94 E;  1YYW A;  2EZ6 A;  4JI0 E;  4K0K E;  1T4N A;  2ZM6 E;  2UUB E;  2E1M A;  2L2K B;  3IWD A;  4LF8 E;  2NUE A;  4M30 A;  2FGG A;  3JTZ A;  1N36 E;  1PKP A;  4WFT A;  5T6J A;  2UUA E;  2L6M A;  4DV4 E;  2VE7 C;  1XMQ E;  3RMP A;  4X62 E;  4JI6 E;  2YZT A;  3H09 A;  4BS9 A;  3J80 C;  2V87 A;  5DNY A;  2NA2 A;  5IWA E;  4YHH E;  3HPZ A;  4KHP E;  4OX9 E;  2N3H A;  1UIL A;  4JYA E;  4LFA E;  3HTX A;  3J81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...