2L3CA

Solution structure of adar2 dsrbm1 bound to lsl rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
74
structure length
74
Chain Sequence
PGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Double-stranded RNA-specific editase 1
publication title The Solution Structure of the ADAR2 dsRBM-RNA Complex Reveals a Sequence-Specific Readout of the Minor Groove.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 16
structure length 74
sequence length 74
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2l3cA00
4DR5E 1T4LB 2B7TA 4DV0E 2E5LE 1J26A 3VYXA 4DV6E 2LTSA 4GKKE 2L2MA 4YY3E 3VYYA 2UXCE 4X65E 4NXNE 2DIXA 1YYOA 1J5EE 4JI5E 1X48A 1HR0E 1IBKE 2NA2A 3OTOE 2LUQA 2UUBE 1YYWA 1T4OA 2N3GA 4M2ZA 3HTXA 4X66E 4DV5E 4DV2E 4DV7E 4DUZE 1STUA 4LF6E 4X64E 4JI7E 4JI4E 4DV1E 4KHPE 3P1XA 2ZM6E 1GQEA 1IBLE 4B3TE 3ADJA 4OX9E 4JI8E 1ZBTA 4B3SE 2UU9E 3C4TA 4DR7E 1DI2A 1IBME 1RC7A 4JYAE 2L3JA 2NUFA 4M30A 1FJGE 4LF5E 2NUGA 2L2NA 4X62E 1RQ0A 1PKPA 5LMNE 4JV5E 2DB2A 2JVAA 2LTRA 3T1HE 4DUYE 1N33E 2LJHA 4X8WA 5LMUE 5CFFE 2LUPB 4DR4E 4LF7E 2LRSA 2RS6A 1XNQE 2L33A 2YT4A 4K0KE 2B7VA 4DR3E 1UILA 4LFCE 4LF4E 2IHR1 3ADGA 1FKAE 1X49A 3LLHA 2L2KB 2VQEE 3J7Yp 1XNRE 3ADLA 2NUEA 2EZ6A 2LBSB 1HNWE 1QU6A 4GKJE 2B3TB 4WYQB 1O0WA 2UUCE 1T4NA 2VQFE 1N36E 4DR6E 4LFAE 4WFTA 1HNZE 2UXBE 2JY9A 4B3RE 2RSMA 1XMOE 1XMQE 1UHZA 4JI1E 4LF9E 2KHXA 2RS7A 2MDRA 4JI2E 4JI6E 2N3HA 4OOGC 4YHHE 3C4BA 4AQYE 4LF8E 2UUAE 1WHQA 4DV3E 2DMYA 4DKKA 4DV4E 1I94E 1N34E 2HHHE 5IWAE 4B3ME 1N32E 2RTXA 3ADIA 1YZ9A 4NXME 1WHNA 2CPNA 4DR2E 4LFBE 2L3CA 3T1YE 2UXDE 4JI3E 2F4VE 4DR1E 1YYKA 1X47A 1EKZA 1HNXE 5BR8E 4JI0E
chains in the Genus database with same CATH superfamily
2YTQA 2B7TA 2EM8A 1AAYA 4DV0E 1P47A 1LLMC 2E5LE 1A1KA 1B69A 2LJUA 2EMHA 1YPNA 2LTSA 2EOFA 2LMZA 3EQ1A 1BB8A 3IWCA 2EPUA 1AH5A 4FK5C 2V88A 1J5EE 4JI5E 3H09A 2EPCA 5T6JA 2G7HA 2EM3A 2NA2A 2WBUA 1T4OA 2N3GA 2J7JA 5IT9C 1X3CA 2YTGA 2EPRA 5IV8B 1STUA 2EL5A 2EPXA 4KHPE 1SR9A 3JU0A 2EN3A 3IWDA 1TF3A 2EN6A 2EOQA 2EMYA 2EN8A 2V83A 2V87A 2I13A 3IWBA 5IXMB 4JYAE 3BIDA 4R2EA 1YFHA 2EOXA 4WPYA 4X62E 1PKPA 1IQOA 3RMPA 4JV5E 3BF2A 2DB2A 2JVAA 2EPNA 2LTRA 3T1HE 2EMIA 4DUYE 2YRMA 1IQSA 2ODRD 2E1MA 2EL4A 3F6HA 4R2AA 4K0KE 2B7VA 4DR3E 1GTKA 4LF4E 3EPKA 1JK1A 2V8QB 2VQEE 2EM6A 2BB8A 4WSPA 1WXRA 4F2JC 1T4NA 2YTEA 3AV0A 5LL6R 2RQLA 2YZTA 4LFAE 2RPCA 2DLKA 2EMAA 2EOSA 2VRDA 1X6HA 2L92A 3C6KA 2JR1A 2EOIA 2EM7A 4F9AB 4JI6E 2YSOA 4YHHE 4AQYE 4N4RB 3JAMC 2V85A 2UUAE 4B3ME 1YSAC 2RTXA 2EMCA 2FTXB 5TSEA 5A6BD 2EPZA 1X6FA 2L3CA 4WXCA 2ENHA 2EMXA 4P78A 2CTDA 4DR1E 3VHTB 2Q8UA 3HXLA 4DR5E 2KONA 2L8TA 2B9DA 2HGHA 2R1FA 4F6MA 2ADRA 3EPLA 4IS1C 2YTJA 3DJWA 1T38A 4J8ZA 4WSGA 3VYYA 4X65E 4R2PA 2YTIA 2EOZA 4R8OA 2EMGA 2DRPA 3FIGA 1EH8A 4ZYDA 1PDAA 3OTOE 1BBGA 2EPOA 2M9AA 4DV2E 2V89A 4LF6E 3EPJA 4DV1E 2ZM6E 1GQEA 3ADJA 2EE8A 4OX9E 4JI8E 5KL5A 4B3SE 4F6NA 4R03A 2ENCA 4MLQA 4Q35B 1YUJA 2GPIA 4BC7A 2EOJA 3THOB 1RC7A 2NUFA 4KZSA 1FJGE 2YTFA 4F9CB 1EH7A 4R2RA 1RQ0A 5LMNE 4HTGA 4BHCA 4NZVA 1N33E 2EP3A 4WXDA 2L33A 2YT4A 1T39A 2EQ3A 2LVHA 3ADGA 1FKAE 1X49A 5A6AA 1A1IA 1XNRE 3EPHA 2LBSB 2EPKX 5KL4A 1TN9A 2VQFE 2R76A 4NHRA 1ZAAC 2UXBE 4B3RE 2RSMA 2D9HA 2EMZA 3J7AG 2MKDA 5LLQA 2JYAA 5AE1A 1F2IG 1X5WA 2FV4B 4BMJA 2GLIA 2EOHA 2RS7A 5F3WA 4R2DA 4JI2E 4RHBB 5AC4A 2N3HA 4OOGC 1G2DC 3C4BA 1WHQA 5AC5A 1ZBQA 4DKKA 2LV2A 2MC6A 4IJDA 5IWAE 4L5NC 3J80C 1N32E 2YRHA 1WRJA 4NXME 2JWOA 3LMLA 1WHNA 2CPNA 5KL3A 3T1YE 2EMWA 2N8XA 3MHHC 2YSPA 2UXDE 2EQ0A 4O4KA 4BCAA 4F54A 1UBDC 2DMIA 5DNYA 3BGHA 2EQ1A 4JI0E 4GKJE 2JPAA 2DLQA 2JOXA 4I8OA 4O5GA 1J26A 1KYQA 1QNTA 1PJQA 2YTDA 3L00A 4GKKE 2EJ4A 4MLVA 4YY3E 2MC5A 4DMIA 2UXCE 2DIXA 2EPPA 2EWLA 5KL7A 5A2QC 4BC9A 2YPNA 3KZZA 1IBKE 2EMLA 5KL2A 1X6EA 2LUQA 4HEIA 4O43A 4R2QA 2UUBE 4M2ZA 4X66E 4LTYA 2BBGA 4DUZE 3UK3C 1A1HA 1IBLE 2HC5A 2F8BA 2UU9E 1NCSA 3C4TA 3ECRA 4BHBA 1DI2A 1IBME 2YRKA 4X9JA 4LF5E 3M99B 2L2NA 4RH8A 1GZ6A 2EMKA 4M0VA 3QG5C 1MGTA 2VF1A 2EOYA 4LF7E 2LRSA 1XNQE 4BBYA 5A6JA 4GEQB 1UILA 2EPMX 2FGGA 3HQ1A 1ZU1A 5BR8E 1Z1BA 2YU8A 1N3GA 2DSYA 3LLHA 3J81C 3J7Yp 3ADLA 3MSWA 2NUEA 2EORA 2EZ6A 1HNWE 1QU6A 4KWYA 3AUZA 2WBSA 4WYQB 2EN1A 2EOEA 1BBOA 4P7DA 1A1FA 2JY9A 4R2CA 1PJSA 3MHSC 2MDGA 1RMDA 5A69A 1XMOE 2ODRC 1XMQE 1UHZA 4JI1E 2KHXA 2I9IA 4ZYEA 5A6BA 4LF8E 2DMYA 2EPAA 1N34E 2HHHE 2LE2A 4M9VC 5ADZA 3ADIA 1YZ9A 2JOBA 3JTZA 2WBTA 4ZYGA 1WJPA 2JXPA 2YTPA 1X47A 2GHFA 4WX9A 4GZNC 2EM2A 2YTOA 1HNXE 1IMUA 1T4LB 2LO3A 2HJJA 2K7IA 2YTNA 2KOUA 3VYXA 4TUGA 2EL6A 4DV6E 2CSHA 4O24A 2L2MA 1DGCA 1A1LA 2EM4A 4NXNE 2EN4A 1YYOA 1X48A 2H36X 1HR0E 5A6KA 2JP9A 1YYWA 2NABA 4Q28A 3HTXA 2WZOA 4ZYHA 2EN7A 4DV5E 4DV7E 3HPZA 4JI7E 4X64E 4JI4E 1PJTA 3P1XA 4B3TE 1ZBTA 2LCEA 3DF6A 3F6GA 4DR7E 3ZOQB 2L3JA 4M30A 2NUGA 1JK2A 1DQ3A 2YWQA 3K6QA 4TUIA 2A25A 2EMFA 2E72A 5AASA 1SFEA 1TF6A 2LJHA 2DGCA 4X8WA 5LMUE 5CFFE 1G2FC 2EOOA 2LUPB 4DR4E 4F9BB 1UN6B 2RS6A 2EM5A 1KJKA 4LFCE 2ELZA 2IHR1 2ELYA 2EPLX 2L2KB 1YUIA 2EM0A 3VK6A 2YU5A 2MKNA 5FLXC 2B3TB 1O0WA 2EOMA 1MEYC 2UUCE 4LU9A 1N36E 4DR6E 2L6MA 3KZYA 2M4IA 1NEIA 4WFTA 4R2SA 1HNZE 2EMBA 2WCC3 2V86A 1L4SA 1EH6A 3BBGA 4LF9E 2EM9A 2PRTA 2MDRA 1ZR9A 5AE2A 4L8NA 2M7QA 2VE7C 4DV3E 3KWRA 4DV4E 1I94E 3TQMA 5KL6A 2M1SA 5AE3A 2EN2A 2ENAA 4DR2E 2CT1A 4BS9A 4LFBE 4JI3E 2F4VE 1A1GA 2K4VA 3OMLA 1YYKA 3HPSA 1EKZA 2RSIA 3THNA 2LT7A 3C6MA 1A1JA
chains in the Genus database with same CATH topology
4DR5E 2KONA 1T4LB 2B7TA 2JOXA 2L8TA 2B9DA 4I8OA 4DV0E 2E5LE 1J26A 2KOUA 3VYXA 4TUGA 4DV6E 2LTSA 3DJWA 4GKKE 2L2MA 2LMZA 4J8ZA 4YY3E 2MC5A 4DMIA 3VYYA 2UXCE 4X65E 2UUAE 4NXNE 2DIXA 3IWCA 2EWLA 2V88A 5A2QC 1YYOA 1J5EE 1X48A 4JI5E 3H09A 2H36X 4R8OA 2G7HA 5T6JA 1HR0E 3FIGA 4BC9A 1IBKE 2NA2A 3OTOE 2LUQA 2UUBE 1YYWA 1T4OA 4Q28A 2N3GA 5IT9C 4M2ZA 3HTXA 2WZOA 4X66E 4LTYA 4DV5E 4DV2E 4DV7E 2V89A 4DUZE 1STUA 4LF6E 3HPZA 4JI7E 4X64E 4JI4E 4DV1E 4KHPE 3P1XA 2ZM6E 1GQEA 1IBLE 4B3TE 2F8BA 3ADJA 4OX9E 4JI8E 1SR9A 3JU0A 1ZBTA 3IWDA 4B3SE 2UU9E 4R03A 3DF6A 3C4TA 3F6GA 4DR7E 1DI2A 2V83A 2V87A 4BC7A 3IWBA 3ZOQB 2L3JA 1RC7A 1IBME 2NUFA 4JYAE 4KZSA 4M30A 1FJGE 4LF5E 2NUGA 2L2NA 4F9CB 4WPYA 1DQ3A 1GZ6A 4X62E 1RQ0A 1PKPA 5LMNE 3K6QA 4TUIA 3RMPA 4JV5E 2DB2A 2JVAA 4M0VA 2LTRA 5AASA 3T1HE 2VF1A 4DUYE 1N33E 2LJHA 4X8WA 5LMUE 5CFFE 2LUPB 4DR4E 2ODRD 4F9BB 2LRSA 4LF7E 2E1MA 2RS6A 1XNQE 2L33A 3F6HA 2YT4A 4BBYA 2B7VA 4GEQB 4DR3E 4K0KE 1UILA 4LFCE 2FGGA 3HQ1A 2IHR1 4LF4E 3ADGA 1FKAE 1X49A 2DSYA 2V8QB 3LLHA 3J81C 3J7Yp 2L2KB 2VQEE 3MSWA 1XNRE 2NUEA 3ADLA 3VK6A 2EZ6A 2LBSB 1HNWE 1QU6A 3AUZA 4GKJE 5FLXC 2B3TB 4WSPA 1WXRA 4WYQB 1O0WA 2UUCE 4P7DA 1T4NA 4LU9A 3AV0A 5LL6R 2VQFE 1N36E 2YZTA 4LFAE 4DR6E 2L6MA 4WFTA 2M4IA 1HNZE 2UXBE 2JY9A 4B3RE 2RSMA 2V86A 3J7AG 1XMOE 5AE1A 2ODRC 1XMQE 1UHZA 2L92A 2JR1A 1HNXE 4JI1E 2FV4B 4BMJA 4LF9E 2KHXA 2RS7A 5F3WA 2MDRA 4F9AB 4JI2E 4JI6E 2N3HA 4OOGC 5AE2A 3C4BA 4YHHE 4L8NA 2M7QA 1WHQA 2V85A 2VE7C 1ZBQA 2DMYA 3JAMC 3KWRA 4DV3E 4AQYE 4DKKA 4DV4E 1I94E 1N34E 2HHHE 2MC6A 2LE2A 3J80C 2M1SA 4L5NC 5IWAE 4B3ME 1N32E 2RTXA 2FTXB 5ADZA 3ADIA 1YZ9A 4NXME 2JWOA 3LMLA 1WHNA 2CPNA 2JOBA 5AE3A 4DR2E 4BS9A 3JTZA 4LFBE 2L3CA 3T1YE 4P78A 2UXDE 4JI3E 2F4VE 2K4VA 3OMLA 1X47A 4BCAA 4F54A 3HPSA 4DR1E 1EKZA 1YYKA 3HXLA 4LF8E 5DNYA 5BR8E 4JI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 E;  1T4L B;  2B7T A;  4DV0 E;  2E5L E;  1J26 A;  3VYX A;  4DV6 E;  2LTS A;  4GKK E;  2L2M A;  4YY3 E;  3VYY A;  2UXC E;  4X65 E;  4NXN E;  2DIX A;  1YYO A;  1J5E E;  4JI5 E;  1X48 A;  1HR0 E;  1IBK E;  2NA2 A;  3OTO E;  2LUQ A;  2UUB E;  1YYW A;  1T4O A;  2N3G A;  4M2Z A;  3HTX A;  4X66 E;  4DV5 E;  4DV2 E;  4DV7 E;  4DUZ E;  1STU A;  4LF6 E;  4X64 E;  4JI7 E;  4JI4 E;  4DV1 E;  4KHP E;  3P1X A;  2ZM6 E;  1GQE A;  1IBL E;  4B3T E;  3ADJ A;  4OX9 E;  4JI8 E;  1ZBT A;  4B3S E;  2UU9 E;  3C4T A;  4DR7 E;  1DI2 A;  1IBM E;  1RC7 A;  4JYA E;  2L3J A;  2NUF A;  4M30 A;  1FJG E;  4LF5 E;  2NUG A;  2L2N A;  4X62 E;  1RQ0 A;  1PKP A;  5LMN E;  4JV5 E;  2DB2 A;  2JVA A;  2LTR A;  3T1H E;  4DUY E;  1N33 E;  2LJH A;  4X8W A;  5LMU E;  5CFF E;  2LUP B;  4DR4 E;  4LF7 E;  2LRS A;  2RS6 A;  1XNQ E;  2L33 A;  2YT4 A;  4K0K E;  2B7V A;  4DR3 E;  1UIL A;  4LFC E;  4LF4 E;  2IHR 1;  3ADG A;  1FKA E;  1X49 A;  3LLH A;  2L2K B;  2VQE E;  3J7Y p;  1XNR E;  3ADL A;  2NUE A;  2EZ6 A;  2LBS B;  1HNW E;  1QU6 A;  4GKJ E;  2B3T B;  4WYQ B;  1O0W A;  2UUC E;  1T4N A;  2VQF E;  1N36 E;  4DR6 E;  4LFA E;  4WFT A;  1HNZ E;  2UXB E;  2JY9 A;  4B3R E;  2RSM A;  1XMO E;  1XMQ E;  1UHZ A;  4JI1 E;  4LF9 E;  2KHX A;  2RS7 A;  2MDR A;  4JI2 E;  4JI6 E;  2N3H A;  4OOG C;  4YHH E;  3C4B A;  4AQY E;  4LF8 E;  2UUA E;  1WHQ A;  4DV3 E;  2DMY A;  4DKK A;  4DV4 E;  1I94 E;  1N34 E;  2HHH E;  5IWA E;  4B3M E;  1N32 E;  2RTX A;  3ADI A;  1YZ9 A;  4NXM E;  1WHN A;  2CPN A;  4DR2 E;  4LFB E;  2L3C A;  3T1Y E;  2UXD E;  4JI3 E;  2F4V E;  4DR1 E;  1YYK A;  1X47 A;  1EKZ A;  1HNX E;  5BR8 E;  4JI0 E; 
#chains in the Genus database with same CATH topology
 2YTQ A;  2B7T A;  2EM8 A;  1AAY A;  4DV0 E;  1P47 A;  1LLM C;  2E5L E;  1A1K A;  1B69 A;  2LJU A;  2EMH A;  1YPN A;  2LTS A;  2EOF A;  2LMZ A;  3EQ1 A;  1BB8 A;  3IWC A;  2EPU A;  1AH5 A;  4FK5 C;  2V88 A;  1J5E E;  4JI5 E;  3H09 A;  2EPC A;  5T6J A;  2G7H A;  2EM3 A;  2NA2 A;  2WBU A;  1T4O A;  2N3G A;  2J7J A;  5IT9 C;  1X3C A;  2YTG A;  2EPR A;  5IV8 B;  1STU A;  2EL5 A;  2EPX A;  4KHP E;  1SR9 A;  3JU0 A;  2EN3 A;  3IWD A;  1TF3 A;  2EN6 A;  2EOQ A;  2EMY A;  2EN8 A;  2V83 A;  2V87 A;  2I13 A;  3IWB A;  5IXM B;  4JYA E;  3BID A;  4R2E A;  1YFH A;  2EOX A;  4WPY A;  4X62 E;  1PKP A;  1IQO A;  3RMP A;  4JV5 E;  3BF2 A;  2DB2 A;  2JVA A;  2EPN A;  2LTR A;  3T1H E;  2EMI A;  4DUY E;  2YRM A;  1IQS A;  2ODR D;  2E1M A;  2EL4 A;  3F6H A;  4R2A A;  4K0K E;  2B7V A;  4DR3 E;  1GTK A;  4LF4 E;  3EPK A;  1JK1 A;  2V8Q B;  2VQE E;  2EM6 A;  2BB8 A;  4WSP A;  1WXR A;  4F2J C;  1T4N A;  2YTE A;  3AV0 A;  5LL6 R;  2RQL A;  2YZT A;  4LFA E;  2RPC A;  2DLK A;  2EMA A;  2EOS A;  2VRD A;  1X6H A;  2L92 A;  3C6K A;  2JR1 A;  2EOI A;  2EM7 A;  4F9A B;  4JI6 E;  2YSO A;  4YHH E;  4AQY E;  4N4R B;  3JAM C;  2V85 A;  2UUA E;  4B3M E;  1YSA C;  2RTX A;  2EMC A;  2FTX B;  5TSE A;  5A6B D;  2EPZ A;  1X6F A;  2L3C A;  4WXC A;  2ENH A;  2EMX A;  4P78 A;  2CTD A;  4DR1 E;  3VHT B;  2Q8U A;  3HXL A;  4DR5 E;  2KON A;  2L8T A;  2B9D A;  2HGH A;  2R1F A;  4F6M A;  2ADR A;  3EPL A;  4IS1 C;  2YTJ A;  3DJW A;  1T38 A;  4J8Z A;  4WSG A;  3VYY A;  4X65 E;  4R2P A;  2YTI A;  2EOZ A;  4R8O A;  2EMG A;  2DRP A;  3FIG A;  1EH8 A;  4ZYD A;  1PDA A;  3OTO E;  1BBG A;  2EPO A;  2M9A A;  4DV2 E;  2V89 A;  4LF6 E;  3EPJ A;  4DV1 E;  2ZM6 E;  1GQE A;  3ADJ A;  2EE8 A;  4OX9 E;  4JI8 E;  5KL5 A;  4B3S E;  4F6N A;  4R03 A;  2ENC A;  4MLQ A;  4Q35 B;  1YUJ A;  2GPI A;  4BC7 A;  2EOJ A;  3THO B;  1RC7 A;  2NUF A;  4KZS A;  1FJG E;  2YTF A;  4F9C B;  1EH7 A;  4R2R A;  1RQ0 A;  5LMN E;  4HTG A;  4BHC A;  4NZV A;  1N33 E;  2EP3 A;  4WXD A;  2L33 A;  2YT4 A;  1T39 A;  2EQ3 A;  2LVH A;  3ADG A;  1FKA E;  1X49 A;  5A6A A;  1A1I A;  1XNR E;  3EPH A;  2LBS B;  2EPK X;  5KL4 A;  1TN9 A;  2VQF E;  2R76 A;  4NHR A;  1ZAA C;  2UXB E;  4B3R E;  2RSM A;  2D9H A;  2EMZ A;  3J7A G;  2MKD A;  5LLQ A;  2JYA A;  5AE1 A;  1F2I G;  1X5W A;  2FV4 B;  4BMJ A;  2GLI A;  2EOH A;  2RS7 A;  5F3W A;  4R2D A;  4JI2 E;  4RHB B;  5AC4 A;  2N3H A;  4OOG C;  1G2D C;  3C4B A;  1WHQ A;  5AC5 A;  1ZBQ A;  4DKK A;  2LV2 A;  2MC6 A;  4IJD A;  5IWA E;  4L5N C;  3J80 C;  1N32 E;  2YRH A;  1WRJ A;  4NXM E;  2JWO A;  3LML A;  1WHN A;  2CPN A;  5KL3 A;  3T1Y E;  2EMW A;  2N8X A;  3MHH C;  2YSP A;  2UXD E;  2EQ0 A;  4O4K A;  4BCA A;  4F54 A;  1UBD C;  2DMI A;  5DNY A;  3BGH A;  2EQ1 A;  4JI0 E;  4GKJ E;  2JPA A;  2DLQ A;  2JOX A;  4I8O A;  4O5G A;  1J26 A;  1KYQ A;  1QNT A;  1PJQ A;  2YTD A;  3L00 A;  4GKK E;  2EJ4 A;  4MLV A;  4YY3 E;  2MC5 A;  4DMI A;  2UXC E;  2DIX A;  2EPP A;  2EWL A;  5KL7 A;  5A2Q C;  4BC9 A;  2YPN A;  3KZZ A;  1IBK E;  2EML A;  5KL2 A;  1X6E A;  2LUQ A;  4HEI A;  4O43 A;  4R2Q A;  2UUB E;  4M2Z A;  4X66 E;  4LTY A;  2BBG A;  4DUZ E;  3UK3 C;  1A1H A;  1IBL E;  2HC5 A;  2F8B A;  2UU9 E;  1NCS A;  3C4T A;  3ECR A;  4BHB A;  1DI2 A;  1IBM E;  2YRK A;  4X9J A;  4LF5 E;  3M99 B;  2L2N A;  4RH8 A;  1GZ6 A;  2EMK A;  4M0V A;  3QG5 C;  1MGT A;  2VF1 A;  2EOY A;  4LF7 E;  2LRS A;  1XNQ E;  4BBY A;  5A6J A;  4GEQ B;  1UIL A;  2EPM X;  2FGG A;  3HQ1 A;  1ZU1 A;  5BR8 E;  1Z1B A;  2YU8 A;  1N3G A;  2DSY A;  3LLH A;  3J81 C;  3J7Y p;  3ADL A;  3MSW A;  2NUE A;  2EOR A;  2EZ6 A;  1HNW E;  1QU6 A;  4KWY A;  3AUZ A;  2WBS A;  4WYQ B;  2EN1 A;  2EOE A;  1BBO A;  4P7D A;  1A1F A;  2JY9 A;  4R2C A;  1PJS A;  3MHS C;  2MDG A;  1RMD A;  5A69 A;  1XMO E;  2ODR C;  1XMQ E;  1UHZ A;  4JI1 E;  2KHX A;  2I9I A;  4ZYE A;  5A6B A;  4LF8 E;  2DMY A;  2EPA A;  1N34 E;  2HHH E;  2LE2 A;  4M9V C;  5ADZ A;  3ADI A;  1YZ9 A;  2JOB A;  3JTZ A;  2WBT A;  4ZYG A;  1WJP A;  2JXP A;  2YTP A;  1X47 A;  2GHF A;  4WX9 A;  4GZN C;  2EM2 A;  2YTO A;  1HNX E;  1IMU A;  1T4L B;  2LO3 A;  2HJJ A;  2K7I A;  2YTN A;  2KOU A;  3VYX A;  4TUG A;  2EL6 A;  4DV6 E;  2CSH A;  4O24 A;  2L2M A;  1DGC A;  1A1L A;  2EM4 A;  4NXN E;  2EN4 A;  1YYO A;  1X48 A;  2H36 X;  1HR0 E;  5A6K A;  2JP9 A;  1YYW A;  2NAB A;  4Q28 A;  3HTX A;  2WZO A;  4ZYH A;  2EN7 A;  4DV5 E;  4DV7 E;  3HPZ A;  4JI7 E;  4X64 E;  4JI4 E;  1PJT A;  3P1X A;  4B3T E;  1ZBT A;  2LCE A;  3DF6 A;  3F6G A;  4DR7 E;  3ZOQ B;  2L3J A;  4M30 A;  2NUG A;  1JK2 A;  1DQ3 A;  2YWQ A;  3K6Q A;  4TUI A;  2A25 A;  2EMF A;  2E72 A;  5AAS A;  1SFE A;  1TF6 A;  2LJH A;  2DGC A;  4X8W A;  5LMU E;  5CFF E;  1G2F C;  2EOO A;  2LUP B;  4DR4 E;  4F9B B;  1UN6 B;  2RS6 A;  2EM5 A;  1KJK A;  4LFC E;  2ELZ A;  2IHR 1;  2ELY A;  2EPL X;  2L2K B;  1YUI A;  2EM0 A;  3VK6 A;  2YU5 A;  2MKN A;  5FLX C;  2B3T B;  1O0W A;  2EOM A;  1MEY C;  2UUC E;  4LU9 A;  1N36 E;  4DR6 E;  2L6M A;  3KZY A;  2M4I A;  1NEI A;  4WFT A;  4R2S A;  1HNZ E;  2EMB A;  2WCC 3;  2V86 A;  1L4S A;  1EH6 A;  3BBG A;  4LF9 E;  2EM9 A;  2PRT A;  2MDR A;  1ZR9 A;  5AE2 A;  4L8N A;  2M7Q A;  2VE7 C;  4DV3 E;  3KWR A;  4DV4 E;  1I94 E;  3TQM A;  5KL6 A;  2M1S A;  5AE3 A;  2EN2 A;  2ENA A;  4DR2 E;  2CT1 A;  4BS9 A;  4LFB E;  4JI3 E;  2F4V E;  1A1G A;  2K4V A;  3OML A;  1YYK A;  3HPS A;  1EKZ A;  2RSI A;  3THN A;  2LT7 A;  3C6M A;  1A1J A; 
#chains in the Genus database with same CATH homology
 4DR5 E;  2KON A;  1T4L B;  2B7T A;  2JOX A;  2L8T A;  2B9D A;  4I8O A;  4DV0 E;  2E5L E;  1J26 A;  2KOU A;  3VYX A;  4TUG A;  4DV6 E;  2LTS A;  3DJW A;  4GKK E;  2L2M A;  2LMZ A;  4J8Z A;  4YY3 E;  2MC5 A;  4DMI A;  3VYY A;  2UXC E;  4X65 E;  2UUA E;  4NXN E;  2DIX A;  3IWC A;  2EWL A;  2V88 A;  5A2Q C;  1YYO A;  1J5E E;  1X48 A;  4JI5 E;  3H09 A;  2H36 X;  4R8O A;  2G7H A;  5T6J A;  1HR0 E;  3FIG A;  4BC9 A;  1IBK E;  2NA2 A;  3OTO E;  2LUQ A;  2UUB E;  1YYW A;  1T4O A;  4Q28 A;  2N3G A;  5IT9 C;  4M2Z A;  3HTX A;  2WZO A;  4X66 E;  4LTY A;  4DV5 E;  4DV2 E;  4DV7 E;  2V89 A;  4DUZ E;  1STU A;  4LF6 E;  3HPZ A;  4JI7 E;  4X64 E;  4JI4 E;  4DV1 E;  4KHP E;  3P1X A;  2ZM6 E;  1GQE A;  1IBL E;  4B3T E;  2F8B A;  3ADJ A;  4OX9 E;  4JI8 E;  1SR9 A;  3JU0 A;  1ZBT A;  3IWD A;  4B3S E;  2UU9 E;  4R03 A;  3DF6 A;  3C4T A;  3F6G A;  4DR7 E;  1DI2 A;  2V83 A;  2V87 A;  4BC7 A;  3IWB A;  3ZOQ B;  2L3J A;  1RC7 A;  1IBM E;  2NUF A;  4JYA E;  4KZS A;  4M30 A;  1FJG E;  4LF5 E;  2NUG A;  2L2N A;  4F9C B;  4WPY A;  1DQ3 A;  1GZ6 A;  4X62 E;  1RQ0 A;  1PKP A;  5LMN E;  3K6Q A;  4TUI A;  3RMP A;  4JV5 E;  2DB2 A;  2JVA A;  4M0V A;  2LTR A;  5AAS A;  3T1H E;  2VF1 A;  4DUY E;  1N33 E;  2LJH A;  4X8W A;  5LMU E;  5CFF E;  2LUP B;  4DR4 E;  2ODR D;  4F9B B;  2LRS A;  4LF7 E;  2E1M A;  2RS6 A;  1XNQ E;  2L33 A;  3F6H A;  2YT4 A;  4BBY A;  2B7V A;  4GEQ B;  4DR3 E;  4K0K E;  1UIL A;  4LFC E;  2FGG A;  3HQ1 A;  2IHR 1;  4LF4 E;  3ADG A;  1FKA E;  1X49 A;  2DSY A;  2V8Q B;  3LLH A;  3J81 C;  3J7Y p;  2L2K B;  2VQE E;  3MSW A;  1XNR E;  2NUE A;  3ADL A;  3VK6 A;  2EZ6 A;  2LBS B;  1HNW E;  1QU6 A;  3AUZ A;  4GKJ E;  5FLX C;  2B3T B;  4WSP A;  1WXR A;  4WYQ B;  1O0W A;  2UUC E;  4P7D A;  1T4N A;  4LU9 A;  3AV0 A;  5LL6 R;  2VQF E;  1N36 E;  2YZT A;  4LFA E;  4DR6 E;  2L6M A;  4WFT A;  2M4I A;  1HNZ E;  2UXB E;  2JY9 A;  4B3R E;  2RSM A;  2V86 A;  3J7A G;  1XMO E;  5AE1 A;  2ODR C;  1XMQ E;  1UHZ A;  2L92 A;  2JR1 A;  1HNX E;  4JI1 E;  2FV4 B;  4BMJ A;  4LF9 E;  2KHX A;  2RS7 A;  5F3W A;  2MDR A;  4F9A B;  4JI2 E;  4JI6 E;  2N3H A;  4OOG C;  5AE2 A;  3C4B A;  4YHH E;  4L8N A;  2M7Q A;  1WHQ A;  2V85 A;  2VE7 C;  1ZBQ A;  2DMY A;  3JAM C;  3KWR A;  4DV3 E;  4AQY E;  4DKK A;  4DV4 E;  1I94 E;  1N34 E;  2HHH E;  2MC6 A;  2LE2 A;  3J80 C;  2M1S A;  4L5N C;  5IWA E;  4B3M E;  1N32 E;  2RTX A;  2FTX B;  5ADZ A;  3ADI A;  1YZ9 A;  4NXM E;  2JWO A;  3LML A;  1WHN A;  2CPN A;  2JOB A;  5AE3 A;  4DR2 E;  4BS9 A;  3JTZ A;  4LFB E;  2L3C A;  3T1Y E;  4P78 A;  2UXD E;  4JI3 E;  2F4V E;  2K4V A;  3OML A;  1X47 A;  4BCA A;  4F54 A;  3HPS A;  4DR1 E;  1EKZ A;  1YYK A;  3HXL A;  4LF8 E;  5DNY A;  5BR8 E;  4JI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...