4MLQA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
289
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
total genus 95
structure length 289
sequence length 310
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlqA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlqA02
1P1WA 2UYEA 4NF4A 3TAJA 1RKMA 5CMKA 3IJOB 2OK2A 1A40A 3OEKA 3PPRA 4G68C 1WVJA 2RKMA 3IAZA 3MP6A 3C31A 4ZDMA 3PPNA 5TPAB 4EF2A 3CI8A 1IXCA 3HN0A 4ONYA 5B7DA 1B51A 1R6ZA 4TLLB 2RCBA 3O97A 2I48A 2DWJA 2DE4A 4MBPA 4IO5A 1FCKA 1TXFA 3CSGA 3IO6A 4HS7A 4R75A 1LBCA 4M1VA 4FORA 2Q89A 1SBPA 2GHBA 3FGSA 1PC3A 5H8NB 5I84A 1A99A 1IXHA 3BKIB 2QSXA 1POY1 2DXRA 3IOUA 3O66A 4ZEDA 5ISUA 4YB5A 5ICTA 3S9EA 1LB8A 3OD7A 1ZBMA 5I57A 4OETA 2XXHA 1FQDA 1FTOA 3B6QA 4RYAA 4F1UA 3FVNA 2RCAA 4RK2A 1WODA 1MQGA 3FASA 1Y4CA 3W9WA 3FJ7A 1DMBA 2H5YA 1MS7A 2HAUA 3LSWA 1BKAA 4F2QA 2P2AA 2F35A 3L6HA 4RNSA 1IQ7A 1YPNA 1O63A 2V25A 2QS4A 1CB6A 2ZNSA 3B7DA 4Z0IA 1OVBA 2O7IA 1NNTA 1IEJA 3O6HA 3MVZA 3PMVA 2D5WA 4RY1A 5CMMA 3IX1A 3VXCA 4LVQA 4OFJA 5AA2B 3A3CA 4EF1A 1SW5A 1B3FA 1USYH 2QMXA 3G3GA 4HCYA 4OEUA 3K1PA 2QPQA 3H3GA 2ABHA 5CMCA 3MZ1A 4EXLA 4E0XA 4BDNA 1IUDA 3FV2A 4UA8A 3THIA 1B3GA 4YKJA 1SW1A 3MP8A 3C9HA 2HQ0A 2QL3A 2DWIA 1R1NA 2O6AA 3IJXB 5CMBA 4DXCA 2UVHA 4TLMB 1HSJA 2DE3A 3L6GA 3VXBA 4F3BA 1MQDA 4OWDA 4U1OA 4FATA 4QFNA 3G3IA 1NNFA 1PB7A 4L17A 1JVXA 3K01A 1SYIA 1EZ9A 4JSOA 3H06B 4NTLA 1JW4A 1TFDA 3MC2A 3OMBA 3QYTA 4R6HA 1R9LA 3RN8A 3LBSA 1MY4A 3KEIA 1Y9UA 4F1VA 2Q9TA 4FAJA 2AYSA 1RYOA 2DS9A 5I59B 1I6BA 2XX7A 1IZ1A 1LAFE 5F1QA 1JETA 1QW0A 1A54A 4I1DA 4NE4A 1LFGA 1OLCA 4KFQA 3IOTA 1GV8A 2ZYKA 1B0LA 2VD2A 3QAXA 4H67A 3CRBA 3EN3A 3KG2A 2UYFA 2Y7IA 4PQJA 1LB9A 1P1NA 4KYSA 3RPWA 1B32A 3V5AA 4NF8B 1UIVA 1M5EA 2IA4A 4PFYA 5L9SA 4PP0A 4ZZAA 3GBBA 3S2VA 3VDFA 2P0SA 4ECFA 2V3QA 2H25A 4GFRA 1Q1KA 3TKDA 1FTKA 4NMYA 4U21A 5DT6A 3KJ7A 4QF9A 1YAEA 1A8EA 4NEDA 1B9JA 1B7ZA 1N04A 2A5TA 1I6QA 2AIXA 2UVGA 3FJGA 3FUZA 3M8UA 5HBCA 1OVTA 2PMSA 1D9VA 2H9BA 3DLNA 3TZAA 1J1NA 4MH5A 1MM7A 1FQAA 3T9VA 1IITA 4X9TA 1LBBA 2DVCA 5CBSA 3H6UA 2I6EA 4Z7EA 1URDA 1B4ZA 2P1SA 3G7WA 3MVWA 5H8SA 3C4MA 4OHNA 2FNCA 3TQLA 1DSNA 5ITPA 4H0WA 5KCJA 2XXQA 3VVFA 5I58A 4LUBA 2A5TB 4Q0CA 3EPEA 4YKKA 4F29A 1VE4A 4LP2B 1ZTYA 4H6DA 4NF6B 4F39A 2XX9A 5BWJA 4FEBA 5H8FB 3TUSA 3H4ZA 5IAIA 4P0GA 1M5BA 3M3KA 4MLQA 1P99A 2ZNUA 1NFTA 3PPQA 1MPCA 4H5FA 1NNKA 4P11A 1HSEA 3PPOA 1LCTA 4WEPA 4WXJA 3UN6A 2F7AA 4XIGQ 4YKPA 3CFXA 1QULA 4DXBA 5A5XB 1MXYA 1PB9A 2FA7A 4NF4B 2QS3A 5KDTB 5CI5A 1N3XA 2R71A 5L9MA 4GWOA 1ZLQA 2GHAA 5TP9B 4R6YA 1IIWA 1N0TA 4PETA 4TOZA 1GR2A 4G8MA 1XC1A 3TTNA 3WAFA 4GIZA 2DWHA 4GVOA 3SEYA 3VLUA 2XXTA 5A5XA 2O1LA 1BP5A 1LGBC 1LAGE 2XXXA 3LSXA 4HCWA 4JWXA 4C0RA 5I58B 5DEXA 3KOSA 3TPAA 2HEUA 1I69A 1XS5A 3MAMA 4G4PA 3TFLA 3TQWA 5FHNA 3IOVA 4Q30B 3C33A 3ZKLA 3U94A 2XX8A 4QHQA 1MQHA 1UTHA 4PFWA 4ELOA 1B58A 1BLFA 3GXAA 3PV0E 1WDNA 4KR5A 2LAOA 2YJPA 1II5A 5LOMA 1IXGA 3LSLA 1B6HA 3JZJA 4G2ZA 2F7CA 1DOTA 3K6VA 4QSDA 1SDXA 4R74A 1R9QA 2I3WA 1N3WA 3IB0A 4EQ9A 2OZZA 3OENA 3TTRA 1QVSA 2NUVA 2GFEA 3I3VA 3IK6B 4IO2A 4M4GA 2DVZA 4GLIA 2X26A 2NOOA 4EXKA 1OLAA 4NWDA 1EH3A 2O1MA 1B3LA 1Y20A 3VFJA 1Y4TA 5AA4A 4F1YA 1PEBA 1FQBA 2F34A 3LSFB 2G93A 2O84X 3MPKA 2XXWA 5ELVA 2YLNA 3O6IA 4MFIA 3K1MA 3OEMA 5F7VA 3VV5A 2Q88A 5AA3A 5JTYA 1TFAA 1B1XA 3MZ9A 3OO9A 3MZBA 4KPTA 3VLWA 2UXAA 3U72A 1NKXA 3GBAA 4R2FA 4OEVA 3I6VA 3VLVA 1QUJA 3DP6A 1ZJLA 2Z22A 4G8NA 3EQ1A 4HTGA 1O7TA 3Q26A 2ALUA 4PE5B 1TWYA 1B46A 1MH4A 3KN3A 3QXMA 4H65A 1P1OA 4I8CA 3ONMA 3I5OA 4ND9A 4X48A 4RK9A 3GZGA 4XKPA 2Y7RA 4I62A 1VR5A 3O9PA 1RYXA 1D4NA 2O7UA 3K4UA 4LQ2A 1A7LA 4GOTA 3T66A 2GH9A 2I58A 3K2DA 3USDA 1KWHA 5L8DA 5I57B 2BJJX 4ZZEA 1AH5A 3EHUA 4GQOA 3MP1A 4TQUQ 3UIFA 1URGA 2XXVA 3DM0A 1MRPA 4G68A 2VD3A 5AA2A 5ICQA 2PVUA 3G3HA 2PT2A 1Q35A 2QJEA 3FVKA 1JW5A 2RC8A 2CMOA 3R7XA 3MQ9A 2QS1A 4JWYA 3K6UA 3RT8A 4BDRA 4BDLA 3TTLA 4EQBA 5I56B 3N94A 4IGTA 4U4XA 1EZPA 4DE8A 3ILUB 1P1UA 1JEUA 3C32A 3ILTB 3K02A 4ELPA 5CBRA 1H44A 1Y3NA 1VSOA 4EQ7A 3DP8A 1FTLA 1TT1A 3K6XA 3O2AA 5TU0A 3C36A 1DPPA 1N7XA 3B6TA 1DTZA 1ATGA 4RPNA 2V3TA 3IO4A 3IR1A 4OQOA 1FQCA 4U22A 3N5LA 3RT6B 1ANFA 3LR1A 2ZYNA 3MVYA 4RJZA 4OFLA 4YAHX 4H8IA 5I2KB 4ZEIA 5BUUA 3RQTA 1NNPA 1S7YA 3HSTA 5H8FA 4KCCA 2Y7KA 3HV1A 3MW0A 3LC8A 2ESNA 4R72A 4DCXA 3A3UA 1LLSA 1MG1A 3FXQA 3PD9A 3Q25A 3FXUA 4N07A 1IXIA 4P0IA 1XVYA 1URSA 4KQPA 4IY6A 4R9GA 1O64A 2NVUB 4ZE8A 4ELRA 3K0VA 1M5FA 3RY3A 4C1TA 5B70A 1NH7A 4FIMA 4RPOA 1MY3A 1UTBB 1A8FA 4QFKA 3T93B 1MDQA 1P1QA 1HSLA 1Z7ME 2B3FA 4WEDA 3U93A 1EZOA 4X1BA 1SI0A 3TCGA 3PUWE 4EUOA 4QSEA 2UVJA 3TMGA 3CIJA 4OFOA 5FTIA 4F3GA 1VFEA 3JYRA 4F3SA 3TCHA 5JTYB 1MQIA 2G29A 1MDP1 2DP8A 1DTGA 3H03A 4GD5A 3T96B 3ZKKA 1PBQA 3O6GA 3VVDA 3H7MA 4MLVA 2B3BA 2Q2AA 1Y1ZA 1PDAA 3D4CA 3PGFA 3RTFB 3TEPA 1B3HA 1BTJA 1YCJA 4YKIA 2DOJA 2D3IA 1B5IA 3HCQA 5I2NA 1SW2A 3Q27A 4LA9A 5M2VA 3TTMA 1OQHA 4OESA 4JSDA 3CG3A 3UK4A 5KZTA 3QUJA 4ZEKA 3F11A 5FTHA 3U8QA 2IEEA 5IKBA 4YB7A 1FQFA 2F78A 2OBGA 2O69A 1PBPA 3KFMA 3U1OA 3H6TA 3VE1B 3OSQA 2OWTA 4GL0A 1UTHB 2Y7PA 1ELJA 5CC2A 5ITOA 3HHFA 4KYEA 2R9JA 2Y84A 2NXOA 4IB2A 3SERA 4N13A 4F22A 3K1NA 2XXIA 4IO4A 4KD5A 2X7PA 3FXRA 2RC9A 4NF5B 1SVXB 4DCYA 4EDPA 4ZE9A 1T0KA 2H4IA 1QKBA 5K2YA 1NMUA 1MXUA 1QUIA 1D9YA 2F6PA 1N84A 1N76A 3M3FA 4KHZE 4FEDA 3H6WA 1USYE 2NWJA 2XD2A 4BDOA 1AIVA 3KOTA 2ONSA 4XXUA 5TP9A 4H5GA 4O3AA 4YMAA 2HZKA 2I0CA 3OELA 1NL5A 2V3UA 1H45A 5DTBA 3C35A 3T22A 1L5TA 2HXWA 3AXFA 4JBZA 4OENA 3FVGA 3TYHA 5H8QA 3KSXA 3K00A 1B3EA 3U92A 2I49A 3DP4A 3PUVE 5K2XA 2XXYA 3G3KA 4FE8A 4OVJA 4U1ZA 3SEUA 4DLDA 4DZ1A 4O3BA 4Q8RA 4WKMA 1LFIA 4JXIA 4N6PA 5KDTA 3CR9A 3V83A 1JEVA 1XHYA 1LSTA 2QS2A 2XHDA 3N6UA 4ESWA 1B0HA 2F6GA 1XOCA 2I4CA 2E1SA 3KSJA 1Y3PA 3MWBA 1MXVA 3QSLA 2V93A 3FZVA 4BDMA 5H8NA 5H8QB 4AB5A 5AE4A 3PMXA 4IGRA 4LZ5A 2QMWA 5I56A 3UP9A 3CFLA 4PFTA 1ZIUA 4AB6A 2ANJA 5DVIA 3SEXA 3WAEA 1LAXA 4E0WA 3HO7A 3R26A 4H1XA 3LUYA 4BLAA 1MPDA 1OIBA 3CVGA 4POXA 4DDDA 1F9BA 3KBRA 3MVXA 2F7BA 3FJMA 4DXUA 2F5XA 3KN7A 3PUZE 2Z23A 1B5JA 3PD8A 2OWSA 1FTMA 4JWOA 3EHTA 4RA1A 2Q8JA 4POWA 1Y3QA 4Q5TA 1AL3A 1FW0A 1S50A 2E0SA 3C34A 2ZYMA 4LONB 4NF5A 3MJNA 4KI0E 1H3DA 2DQVA 1JNFA 3KN8A 2VOZA 3O29A 1US5A 2Z8EA 3MUQA 3QIMA 1ZU0A 3G3FA 5CRYA 2UVIA 4DIGA 1MM6A 2REGA 3E9XA 3OXNA 3PU5A 4OERA 3IB2A 3KGCA 2DSFA 4R73A 5CM6A 3K6WA 1NH8A 1GTKA 3T9UA 1B05A 1FQEA 4ELQA 3EF7A 2HCAA 2THIA 2Z8DA 3VVEA 2AL4A 3UORA 1VFDA 1SD3A 3N26A 1LAHE 1UIUA 4ISUA 5DVJA 1JVYA 1ZKBA 1JW1A 3RLFE 2HZLA 1D3KA 5H8HB 3V89B 3E4RA 3GLBA 1SQYA 1PB8A 4I9DA 3H6VA 1MY0A 3KZGA 5L9OA 4QFLA 3SDFA 2A5SA 4QRZA 5EYFA 2HFBA 4GL8A 5JEIA 1YTVA 4KCDA 3DELB 4LZ8A 1N7WA 3FV1A 4GXAA 2Q2CA 5DVFA 5AA4B 3N6TA 2O51A 2RINA 2WKYA 4GXSB 4R6KA 4YU0A 2OLBA 3HPIA 3T9HB 1LCFA 2XXUA 2R6GE 2VHAA 3W15C 2PT1A 4F2OA 3IL1B 2DE2A 3IOWA 2KLFA 1JQFA 2PBWA 5TPAA 4G77A 4X1DA 1B5HA 2PX1A 1DPEA 4GF8A 1H76A 2O68A 2I0BA 4IY5A 1OQGA 1SI1A 1Y1MA 1US4A 3MPLA 4GRKA 1EU8A 5KCJB 3D4GA 3ECRA 4LZ7A 1UTBA 4H8JA 3S9LC 2FYIA 4LATA 4NF8A 4NF6A 2F8DA 5DEXB 4F31B 2ZNTA 1B2HA 3SKPA 4YICA 1QJMA 4U2RA 3E13X 1LFHA 3B6WA 3Q28A 3IORA 2M8CA 2ONRA 4G68B 1MPBA 5JK4A 2VP1A 4IO3A 4C1UA 5AA2D 4IO7A 4AQ4A 2XD3A 4BDQA 4OYVA 1B52A 4R9FA 4O3CA 3S4UA 1MXZA 4ESXA 3PPPA 4OMBA 1FTJA 1XVXA 3RUMA 3BFUA 2D21A 2Z8FA 3T9XB 2W7YA 5J1DA 1CE2A 2F36A 3SETA 4MF3A 2CZLA 3FVOA 3E3KA 3A09A 3CSBA 1AMFA 1OMPA 3JV9A 4YMBA 2I4BA 2PYYA 2ZMBA 3PUXE 1GVCA 1MXXA 4ZEFA 3UA8A 2RC7A 2ONKE 2V84A 3ODBA 4FECA 4YZZA 4F18A 1SW4A 4U4SA 5EHSA 3RTWB 1XT8A 4F3PA 4ZECA 5I59A 3PUYE 1M5CA 5I2KA 3G3JA 4JB7A 4OTEA 3OO7A 3ZS6A 1SYHA 3Q29A 2DWAA 2ZXTA 3FIRA 2X7QA 4K3FA 4ZS9A 3TCFA 4YB6A 3IB1A 1M5DA 5I2NB 2DYXA 2YPNA 2OCUA 5FHOA 2H98A 3RNNA 3TELA 2QRYA 3OO6A 4LQ5A 1MQJA 4XKNA 2VGQA 5DYHA 1GGGA 1H43A 1B40A 4XTCQ 4QSCA 5EHMA 3SEVA 1MH3A 3TDJA 2OJTA 3PMWA 3TTKA 1UQWA 3OOAA 1POTA 4RXLA 1BIYA 3FD3A 3HHGA 4HW8A 3BBRA 3KJTA 1MY1A 1QKAA 1ZMGA 3CFZA 4QFOA 4R2BA 5H8HA 3SESA 2ZYOA 2HAVA 1A55A 2XXPA 1B4HA 3CG1A 3QUFA 4JDFA 3OO8A 4XKQA 5AA1A 3OSRA 4OXVA 3SEWA 1Z7NE 1S9TA 4IO6A 4F19A 1QUKA 1MY2A 3W9VA 2XXRA 2REJA 2RF1A 5HM4B 3R6UA 4U23A 2GRVA 3M3LA 3V8XB 1AOVA 2F97A 4OZ9A 5FHMA 2DXYA 2I3VA 4ZEBA 3ZSFA 4G8HA 4PFUA 4NWCA 3UGWA 4XKRA 3QK6A 2AL5A 3EHSA 3MBPA 1I6AA 2H99A 1B7HA 3FATA 4FJPA 3O28A 4KYDA 4THIA 1B7UA 3P7IA 1B1HA 4UACA 3RGYA 2B65A 3BFTA 4QFPA 1MXWA 3S9NC 5HPQA 2Y7WA 3S9MC 3TODA
chains in the Genus database with same CATH superfamily
1P1WA 1RKMA 1NEIA 4G68C 1A40A 3PPRA 2D9HA 5A5XA 3IAZA 2RKMA 3MP6A 4ZDMA 5TPAB 3PPNA 2YTOA 3IWCA 3O97A 2GHFA 2DE4A 1FCKA 3IO6A 1FPKA 4OA4A 3BKIB 4F6MA 5ICTA 1LBZA 5I57A 1ZBMA 1FTOA 4F1UA 1BB8A 3FASA 1DMBA 1MS7A 3LSWA 1BKAA 1O63A 2QS4A 3PMVA 4L5NC 1ZAAC 5IZ3A 4LVQA 4HCYA 3ADGA 1JP4A 2E72A 1J5EE 1IUDA 2EPUA 3MP8A 3C9HA 2QL3A 2UVHA 2DE3A 3C4BA 4BC9A 4U1OA 5LL6R 4L17A 1JVXA 3K01A 3H06B 4NTLA 1HNXE 1NCSA 4NAPA 3LLHA 4PF8A 4F1VA 1RYOA 2EOJA 2XX7A 5F1QA 1LAFE 1QW0A 4DV7E 4NE4A 1NV7A 4KFQA 4R2AA 1B0LA 4H67A 4PQJA 1EZPA 3CRBA 3J81C 1P1NA 3RPWA 1B32A 1MGTA 5L9SA 4PP0A 2P0SA 1Q1KA 1NUWA 4K0KE 4QF9A 1B7ZA 2UVGA 3FJGA 5HBCA 2H9BA 3DLNA 4MH5A 3TQMA 2CZIA 4MMPA 1O0WA 5CBSA 2L5VA 1IMDA 1URDA 5KCJA 4H0WA 2A5TB 2EPMX 4BCAA 4F29A 2YTEA 1LBYA 1ZTYA 5AC5A 5IAIA 1M5BA 4BDOA 1P99A 2ZNUA 2EOYA 4TLMB 4WEPA 3TUSA 2PFYA 1HSEA 3UN6A 2KQZA 5A5XB 2LBSB 4PGNA 3CFXA 5J16A 1ZLQA 5TP9B 4R6YA 1IIWA 1N0TA 4PETA 2EORA 2XXTA 4GWWA 2XXXA 5I58B 1LAGE 3TPAA 3BBGA 1XS5A 2EPKX 5FHNA 4Q30B 4QBAA 1B58A 1X47A 1BLFA 3GXAA 4MCOA 2YJPA 4Q35B 3JZJA 4G2ZA 2F7CA 4R74A 2I3WA 4GBVA 3OENA 4M0VA 4M4GA 3KBZA 2K7IA 4GLIA 1Y4TA 5AA4A 1PEBA 3MPKA 1NV4A 1TFAA 3VLWA 4OVSA 4BS9A 3MZBA 1A1GA 1ZR9A 3U72A 3BF2A 3GBAA 4R2FA 4OEVA 2L6MA 3EQ1A 2EM0A 3RYDA 4GEQB 4MNPA 2ALUA 1MH4A 1KZ8A 4H65A 1P1OA 3I5OA 4LQ2A 3T66A 2CZHA 1A7LA 4GOTA 2GH9A 2LVHA 2L2NA 2KR0A 2WBTA 3MP1A 3DM0A 2VD3A 2PVUA 3G3HA 3FVKA 1JW5A 1RQ0A 3M99B 1FPLA 3K6UA 3RT8A 1Z1BA 4BDRA 3N94A 5ET7A 2H36X 1JEUA 3ILTB 1XNQE 1FPJA 2UXCE 1TT1A 4X9JA 3K6XA 1SPIA 3O2AA 1DPPA 1DTZA 1NUXA 4RPNA 4OQOA 3RT6B 3LR1A 5FLXC 3MVYA 4RJZA 1HNWE 2MKNA 1NNPA 4DCXA 2EN2A 1MG1A 3FXQA 3Q25A 4P0IA 3FXUA 2L33A 4WEDA 4KQPA 1O64A 4ZE8A 2M9AA 4C1TA 2V4CA 3T93B 5KL4A 1P1QA 2B3FA 1EZOA 4EUOA 4QSEA 5FTIA 4F3GA 3JYRA 4NHBA 2JY9A 2FV4B 5EQ8A 1FJ9A 3T96B 2EPOA 1FBFA 3O6GA 2B4LA 1RDXA 3T1BA 4MLVA 2R8TA 1Y1ZA 1N33E 4YKIA 4RH8A 1SW2A 2XWOA 4LA9A 1OQHA 3CG3A 3F11A 2IEEA 1X3CA 2OBGA 1PBPA 3H6TA 2Y7PA 1ELJA 5CC2A 3HHFA 4KYEA 2R9JA 3K1NA 2K4VA 4KD5A 1IMAA 4EDPA 2VPOA 2HGHA 4RHBB 1NMUA 1QUIA 2F6PA 2WYKA 1N84A 3KZZA 5IM2A 2WBDA 1BK4A 5T6JA 1FPEA 5TP9A 4H5GA 2I0CA 2MKZA 3VYXA 2V3UA 1L5TA 4OENA 4O43A 2F3BA 1N36E 3U92A 1LBWA 3SEUA 4DZ1A 4WKMA 4JXIA 1NV1A 2QS2A 1B0HA 1ZBTA 2I4CA 1MXVA 4JVIA 4DV3E 5H8QB 4AB5A 3LMLA 3CHGA 3SEXA 4E0WA 3HO7A 4BLAA 3MVXA 2F7BA 4R8OA 2Y5LA 2OWSA 2DIXA 2UUCE 4P1EA 5IV8B 4Q5TA 1AL3A 1FW0A 2MC5A 1S50A 2E0SA 2ZYMA 2EPAA 3KN8A 2VOZA 4YY3E 1IBKE 4QXDA 1YZ9A 2EM8A 3PU5A 2WBUA 3RPLB 5T3JA 1P47A 3H09A 4GWXA 5EQ7A 1KJKA 1T39A 2FTXB 1WHQA 2XA5A 1VFDA 1JW1A 4DV5E 3GLBA 2A5SA 5EYFA 2EM2A 5JEIA 3HPSA 5IT9C 4LZ8A 3FV1A 2EN4A 5DVFA 2WKYA 2VRDA 4YU0A 3W15C 4F2OA 4PAIA 3ADJA 1RDYA 3AV0A 2JWOA 4X1DA 1B5HA 2DRPA 4IY5A 1US4A 4N81A 2I13A 3ECRA 4NGUA 1FBEA 3S9LC 4NF6A 4NF8A 1QJMA 4U2RA 1LFHA 4ZYDA 1G2FC 2EM5A 2M8CA 5JK4A 1IMUA 4IO3A 2KHXA 4AQ4A 4BDQA 4R9FA 4O3CA 4GKJE 5KL7A 4WYQB 1XVXA 3T9XB 1IQOA 2W7YA 4JVDA 4MF3A 2FIEA 3FVOA 3CSBA 3JV9A 2ZMBA 4P78A 4MHFA 4ZEFA 2RC7A 2ONKE 4FECA 5KL3A 4JI6E 4ZECA 5I59A 1EKZA 4LF6E 4OTEA 3Q29A 5LMUE 2DWAA 4PFBA 4ZS9A 4K3FA 4B3ME 3HQ1A 3IB1A 2DYXA 4PTKA 2OCUA 3RNNA 1AWBA 3ZOQB 1MH3A 3PMWA 3OOAA 1POTA 3HHGA 4HW8A 3BBRA 1MY1A 1ZMGA 3SZPA 3SESA 4R03A 2HPGA 1A55A 3SEWA 2QVVA 1Z7NE 3W9VA 2XXRA 3KZYA 3R6UA 5A6AA 3M3LA 1B69A 4OZ9A 3MHSC 2YRMA 2I3VA 3RPLA 2ENHA 4PFUA 3UGWA 4XKRA 3QK6A 4KYDA 1I6AA 3L00A 2EMCA 2MKDA 1B1HA 2B65A 4QFPA 3S9NC 2XWVA 3TODA 2OK2A 3OEKA 4DR7E 2RQLA 3C31A 4O7IA 3HN0A 5B7DA 1B51A 2DWJA 4MBPA 4IO5A 3CSGA 4HS7A 4R75A 4M1VA 2QFLA 4F9AB 1A99A 2VT5A 1BBOA 1POY1 3O66A 5ISUA 2EOIA 3S9EA 3OD7A 4OETA 1GZ6A 3FVNA 4RK2A 5DNYA 1MQGA 3FJ7A 4GBWA 2HAUA 4F2QA 1IQ7A 2L92A 1CB6A 2ZNSA 3B7DA 4Z0IA 5LTCA 2EE8A 2O7IA 1NNTA 1IEJA 2YTPA 4NHRA 2D5WA 3IX1A 4OFJA 2EN6A 4EF1A 1USYH 2YU5A 3K1PA 2QPQA 3H3GA 2ABHA 5CMCA 4EXLA 4LF8E 4E0XA 5CFFE 3FV2A 1LLMC 4YKJA 4WSPA 2WBBA 1VDWA 3L6GA 3VXBA 4F3BA 4FATA 3G3IA 4BHBA 1PB7A 3ROJA 2VQFE 3MC2A 2F4VE 1MY4A 3KEIA 3LBSA 4NG7A 3BIHA 2LMZA 2JP9A 3BIGA 1I6BA 3KC0A 1JETA 2F8BA 1A54A 4LTYA 4PGPA 3KG2A 3V5AA 2UYFA 2Y7IA 2DLKA 1UIVA 3VDFA 2V3QA 1FBGA 4GFRA 1FTKA 4U21A 1INPA 1A8EA 1YAEA 1B9JA 1N04A 3M8UA 1OVTA 3TZAA 3H6UA 5H8SA 3MVWA 4PBQA 1YYOA 1DSNA 4LUBA 4Q0CA 5A5LA 4LP2B 4F39A 4ZYHA 2XX9A 5EYGA 4FEBA 4P9KA 4MIJA 4P0GA 4H5FA 4MLQA 1NFTA 1MPCA 4WXJA 3PPOA 1LCTA 2FIXA 2F7AA 4BMJA 4YKPA 4JI4E 2QS3A 5CI5A 4GWOA 2GHAA 2NA2A 4R2SA 5EQAA 4Q28A 2NUGA 5I3SA 3C6KA 2EPCA 3F6GA 5DEXA 2HEUA 1DQ3A 4N4RB 4MNCA 3TFLA 4F54A 3MYUA 2EM6A 4QHQA 4PFWA 4ELOA 4PFRA 2M7QA 2LAOA 1IXGA 3LSLA 1DOTA 1SDXA 4EQ9A 2V83A 1N3WA 3VK6A 3TTKA 1QVSA 2NUVA 4IO2A 4OVRA 4DI4B 4WX9A 2X26A 2NOOA 4EXKA 1OLAA 4NWDA 1B3LA 3MHHC 4F1YA 1LEVA 3LSFB 1FQBA 4R2DA 5ELVA 3RTWB 2O84X 5JTYA 3OEMA 2Q88A 1BBGA 2UXAA 3THNA 3VLVA 3DP6A 4HTGA 3Q26A 4PE5B 1B46A 4DUZE 4X48A 4XKPA 2Y7RA 3O9PA 1D4NA 3K4UA 1KWHA 4OVQA 5I5PA 2YTGA 2JYAA 3EHUA 4JYAE 3UIFA 2XXVA 5ICQA 4X65E 4DR6E 2YT4A 2PT2A 3MQ9A 1EH7A 3TTLA 5EYHA 4U4XA 4DE8A 3C32A 3K02A 4ELPA 5CBRA 1Y3NA 1FBPA 4PDDA 3DP8A 4EQ7A 1FTLA 2CSHA 2EMGA 1N7XA 3IO4A 3K6QA 2CTDA 4P3LA 2Y5KA 4LF5E 1FPDA 4N17A 2B9DA 3HSTA 2ESNA 4IJDA 1LLSA 1N32E 4LF7E 4EQBA 1URSA 4IY6A 2Q8MA 4ELRA 3K0VA 3RY3A 5B70A 1NH7A 4RPOA 4QFKA 3U93A 3ADIA 1SI0A 5A6JA 4F3SA 4BC7A 3TCHA 4P47A 3ZKKA 1NV5A 2IHR1 1IMEA 3RTFB 3TEPA 3D4CA 1B3HA 4DUYE 4O24A 2DOJA 1B5IA 4GWZA 3Q27A 4OESA 3UK4A 3QUJA 2EPNA 5FTHA 3U8QA 1FPFA 1J26A 1YYWA 1FQFA 2F78A 2O69A 3GYYA 3OSQA 2Q74A 3JAMC 3C4TA 1I94E 1YYZA 2LTSA 2X7PA 4R2CA 3FXRA 4ZE9A 1SVXB 5K2YA 5ESYA 2ELYA 3M3FA 5IXMB 1T38A 1USYE 2UXBE 2NWJA 2XD2A 2ONSA 4O8MA 2UU9E 1H45A 5DTBA 3T22A 2HXWA 3AXFA 3TYHA 3FVGA 4B3SE 1F2IG 4BBYA 4U1ZA 1AOVA 4FE8A 4O3BA 1LFIA 4N6PA 1KYQA 1EYJA 2XHDA 2R76A 1XNRE 3N6UA 4HE2A 2E1SA 1Y3PA 3MWBA 4DV1E 3FZVA 4BDMA 4F9BB 1PJTA 5AE4A 4PFIA 5LDZA 2LUQA 2QMWA 4LN5A 5I56A 4GWSA 1ZIUA 5DVIA 1X48A 2V8QB 3LUYA 1MPDA 1OIBA 1A1LA 1F9BA 3KBRA 3FJMA 3KN7A 3PUZE 4RA1A 1Y3QA 4LONB 3C34A 4NF5A 3MJNA 2Z8EA 1QGXA 2N3HA 2RSIA 2WEFA 3P1XA 4OERA 3IB2A 3KGCA 1YSAC 2DSFA 1QU6A 1GTKA 2VE7C 2ZZXA 2HCAA 2EN7A 5KL2A 1EH6A 1SD3A 4ISUA 1ZKBA 4I40A 5H8HB 3V89B 2KONA 3E4RA 1SQYA 1PB8A 4I9DA 5L9OA 3D1RA 2RS7A 2HFBA 4GL8A 4OX9E 1EH8A 1DBZA 2RINA 4R6KA 1LCFA 2XXUA 2R6GE 2VHAA 2PT1A 3IL1B 3IOWA 1JQFA 5TPAA 4GF8A 4BHCA 1IMBA 1OQGA 1SI1A 1Y1MA 1EU8A 3D4GA 1SR9A 2V85A 2ZM6E 3U65A 2JPAA 2ONRA 2EL4A 2ADRA 2EN1A 1MPBA 2VP1A 1NV6A 4TUIA 3HFUA 4OANA 3S4UA 1FPIA 4OMBA 1FTJA 3BFUA 2Z8FA 2EPXA 3IWBA 4JI2E 3SETA 4HE1A 2PYYA 4GX6A 1SW4A 1FJ6A 1JK1A 5I2KA 3G3JA 3OO7A 2ZXTA 3FIRA 2X7QA 3TCFA 4DV6E 4GWYA 3TELA 2QRYA 4O5GA 3OO6A 4XKNA 5DYHA 1GGGA 1B40A 4QSCA 2OJTA 1UQWA 1PJQA 1X6HA 1QKAA 2EOXA 2RSMA 3QUFA 3U94A 3OO8A 4F19A 4OXVA 4AQYE 2DDKA 1X6EA 4GX3A 3V8XB 1K9ZA 1UILA 5FHMA 2DXYA 3ZSFA 2KOUA 2XWKA 1FPGA 1TF3A 3T1HE 2AL5A 4ELQA 5IZ1A 3O28A 3P7IA 3LV0A 1FSAA 2PRTA 1MXWA 2UYEA 4NF4A 5CMKA 2EMLA 1IXCA 4ONYA 1R6ZA 2RCBA 2I48A 1TXFA 5IWAE 1IMFA 1PC3A 4N6DA 5DW8A 5H8NB 1IXHA 4F6NA 2QSXA 2DXRA 4PBHA 2XXHA 5AASA 2ZZWA 4RYAA 1WJPA 2RCAA 5ET6A 1WODA 2EN3A 2H5YA 1YXIA 2P2AA 2EOSA 2V25A 3MVZA 3VXCA 4N8YA 5CMMA 3A3CA 5LLQA 1B3FA 4P8BA 4UA8A 3T0JA 2DWIA 4F2JC 3EKIA 1HSJA 2EOFA 2B7VA 2YWQA 1MQDA 1NNFA 1SYIA 1EZ9A 4JSOA 2CT1A 4GKKE 2M1SA 4R6HA 1R9LA 4FAJA 2AYSA 5I59B 2XWIA 4I1DA 4DR2E 1FBHA 1GV8A 1OLCA 4R2RA 3IOTA 2ZYKA 3QAXA 2VD2A 3EN3A 4DXCA 2OX3A 1LB9A 4KYSA 4O7MA 2WBSA 3AUZA 1M5EA 2IA4A 4ZYEA 4PFYA 1X49A 2MDRA 4ZZAA 1JK2A 3S2VA 2JVAA 4ECFA 4NMYA 3KJ7A 4NEDA 3TTNA 2A5TA 4R2EA 2I9IA 2AIXA 1D9VA 2DLQA 1J1NA 2EN8A 1MM7A 1FQAA 3T9VA 1IITA 2YTFA 2M4IA 2CZKA 1LBBA 2DVCA 2EMYA 1WHNA 2P1SA 2FNCA 5ITPA 2XXQA 3VVFA 5I7IA 3EPEA 4YKKA 4N6KA 1VE4A 4H6DA 4NF6B 3LUZA 4H46A 3PPQA 1NNKA 4M2ZA 4NF4B 3J80C 4JV5E 1T4OA 2R71A 5L9MA 4TOZA 1GR2A 4G8MA 1XC1A 1NUZA 2EPPA 4GVOA 3VLUA 3EPHA 4X66E 2O1LA 4HCWA 4HEIA 3T1YE 3KOSA 1WRJA 2DMYA 1I69A 3FBPA 3MAMA 4G4PA 1XMOE 3C33A 1UTHA 1IBME 4PF6A 1WDNA 4KR5A 5LOMA 1T4LB 3K6VA 4GWUA 3A29A 2OZZA 1YFHA 4JI8E 3IK6B 3I3VA 5IZ3B 1HR0E 1YUJA 2DVZA 3VFJA 2G93A 5F7VA 3K1MA 4LFCE 3VV5A 1UHZA 3MZ9A 4KPTA 4WFTA 1NKXA 4MNIA 3MSTA 3I6VA 1QUJA 1ZJLA 1O7TA 4I8CA 3QXMA 3OTOE 3ONMA 3GZGA 4OWDA 5EQ9A 1VR5A 2HHHE 2B3TB 4N8GA 5I57B 2BJJX 4ZZEA 1AH5A 4PAKA 4KHPE 4TQUQ 5AA2A 1URGA 2HJJA 1MRPA 2BJIA 4NQ8A 3R7XA 4JWYA 2QS1A 4IGTA 3ILUB 1L4SA 1FKAE 2OWZA 1H44A 1TF6A 4JI7E 5TU0A 2L3CA 4GX4A 3B6TA 1ATGA 2EMAA 2V3TA 3IR1A 4MAGA 4NZVA 3N5LA 2R1FA 4JI5E 2ZYNA 4YAHX 4PE3A 4OFLA 5H8FA 4ZEIA 1S7YA 3B8BA 4KCCA 2Y7KA 3HV1A 3LC8A 1T4NA 3DF6A 3PD9A 4N07A 1IXIA 4R9GA 1XVYA 2CEYA 2N8XA 2JOBA 4FIMA 1UTBB 1NV3A 2EPLX 1HSLA 1Z7ME 4XF5A 3TCGA 2UVJA 2YTDA 1IBLE 2V89A 5JTYB 2XXKA 1MDP1 2DP8A 1DTGA 3H03A 4GD5A 4O94A 5F24A 1PBQA 3VVDA 2B3BA 2YU8A 3PGFA 2V88A 1YCJA 5I2NA 2FBPA 5M2VA 3TTMA 5KZTA 4IR8A 5IKBA 2V86A 4YB7A 1YZ0A 3HPZA 3U1OA 2OWTA 4GL0A 1UTHB 2Y84A 4AS5A 4IB2A 4P56A 3SERA 2A25A 2XXIA 2B4MA 4NF5B 2EWLA 4KXPA 2ENCA 1LBVA 2LE2A 2LTRA 2H4IA 1D9YA 1FTAA 1AAYA 4KHZE 4FEDA 4KWYA 3H6WA 4NXNE 4XXUA 5AE3A 2HZKA 1NL5A 3C35A 4JBZA 3IFAA 2EL6A 2CPNA 1NV2A 3KSXA 1IMCA 3DP4A 4OVTA 5K2XA 2XXYA 3MSWA 3G3KA 2N3GA 1JEVA 2EM7A 1LSTA 4ESWA 1XOCA 3KSJA 3QSLA 4NX1A 2LUPB 1RMDA 2L2KB 4LZ5A 3JU0A 3EPKA 4PFTA 2EMFA 3WAEA 3BIDA 3R26A 4N4UA 2EM9A 3CVGA 4POXA 2V87A 4JWOA 3EPLA 1B5JA 2Z23A 3ISPA 1FTMA 3EHTA 4X04A 4POWA 1JNFA 1FBDA 3O29A 2FHYA 1US5A 2LV2A 2FGGA 2YRKA 5CRYA 4DIGA 4B3TE 4R73A 2DSYA 1B05A 1FQEA 3EF7A 2Z8DA 2THIA 4LF4E 1RDZA 4G61A 2FVZA 1LAHE 4FBPA 1JVYA 4NN3A 3RLFE 2HZLA 5ET8A 3H6VA 1MY0A 4WSGA 3KZGA 3PTYA 4QFLA 4GZNC 3SDFA 5FBPA 3VYYA 1YTVA 3DELB 2EMZA 3E78A 4M30A 2Q2CA 4AS4A 3N6TA 4GXSB 3HPIA 2DE2A 2PBWA 2EPRA 4DMIA 2GQ1A 4G77A 2PX1A 1DPEA 1H76A 2O68A 2I0BA 3MPLA 1SFEA 5KCJB 4GRKA 3IFCA 3HTXA 4LZ7A 2FYIA 1D9QA 5DEXB 2F8DA 4F31B 1B2HA 3SKPA 4YICA 3Q28A 3IORA 1A1KA 4C1UA 5AA2D 4IO7A 2UUBE 1A1IA 2MC6A 4PAFA 2EZ6A 2D21A 5J1DA 2RS6A 4FK5C 4YMBA 2I4BA 3PUXE 1MXXA 2EMWA 2V84A 4IS1C 4YZZA 4F18A 5EHSA 1XT8A 4F3PA 1A1JA 1M5CA 4JI3E 4F9CB 4JB7A 3NOHA 3ZS6A 1SYHA 4HXVA 4YB6A 2WCC3 1M5DA 2H98A 2LJHA 1DK4A 2VGQA 5EHMA 4XTCQ 2YSOA 3SEVA 3TDJA 1G0HA 2BBGA 2YRHA 2G7HA 3FD3A 2NABA 3KJTA 4MEVA 5AE2A 4DR5E 2ZYOA 3RQTA 1B4HA 3OSRA 1S9TA 1MY2A 2REJA 5HM4B 4U23A 4WXDA 1DGCA 4J8ZA 4ZEBA 4G8HA 4KZSA 4PC9A 2L8TA 4NWCA 3V83A 1B7HA 1B7UA 3E79A 1ZBQA 3BFTA 2F3DA 1X6FA 4L8NA 3TAJA 5A6BA 5A2QC 3IJOB 2EOZA 5TSEA 1WVJA 4XEQA 5ET5A 4EF2A 3CI8A 2VQEE 2VPNA 1ZU1A 2DB2A 2LCEA 4TLLB 4Z7EA 3DJWA 2LJUA 1LBCA 4FORA 2Q89A 1YUIA 1SBPA 2GHBA 3FGSA 4PCDA 5I84A 3IOUA 4ZEDA 1LB8A 1FQDA 3B6QA 2HC5A 3HXLA 2NUFA 2Q8UA 1Y4CA 3W9WA 2EL5A 3L6HA 2F35A 4RNSA 1YPNA 3J7Yp 1OVBA 3O6HA 5AA2B 4RY1A 2YSPA 1SW5A 2HXRA 3G3GA 2QMXA 2ZZVA 2WX9A 4OEUA 2EM4A 3MZ1A 4BDNA 3THIA 1B3GA 4YHHE 1SW1A 5CMBA 3QG5C 2HQ0A 1R1NA 2O6AA 3IJXB 5A69A 4QFNA 5KL5A 1JW4A 3B50A 1TFDA 3OMBA 3QYTA 3RN8A 1Y9UA 2Q9TA 2DS9A 4O4KA 1IZ1A 1G2DC 1LFGA 4DLDA 4NF8B 3GBBA 2PFZA 4HE0A 4LU9A 2H25A 3TKDA 2PCRA 5DT6A 2YTJA 3FUZA 1I6QA 2PMSA 1K9YA 4X9TA 2I6EA 3G7WA 1B4ZA 3C4MA 4OHNA 3TQLA 4LFAE 4JVCA 5I58A 4DR3E 2EPZA 1EYIA 4X8WA 2RTXA 2WZOA 5BWJA 1PJSA 5H8FB 2BB8A 3H4ZA 4N15A 3M3KA 4P11A 1DCUA 3TTRA 2EMKA 2UXDE 2E1MA 4XIGQ 4MJOA 2EOQA 1QULA 4DXBA 1MXYA 1PB9A 2FA7A 5KDTB 4WXCA 1N3XA 4DV2E 4DR4E 4R2QA 1TN9A 1UN6B 3RMPA 2L2MA 3WAFA 1DI2A 2DWHA 4GIZA 3SEYA 2ELZA 1BP5A 1LGBC 4C0RA 3LSXA 2YTNA 4JWXA 3THOB 1PKPA 5LMNE 5KL6A 1STUA 2GPIA 3TQWA 3IOVA 3ZKLA 2XX8A 1MQHA 3PV0E 1FBCA 1II5A 1B6HA 4QSDA 1R9QA 3IB0A 3EPJA 2GFEA 2P3VA 1EH3A 2O1MA 1Y20A 5IGAA 2F34A 2XXWA 2YLNA 3O6IA 4MFIA 5AA3A 1B1XA 3OO9A 1IQSA 5A6BD 2NUEA 4WPYA 2Z22A 4G8NA 4I3YA 4N91A 1TWYA 2EJ4A 3KN3A 2RPCA 4ND9A 4RK9A 4I62A 1RYXA 2O7UA 3USDA 2I58A 3K2DA 5L8DA 1A1HA 4GQOA 4G68A 1Q35A 2QJEA 2RC8A 4X62E 2CMOA 5I56B 4BDLA 4P7DA 1P1UA 3KC1A 2ODRC 1VSOA 1N34E 3C36A 4I8OA 1FQCA 4U22A 2LO3A 1ANFA 4DV0E 5BUUA 2DGCA 1NUYA 4H8IA 5I2KB 2JOXA 3MW0A 4R72A 3A3UA 1XMQE 2HHMA 2NVUB 1M5FA 1MY3A 1A8FA 1MDQA 3FXBA 3UK3C 4X1BA 3PUWE 2EMXA 3TMGA 2VF1A 3BGHA 3CIJA 4OFOA 2EMBA 1VFEA 1MQIA 2EMHA 2G29A 2EQ3A 3H7MA 2Q2AA 2WYPA 1PDAA 1BTJA 2D3IA 3HCQA 1FPBA 1HNZE 4JSDA 4ZEKA 4I3EA 4XFEA 1NV0A 3KFMA 4DI3D 1G0IA 2ENAA 2YTIA 2QVRA 5ITOA 2NXOA 2YZTA 4N13A 4F22A 4IO4A 2RC9A 4DCYA 1T0KA 1QKBA 1MXUA 1N76A 1AIVA 3KOTA 4O3AA 2DMIA 4DV4E 3OELA 2B7TA 4JI1E 1A1FA 5H8QA 3IWDA 2MDGA 3K00A 1B3EA 2I49A 3PUVE 4Q8RA 4OVJA 5KDTA 3CR9A 4R2PA 4LFBE 1NI9A 1XHYA 2F6GA 2QVUA 2V93A 5H8NA 3VHTB 3PMXA 4IGRA 4UABA 3UP9A 3CFLA 5AE1A 4AB6A 2JR1A 2ANJA 4TUGA 1LAXA 4DKKA 4H1XA 3F6HA 4DDDA 3ADLA 2F5XA 4PDHA 3VE1B 4DXUA 3PD8A 2Q8JA 2J7JA 4KI0E 1H3DA 2DQVA 4H45A 1QNTA 3MUQA 3QIMA 1ZU0A 3G3FA 2UVIA 1MM6A 2REGA 3E9XA 3OXNA 5CM6A 3K6WA 1NH8A 3T9UA 4ZYGA 4DR1E 3VVEA 2AL4A 3UORA 3N26A 2P3NA 2EOHA 1UIUA 5DVJA 1UBDC 4MX6A 1D3KA 1Q9DA 4OVPA 4QRZA 1KA0A 4KCDA 1N7WA 4GXAA 5AA4B 5BR8E 2O51A 1CNQA 2OLBA 3T9HB 2ODRD 2KLFA 5F3WA 4M9VC 1RC7A 5IZZA 2EP3A 1LBXA 1KA1A 1UTBA 4H8JA 4LATA 1N3GA 2ZNTA 3E13X 3B6WA 3FIGA 4G68B 2EOEA 2XD3A 4OYVA 2EMIA 2GLIA 1B52A 1MXZA 4X64E 4ESXA 3PPPA 3RUMA 3J7AG 1CE2A 2F36A 2CZLA 3E3KA 3A09A 1AMFA 1OMPA 1GVCA 3OMLA 2CEXA 3UA8A 3ODBA 5AC4A 2EOOA 4NXME 4U4SA 1MEYC 2EOMA 3PUYE 5A6KA 1FRPA 2JJKA 3QMFA 2JXPA 4P1LA 3JTZA 2E5LE 1GQEA 5I2NB 2EQ0A 2YPNA 5FHOA 4LQ5A 1MQJA 4B3RE 1H43A 2YTQA 4RXLA 1BIYA 4JI0E 4R2BA 4QFOA 3CFZA 4OOGC 1EYKA 5H8HA 2LT7A 2HAVA 2XXPA 5AA1A 4JDFA 3CG1A 4XKQA 4YMAA 3C6MA 4IO6A 4NF0A 1QUKA 3KWRA 2RF1A 2UUAE 2GRVA 4LF9E 2F97A 2EM3A 2L3JA 1YYKA 3MBPA 1XI6A 3EHSA 4FJPA 2H99A 3FATA 4THIA 4YB5A 2LRSA 4X8RA 3RGYA 2EQ1A 1FJGE 4UACA 1X5WA 5HPQA 5ADZA 2Y7WA 1WXRA 3S9MC
chains in the Genus database with same CATH topology
1P1WA 2UYEA 4NF4A 3TAJA 1RKMA 5CMKA 3IJOB 2OK2A 1A40A 3OEKA 3PPRA 4G68C 1WVJA 2RKMA 3IAZA 3MP6A 3C31A 4ZDMA 3PPNA 5TPAB 4EF2A 3CI8A 1IXCA 3HN0A 4ONYA 5B7DA 1B51A 1R6ZA 4TLLB 2RCBA 3O97A 2I48A 2DWJA 2DE4A 4MBPA 4IO5A 1FCKA 1TXFA 3CSGA 3IO6A 4HS7A 4R75A 1LBCA 4M1VA 4FORA 2Q89A 1SBPA 2GHBA 3FGSA 1PC3A 5H8NB 5I84A 1A99A 1IXHA 3BKIB 2QSXA 1POY1 2DXRA 3IOUA 3O66A 4ZEDA 5ISUA 4YB5A 5ICTA 3S9EA 1LB8A 3OD7A 1ZBMA 5I57A 4OETA 2XXHA 1FQDA 1FTOA 3B6QA 4RYAA 4F1UA 3FVNA 2RCAA 4RK2A 1WODA 1MQGA 3FASA 1Y4CA 3W9WA 3FJ7A 1DMBA 2H5YA 1MS7A 2HAUA 3LSWA 1BKAA 4F2QA 2P2AA 2F35A 3L6HA 4RNSA 1IQ7A 1YPNA 1O63A 2V25A 2QS4A 1CB6A 2ZNSA 3B7DA 4Z0IA 1OVBA 2O7IA 1NNTA 1IEJA 3O6HA 3MVZA 3PMVA 2D5WA 4RY1A 5CMMA 3IX1A 3VXCA 4LVQA 4OFJA 5AA2B 3A3CA 4EF1A 1SW5A 1B3FA 1USYH 2QMXA 3G3GA 4HCYA 4OEUA 3K1PA 2QPQA 3H3GA 2ABHA 5CMCA 3MZ1A 4EXLA 4E0XA 4BDNA 1IUDA 3FV2A 4UA8A 3THIA 1B3GA 4YKJA 1SW1A 3MP8A 3C9HA 2HQ0A 2QL3A 2DWIA 1R1NA 2O6AA 3IJXB 5CMBA 4DXCA 2UVHA 4TLMB 1HSJA 2DE3A 3L6GA 3VXBA 4F3BA 1MQDA 4OWDA 4U1OA 4FATA 4QFNA 3G3IA 1NNFA 1PB7A 4L17A 1JVXA 3K01A 1SYIA 1EZ9A 4JSOA 3H06B 4NTLA 1JW4A 1TFDA 3MC2A 3OMBA 3QYTA 4R6HA 1R9LA 3RN8A 3LBSA 1MY4A 3KEIA 1Y9UA 4F1VA 2Q9TA 4FAJA 2AYSA 1RYOA 2DS9A 5I59B 1I6BA 2XX7A 1IZ1A 1LAFE 5F1QA 1JETA 1QW0A 1A54A 4I1DA 4NE4A 1LFGA 1OLCA 4KFQA 3IOTA 1GV8A 2ZYKA 1B0LA 2VD2A 3QAXA 4H67A 3CRBA 3EN3A 3KG2A 2UYFA 2Y7IA 4PQJA 1LB9A 1P1NA 4KYSA 3RPWA 1B32A 3V5AA 4NF8B 1UIVA 1M5EA 2IA4A 4PFYA 5L9SA 4PP0A 4ZZAA 3GBBA 3S2VA 3VDFA 2P0SA 4ECFA 2V3QA 2H25A 4GFRA 1Q1KA 3TKDA 1FTKA 4NMYA 4U21A 5DT6A 3KJ7A 4QF9A 1YAEA 1A8EA 4NEDA 1B9JA 1B7ZA 1N04A 2A5TA 1I6QA 2AIXA 2UVGA 3FJGA 3FUZA 3M8UA 5HBCA 1OVTA 2PMSA 1D9VA 2H9BA 3DLNA 3TZAA 1J1NA 4MH5A 1MM7A 1FQAA 3T9VA 1IITA 4X9TA 1LBBA 2DVCA 5CBSA 3H6UA 2I6EA 4Z7EA 1URDA 1B4ZA 2P1SA 3G7WA 3MVWA 5H8SA 3C4MA 4OHNA 2FNCA 3TQLA 1DSNA 5ITPA 4H0WA 5KCJA 2XXQA 3VVFA 5I58A 4LUBA 2A5TB 4Q0CA 3EPEA 4YKKA 4F29A 1VE4A 4LP2B 1ZTYA 4H6DA 4NF6B 4F39A 2XX9A 5BWJA 4FEBA 5H8FB 3TUSA 3H4ZA 5IAIA 4P0GA 1M5BA 3M3KA 4MLQA 1P99A 2ZNUA 1NFTA 3PPQA 1MPCA 4H5FA 1NNKA 4P11A 1HSEA 3PPOA 1LCTA 4WEPA 4WXJA 3UN6A 2F7AA 4XIGQ 4YKPA 3CFXA 1QULA 4DXBA 5A5XB 1MXYA 1PB9A 2FA7A 4NF4B 2QS3A 5KDTB 5CI5A 1N3XA 2R71A 5L9MA 4GWOA 1ZLQA 2GHAA 5TP9B 4R6YA 1IIWA 1N0TA 4PETA 4TOZA 1GR2A 4G8MA 1XC1A 3TTNA 3WAFA 4GIZA 2DWHA 4GVOA 3SEYA 3VLUA 2XXTA 5A5XA 2O1LA 1BP5A 1LGBC 1LAGE 2XXXA 3LSXA 4HCWA 4JWXA 4C0RA 5I58B 5DEXA 3KOSA 3TPAA 2HEUA 1I69A 1XS5A 3MAMA 4G4PA 3TFLA 3TQWA 5FHNA 3IOVA 4Q30B 3C33A 3ZKLA 3U94A 2XX8A 4QHQA 1MQHA 1UTHA 4PFWA 4ELOA 1B58A 1BLFA 3GXAA 3PV0E 1WDNA 4KR5A 2LAOA 2YJPA 1II5A 5LOMA 1IXGA 3LSLA 1B6HA 3JZJA 4G2ZA 2F7CA 1DOTA 3K6VA 4QSDA 1SDXA 4R74A 1R9QA 2I3WA 1N3WA 3IB0A 4EQ9A 2OZZA 3OENA 3TTRA 1QVSA 2NUVA 2GFEA 3I3VA 3IK6B 4IO2A 4M4GA 2DVZA 4GLIA 2X26A 2NOOA 4EXKA 1OLAA 4NWDA 1EH3A 2O1MA 1B3LA 1Y20A 3VFJA 1Y4TA 5AA4A 4F1YA 1PEBA 1FQBA 2F34A 3LSFB 2G93A 2O84X 3MPKA 2XXWA 5ELVA 2YLNA 3O6IA 4MFIA 3K1MA 3OEMA 5F7VA 3VV5A 2Q88A 5AA3A 5JTYA 1TFAA 1B1XA 3MZ9A 3OO9A 3MZBA 4KPTA 3VLWA 2UXAA 3U72A 1NKXA 3GBAA 4R2FA 4OEVA 3I6VA 3VLVA 1QUJA 3DP6A 1ZJLA 2Z22A 4G8NA 3EQ1A 4HTGA 1O7TA 3Q26A 2ALUA 4PE5B 1TWYA 1B46A 1MH4A 3KN3A 3QXMA 4H65A 1P1OA 4I8CA 3ONMA 3I5OA 4ND9A 4X48A 4RK9A 3GZGA 4XKPA 2Y7RA 4I62A 1VR5A 3O9PA 1RYXA 1D4NA 2O7UA 3K4UA 4LQ2A 1A7LA 4GOTA 3T66A 2GH9A 2I58A 3K2DA 3USDA 1KWHA 5L8DA 5I57B 2BJJX 4ZZEA 1AH5A 3EHUA 4GQOA 3MP1A 4TQUQ 3UIFA 1URGA 2XXVA 3DM0A 1MRPA 4G68A 2VD3A 5AA2A 5ICQA 2PVUA 3G3HA 2PT2A 1Q35A 2QJEA 3FVKA 1JW5A 2RC8A 2CMOA 3R7XA 3MQ9A 2QS1A 4JWYA 3K6UA 3RT8A 4BDRA 4BDLA 3TTLA 4EQBA 5I56B 3N94A 4IGTA 4U4XA 1EZPA 4DE8A 3ILUB 1P1UA 1JEUA 3C32A 3ILTB 3K02A 4ELPA 5CBRA 1H44A 1Y3NA 1VSOA 4EQ7A 3DP8A 1FTLA 1TT1A 3K6XA 3O2AA 5TU0A 3C36A 1DPPA 1N7XA 3B6TA 1DTZA 1ATGA 4RPNA 2V3TA 3IO4A 3IR1A 4OQOA 1FQCA 4U22A 3N5LA 3RT6B 1ANFA 3LR1A 2ZYNA 3MVYA 4RJZA 4OFLA 4YAHX 4H8IA 5I2KB 4ZEIA 5BUUA 3RQTA 1NNPA 1S7YA 3HSTA 5H8FA 4KCCA 2Y7KA 3HV1A 3MW0A 3LC8A 2ESNA 4R72A 4DCXA 3A3UA 1LLSA 1MG1A 3FXQA 3PD9A 3Q25A 3FXUA 4N07A 1IXIA 4P0IA 1XVYA 1URSA 4KQPA 4IY6A 4R9GA 1O64A 2NVUB 4ZE8A 4ELRA 3K0VA 1M5FA 3RY3A 4C1TA 5B70A 1NH7A 4FIMA 4RPOA 1MY3A 1UTBB 1A8FA 4QFKA 3T93B 1MDQA 1P1QA 1HSLA 1Z7ME 2B3FA 4WEDA 3U93A 1EZOA 4X1BA 1SI0A 3TCGA 3PUWE 4EUOA 4QSEA 2UVJA 3TMGA 3CIJA 4OFOA 5FTIA 4F3GA 1VFEA 3JYRA 4F3SA 3TCHA 5JTYB 1MQIA 2G29A 1MDP1 2DP8A 1DTGA 3H03A 4GD5A 3T96B 3ZKKA 1PBQA 3O6GA 3VVDA 3H7MA 4MLVA 2B3BA 2Q2AA 1Y1ZA 1PDAA 3D4CA 3PGFA 3RTFB 3TEPA 1B3HA 1BTJA 1YCJA 4YKIA 2DOJA 2D3IA 1B5IA 3HCQA 5I2NA 1SW2A 3Q27A 4LA9A 5M2VA 3TTMA 1OQHA 4OESA 4JSDA 3CG3A 3UK4A 5KZTA 3QUJA 4ZEKA 3F11A 5FTHA 3U8QA 2IEEA 5IKBA 4YB7A 1FQFA 2F78A 2OBGA 2O69A 1PBPA 3KFMA 3U1OA 3H6TA 3VE1B 3OSQA 2OWTA 4GL0A 1UTHB 2Y7PA 1ELJA 5CC2A 5ITOA 3HHFA 4KYEA 2R9JA 2Y84A 2NXOA 4IB2A 3SERA 4N13A 4F22A 3K1NA 2XXIA 4IO4A 4KD5A 2X7PA 3FXRA 2RC9A 4NF5B 1SVXB 4DCYA 4EDPA 4ZE9A 1T0KA 2H4IA 1QKBA 5K2YA 1NMUA 1MXUA 1QUIA 1D9YA 2F6PA 1N84A 1N76A 3M3FA 4KHZE 4FEDA 3H6WA 1USYE 2NWJA 2XD2A 4BDOA 1AIVA 3KOTA 2ONSA 4XXUA 5TP9A 4H5GA 4O3AA 4YMAA 2HZKA 2I0CA 3OELA 1NL5A 2V3UA 1H45A 5DTBA 3C35A 3T22A 1L5TA 2HXWA 3AXFA 4JBZA 4OENA 3FVGA 3TYHA 5H8QA 3KSXA 3K00A 1B3EA 3U92A 2I49A 3DP4A 3PUVE 5K2XA 2XXYA 3G3KA 4FE8A 4OVJA 4U1ZA 3SEUA 4DLDA 4DZ1A 4O3BA 4Q8RA 4WKMA 1LFIA 4JXIA 4N6PA 5KDTA 3CR9A 3V83A 1JEVA 1XHYA 1LSTA 2QS2A 2XHDA 3N6UA 4ESWA 1B0HA 2F6GA 1XOCA 2I4CA 2E1SA 3KSJA 1Y3PA 3MWBA 1MXVA 3QSLA 2V93A 3FZVA 4BDMA 5H8NA 5H8QB 4AB5A 5AE4A 3PMXA 4IGRA 4LZ5A 2QMWA 5I56A 3UP9A 3CFLA 4PFTA 1ZIUA 4AB6A 2ANJA 5DVIA 3SEXA 3WAEA 1LAXA 4E0WA 3HO7A 3R26A 4H1XA 3LUYA 4BLAA 1MPDA 1OIBA 3CVGA 4POXA 4DDDA 1F9BA 3KBRA 3MVXA 2F7BA 3FJMA 4DXUA 2F5XA 3KN7A 3PUZE 2Z23A 1B5JA 3PD8A 2OWSA 1FTMA 4JWOA 3EHTA 4RA1A 2Q8JA 4POWA 1Y3QA 4Q5TA 1AL3A 1FW0A 1S50A 2E0SA 3C34A 2ZYMA 4LONB 4NF5A 3MJNA 4KI0E 1H3DA 2DQVA 1JNFA 3KN8A 2VOZA 3O29A 1US5A 2Z8EA 3MUQA 3QIMA 1ZU0A 3G3FA 5CRYA 2UVIA 4DIGA 1MM6A 2REGA 3E9XA 3OXNA 3PU5A 4OERA 3IB2A 3KGCA 2DSFA 4R73A 5CM6A 3K6WA 1NH8A 1GTKA 3T9UA 1B05A 1FQEA 4ELQA 3EF7A 2HCAA 2THIA 2Z8DA 3VVEA 2AL4A 3UORA 1VFDA 1SD3A 3N26A 1LAHE 1UIUA 4ISUA 5DVJA 1JVYA 1ZKBA 1JW1A 3RLFE 2HZLA 1D3KA 5H8HB 3V89B 3E4RA 3GLBA 1SQYA 1PB8A 4I9DA 3H6VA 1MY0A 3KZGA 5L9OA 4QFLA 3SDFA 2A5SA 4QRZA 5EYFA 2HFBA 4GL8A 5JEIA 1YTVA 4KCDA 3DELB 4LZ8A 1N7WA 3FV1A 4GXAA 2Q2CA 5DVFA 5AA4B 3N6TA 2O51A 2RINA 2WKYA 4GXSB 4R6KA 4YU0A 2OLBA 3HPIA 3T9HB 1LCFA 2XXUA 2R6GE 2VHAA 3W15C 2PT1A 4F2OA 3IL1B 2DE2A 3IOWA 2KLFA 1JQFA 2PBWA 5TPAA 4G77A 4X1DA 1B5HA 2PX1A 1DPEA 4GF8A 1H76A 2O68A 2I0BA 4IY5A 1OQGA 1SI1A 1Y1MA 1US4A 3MPLA 4GRKA 1EU8A 5KCJB 3D4GA 3ECRA 4LZ7A 1UTBA 4H8JA 3S9LC 2FYIA 4LATA 4NF8A 4NF6A 2F8DA 5DEXB 4F31B 2ZNTA 1B2HA 3SKPA 4YICA 1QJMA 4U2RA 3E13X 1LFHA 3B6WA 3Q28A 3IORA 2M8CA 2ONRA 4G68B 1MPBA 5JK4A 2VP1A 4IO3A 4C1UA 5AA2D 4IO7A 4AQ4A 2XD3A 4BDQA 4OYVA 1B52A 4R9FA 4O3CA 3S4UA 1MXZA 4ESXA 3PPPA 4OMBA 1FTJA 1XVXA 3RUMA 3BFUA 2D21A 2Z8FA 3T9XB 2W7YA 5J1DA 1CE2A 2F36A 3SETA 4MF3A 2CZLA 3FVOA 3E3KA 3A09A 3CSBA 1AMFA 1OMPA 3JV9A 4YMBA 2I4BA 2PYYA 2ZMBA 3PUXE 1GVCA 1MXXA 4ZEFA 3UA8A 2RC7A 2ONKE 2V84A 3ODBA 4FECA 4YZZA 4F18A 1SW4A 4U4SA 5EHSA 3RTWB 1XT8A 4F3PA 4ZECA 5I59A 3PUYE 1M5CA 5I2KA 3G3JA 4JB7A 4OTEA 3OO7A 3ZS6A 1SYHA 3Q29A 2DWAA 2ZXTA 3FIRA 2X7QA 4K3FA 4ZS9A 3TCFA 4YB6A 3IB1A 1M5DA 5I2NB 2DYXA 2YPNA 2OCUA 5FHOA 2H98A 3RNNA 3TELA 2QRYA 3OO6A 4LQ5A 1MQJA 4XKNA 2VGQA 5DYHA 1GGGA 1H43A 1B40A 4XTCQ 4QSCA 5EHMA 3SEVA 1MH3A 3TDJA 2OJTA 3PMWA 3TTKA 1UQWA 3OOAA 1POTA 4RXLA 1BIYA 3FD3A 3HHGA 4HW8A 3BBRA 3KJTA 1MY1A 1QKAA 1ZMGA 3CFZA 4QFOA 4R2BA 5H8HA 3SESA 2ZYOA 2HAVA 1A55A 2XXPA 1B4HA 3CG1A 3QUFA 4JDFA 3OO8A 4XKQA 5AA1A 3OSRA 4OXVA 3SEWA 1Z7NE 1S9TA 4IO6A 4F19A 1QUKA 1MY2A 3W9VA 2XXRA 2REJA 2RF1A 5HM4B 3R6UA 4U23A 2GRVA 3M3LA 3V8XB 1AOVA 2F97A 4OZ9A 5FHMA 2DXYA 2I3VA 4ZEBA 3ZSFA 4G8HA 4PFUA 4NWCA 3UGWA 4XKRA 3QK6A 2AL5A 3EHSA 3MBPA 1I6AA 2H99A 1B7HA 3FATA 4FJPA 3O28A 4KYDA 4THIA 1B7UA 3P7IA 1B1HA 4UACA 3RGYA 2B65A 3BFTA 4QFPA 1MXWA 3S9NC 5HPQA 2Y7WA 3S9MC 3TODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1W A;  2UYE A;  4NF4 A;  3TAJ A;  1RKM A;  5CMK A;  3IJO B;  2OK2 A;  1A40 A;  3OEK A;  3PPR A;  4G68 C;  1WVJ A;  2RKM A;  3IAZ A;  3MP6 A;  3C31 A;  4ZDM A;  3PPN A;  5TPA B;  4EF2 A;  3CI8 A;  1IXC A;  3HN0 A;  4ONY A;  5B7D A;  1B51 A;  1R6Z A;  4TLL B;  2RCB A;  3O97 A;  2I48 A;  2DWJ A;  2DE4 A;  4MBP A;  4IO5 A;  1FCK A;  1TXF A;  3CSG A;  3IO6 A;  4HS7 A;  4R75 A;  1LBC A;  4M1V A;  4FOR A;  2Q89 A;  1SBP A;  2GHB A;  3FGS A;  1PC3 A;  5H8N B;  5I84 A;  1A99 A;  1IXH A;  3BKI B;  2QSX A;  1POY 1;  2DXR A;  3IOU A;  3O66 A;  4ZED A;  5ISU A;  4YB5 A;  5ICT A;  3S9E A;  1LB8 A;  3OD7 A;  1ZBM A;  5I57 A;  4OET A;  2XXH A;  1FQD A;  1FTO A;  3B6Q A;  4RYA A;  4F1U A;  3FVN A;  2RCA A;  4RK2 A;  1WOD A;  1MQG A;  3FAS A;  1Y4C A;  3W9W A;  3FJ7 A;  1DMB A;  2H5Y A;  1MS7 A;  2HAU A;  3LSW A;  1BKA A;  4F2Q A;  2P2A A;  2F35 A;  3L6H A;  4RNS A;  1IQ7 A;  1YPN A;  1O63 A;  2V25 A;  2QS4 A;  1CB6 A;  2ZNS A;  3B7D A;  4Z0I A;  1OVB A;  2O7I A;  1NNT A;  1IEJ A;  3O6H A;  3MVZ A;  3PMV A;  2D5W A;  4RY1 A;  5CMM A;  3IX1 A;  3VXC A;  4LVQ A;  4OFJ A;  5AA2 B;  3A3C A;  4EF1 A;  1SW5 A;  1B3F A;  1USY H;  2QMX A;  3G3G A;  4HCY A;  4OEU A;  3K1P A;  2QPQ A;  3H3G A;  2ABH A;  5CMC A;  3MZ1 A;  4EXL A;  4E0X A;  4BDN A;  1IUD A;  3FV2 A;  4UA8 A;  3THI A;  1B3G A;  4YKJ A;  1SW1 A;  3MP8 A;  3C9H A;  2HQ0 A;  2QL3 A;  2DWI A;  1R1N A;  2O6A A;  3IJX B;  5CMB A;  4DXC A;  2UVH A;  4TLM B;  1HSJ A;  2DE3 A;  3L6G A;  3VXB A;  4F3B A;  1MQD A;  4OWD A;  4U1O A;  4FAT A;  4QFN A;  3G3I A;  1NNF A;  1PB7 A;  4L17 A;  1JVX A;  3K01 A;  1SYI A;  1EZ9 A;  4JSO A;  3H06 B;  4NTL A;  1JW4 A;  1TFD A;  3MC2 A;  3OMB A;  3QYT A;  4R6H A;  1R9L A;  3RN8 A;  3LBS A;  1MY4 A;  3KEI A;  1Y9U A;  4F1V A;  2Q9T A;  4FAJ A;  2AYS A;  1RYO A;  2DS9 A;  5I59 B;  1I6B A;  2XX7 A;  1IZ1 A;  1LAF E;  5F1Q A;  1JET A;  1QW0 A;  1A54 A;  4I1D A;  4NE4 A;  1LFG A;  1OLC A;  4KFQ A;  3IOT A;  1GV8 A;  2ZYK A;  1B0L A;  2VD2 A;  3QAX A;  4H67 A;  3CRB A;  3EN3 A;  3KG2 A;  2UYF A;  2Y7I A;  4PQJ A;  1LB9 A;  1P1N A;  4KYS A;  3RPW A;  1B32 A;  3V5A A;  4NF8 B;  1UIV A;  1M5E A;  2IA4 A;  4PFY A;  5L9S A;  4PP0 A;  4ZZA A;  3GBB A;  3S2V A;  3VDF A;  2P0S A;  4ECF A;  2V3Q A;  2H25 A;  4GFR A;  1Q1K A;  3TKD A;  1FTK A;  4NMY A;  4U21 A;  5DT6 A;  3KJ7 A;  4QF9 A;  1YAE A;  1A8E A;  4NED A;  1B9J A;  1B7Z A;  1N04 A;  2A5T A;  1I6Q A;  2AIX A;  2UVG A;  3FJG A;  3FUZ A;  3M8U A;  5HBC A;  1OVT A;  2PMS A;  1D9V A;  2H9B A;  3DLN A;  3TZA A;  1J1N A;  4MH5 A;  1MM7 A;  1FQA A;  3T9V A;  1IIT A;  4X9T A;  1LBB A;  2DVC A;  5CBS A;  3H6U A;  2I6E A;  4Z7E A;  1URD A;  1B4Z A;  2P1S A;  3G7W A;  3MVW A;  5H8S A;  3C4M A;  4OHN A;  2FNC A;  3TQL A;  1DSN A;  5ITP A;  4H0W A;  5KCJ A;  2XXQ A;  3VVF A;  5I58 A;  4LUB A;  2A5T B;  4Q0C A;  3EPE A;  4YKK A;  4F29 A;  1VE4 A;  4LP2 B;  1ZTY A;  4H6D A;  4NF6 B;  4F39 A;  2XX9 A;  5BWJ A;  4FEB A;  5H8F B;  3TUS A;  3H4Z A;  5IAI A;  4P0G A;  1M5B A;  3M3K A;  4MLQ A;  1P99 A;  2ZNU A;  1NFT A;  3PPQ A;  1MPC A;  4H5F A;  1NNK A;  4P11 A;  1HSE A;  3PPO A;  1LCT A;  4WEP A;  4WXJ A;  3UN6 A;  2F7A A;  4XIG Q;  4YKP A;  3CFX A;  1QUL A;  4DXB A;  5A5X B;  1MXY A;  1PB9 A;  2FA7 A;  4NF4 B;  2QS3 A;  5KDT B;  5CI5 A;  1N3X A;  2R71 A;  5L9M A;  4GWO A;  1ZLQ A;  2GHA A;  5TP9 B;  4R6Y A;  1IIW A;  1N0T A;  4PET A;  4TOZ A;  1GR2 A;  4G8M A;  1XC1 A;  3TTN A;  3WAF A;  4GIZ A;  2DWH A;  4GVO A;  3SEY A;  3VLU A;  2XXT A;  5A5X A;  2O1L A;  1BP5 A;  1LGB C;  1LAG E;  2XXX A;  3LSX A;  4HCW A;  4JWX A;  4C0R A;  5I58 B;  5DEX A;  3KOS A;  3TPA A;  2HEU A;  1I69 A;  1XS5 A;  3MAM A;  4G4P A;  3TFL A;  3TQW A;  5FHN A;  3IOV A;  4Q30 B;  3C33 A;  3ZKL A;  3U94 A;  2XX8 A;  4QHQ A;  1MQH A;  1UTH A;  4PFW A;  4ELO A;  1B58 A;  1BLF A;  3GXA A;  3PV0 E;  1WDN A;  4KR5 A;  2LAO A;  2YJP A;  1II5 A;  5LOM A;  1IXG A;  3LSL A;  1B6H A;  3JZJ A;  4G2Z A;  2F7C A;  1DOT A;  3K6V A;  4QSD A;  1SDX A;  4R74 A;  1R9Q A;  2I3W A;  1N3W A;  3IB0 A;  4EQ9 A;  2OZZ A;  3OEN A;  3TTR A;  1QVS A;  2NUV A;  2GFE A;  3I3V A;  3IK6 B;  4IO2 A;  4M4G A;  2DVZ A;  4GLI A;  2X26 A;  2NOO A;  4EXK A;  1OLA A;  4NWD A;  1EH3 A;  2O1M A;  1B3L A;  1Y20 A;  3VFJ A;  1Y4T A;  5AA4 A;  4F1Y A;  1PEB A;  1FQB A;  2F34 A;  3LSF B;  2G93 A;  2O84 X;  3MPK A;  2XXW A;  5ELV A;  2YLN A;  3O6I A;  4MFI A;  3K1M A;  3OEM A;  5F7V A;  3VV5 A;  2Q88 A;  5AA3 A;  5JTY A;  1TFA A;  1B1X A;  3MZ9 A;  3OO9 A;  3MZB A;  4KPT A;  3VLW A;  2UXA A;  3U72 A;  1NKX A;  3GBA A;  4R2F A;  4OEV A;  3I6V A;  3VLV A;  1QUJ A;  3DP6 A;  1ZJL A;  2Z22 A;  4G8N A;  3EQ1 A;  4HTG A;  1O7T A;  3Q26 A;  2ALU A;  4PE5 B;  1TWY A;  1B46 A;  1MH4 A;  3KN3 A;  3QXM A;  4H65 A;  1P1O A;  4I8C A;  3ONM A;  3I5O A;  4ND9 A;  4X48 A;  4RK9 A;  3GZG A;  4XKP A;  2Y7R A;  4I62 A;  1VR5 A;  3O9P A;  1RYX A;  1D4N A;  2O7U A;  3K4U A;  4LQ2 A;  1A7L A;  4GOT A;  3T66 A;  2GH9 A;  2I58 A;  3K2D A;  3USD A;  1KWH A;  5L8D A;  5I57 B;  2BJJ X;  4ZZE A;  1AH5 A;  3EHU A;  4GQO A;  3MP1 A;  4TQU Q;  3UIF A;  1URG A;  2XXV A;  3DM0 A;  1MRP A;  4G68 A;  2VD3 A;  5AA2 A;  5ICQ A;  2PVU A;  3G3H A;  2PT2 A;  1Q35 A;  2QJE A;  3FVK A;  1JW5 A;  2RC8 A;  2CMO A;  3R7X A;  3MQ9 A;  2QS1 A;  4JWY A;  3K6U A;  3RT8 A;  4BDR A;  4BDL A;  3TTL A;  4EQB A;  5I56 B;  3N94 A;  4IGT A;  4U4X A;  1EZP A;  4DE8 A;  3ILU B;  1P1U A;  1JEU A;  3C32 A;  3ILT B;  3K02 A;  4ELP A;  5CBR A;  1H44 A;  1Y3N A;  1VSO A;  4EQ7 A;  3DP8 A;  1FTL A;  1TT1 A;  3K6X A;  3O2A A;  5TU0 A;  3C36 A;  1DPP A;  1N7X A;  3B6T A;  1DTZ A;  1ATG A;  4RPN A;  2V3T A;  3IO4 A;  3IR1 A;  4OQO A;  1FQC A;  4U22 A;  3N5L A;  3RT6 B;  1ANF A;  3LR1 A;  2ZYN A;  3MVY A;  4RJZ A;  4OFL A;  4YAH X;  4H8I A;  5I2K B;  4ZEI A;  5BUU A;  3RQT A;  1NNP A;  1S7Y A;  3HST A;  5H8F A;  4KCC A;  2Y7K A;  3HV1 A;  3MW0 A;  3LC8 A;  2ESN A;  4R72 A;  4DCX A;  3A3U A;  1LLS A;  1MG1 A;  3FXQ A;  3PD9 A;  3Q25 A;  3FXU A;  4N07 A;  1IXI A;  4P0I A;  1XVY A;  1URS A;  4KQP A;  4IY6 A;  4R9G A;  1O64 A;  2NVU B;  4ZE8 A;  4ELR A;  3K0V A;  1M5F A;  3RY3 A;  4C1T A;  5B70 A;  1NH7 A;  4FIM A;  4RPO A;  1MY3 A;  1UTB B;  1A8F A;  4QFK A;  3T93 B;  1MDQ A;  1P1Q A;  1HSL A;  1Z7M E;  2B3F A;  4WED A;  3U93 A;  1EZO A;  4X1B A;  1SI0 A;  3TCG A;  3PUW E;  4EUO A;  4QSE A;  2UVJ A;  3TMG A;  3CIJ A;  4OFO A;  5FTI A;  4F3G A;  1VFE A;  3JYR A;  4F3S A;  3TCH A;  5JTY B;  1MQI A;  2G29 A;  1MDP 1;  2DP8 A;  1DTG A;  3H03 A;  4GD5 A;  3T96 B;  3ZKK A;  1PBQ A;  3O6G A;  3VVD A;  3H7M A;  4MLV A;  2B3B A;  2Q2A A;  1Y1Z A;  1PDA A;  3D4C A;  3PGF A;  3RTF B;  3TEP A;  1B3H A;  1BTJ A;  1YCJ A;  4YKI A;  2DOJ A;  2D3I A;  1B5I A;  3HCQ A;  5I2N A;  1SW2 A;  3Q27 A;  4LA9 A;  5M2V A;  3TTM A;  1OQH A;  4OES A;  4JSD A;  3CG3 A;  3UK4 A;  5KZT A;  3QUJ A;  4ZEK A;  3F11 A;  5FTH A;  3U8Q A;  2IEE A;  5IKB A;  4YB7 A;  1FQF A;  2F78 A;  2OBG A;  2O69 A;  1PBP A;  3KFM A;  3U1O A;  3H6T A;  3VE1 B;  3OSQ A;  2OWT A;  4GL0 A;  1UTH B;  2Y7P A;  1ELJ A;  5CC2 A;  5ITO A;  3HHF A;  4KYE A;  2R9J A;  2Y84 A;  2NXO A;  4IB2 A;  3SER A;  4N13 A;  4F22 A;  3K1N A;  2XXI A;  4IO4 A;  4KD5 A;  2X7P A;  3FXR A;  2RC9 A;  4NF5 B;  1SVX B;  4DCY A;  4EDP A;  4ZE9 A;  1T0K A;  2H4I A;  1QKB A;  5K2Y A;  1NMU A;  1MXU A;  1QUI A;  1D9Y A;  2F6P A;  1N84 A;  1N76 A;  3M3F A;  4KHZ E;  4FED A;  3H6W A;  1USY E;  2NWJ A;  2XD2 A;  4BDO A;  1AIV A;  3KOT A;  2ONS A;  4XXU A;  5TP9 A;  4H5G A;  4O3A A;  4YMA A;  2HZK A;  2I0C A;  3OEL A;  1NL5 A;  2V3U A;  1H45 A;  5DTB A;  3C35 A;  3T22 A;  1L5T A;  2HXW A;  3AXF A;  4JBZ A;  4OEN A;  3FVG A;  3TYH A;  5H8Q A;  3KSX A;  3K00 A;  1B3E A;  3U92 A;  2I49 A;  3DP4 A;  3PUV E;  5K2X A;  2XXY A;  3G3K A;  4FE8 A;  4OVJ A;  4U1Z A;  3SEU A;  4DLD A;  4DZ1 A;  4O3B A;  4Q8R A;  4WKM A;  1LFI A;  4JXI A;  4N6P A;  5KDT A;  3CR9 A;  3V83 A;  1JEV A;  1XHY A;  1LST A;  2QS2 A;  2XHD A;  3N6U A;  4ESW A;  1B0H A;  2F6G A;  1XOC A;  2I4C A;  2E1S A;  3KSJ A;  1Y3P A;  3MWB A;  1MXV A;  3QSL A;  2V93 A;  3FZV A;  4BDM A;  5H8N A;  5H8Q B;  4AB5 A;  5AE4 A;  3PMX A;  4IGR A;  4LZ5 A;  2QMW A;  5I56 A;  3UP9 A;  3CFL A;  4PFT A;  1ZIU A;  4AB6 A;  2ANJ A;  5DVI A;  3SEX A;  3WAE A;  1LAX A;  4E0W A;  3HO7 A;  3R26 A;  4H1X A;  3LUY A;  4BLA A;  1MPD A;  1OIB A;  3CVG A;  4POX A;  4DDD A;  1F9B A;  3KBR A;  3MVX A;  2F7B A;  3FJM A;  4DXU A;  2F5X A;  3KN7 A;  3PUZ E;  2Z23 A;  1B5J A;  3PD8 A;  2OWS A;  1FTM A;  4JWO A;  3EHT A;  4RA1 A;  2Q8J A;  4POW A;  1Y3Q A;  4Q5T A;  1AL3 A;  1FW0 A;  1S50 A;  2E0S A;  3C34 A;  2ZYM A;  4LON B;  4NF5 A;  3MJN A;  4KI0 E;  1H3D A;  2DQV A;  1JNF A;  3KN8 A;  2VOZ A;  3O29 A;  1US5 A;  2Z8E A;  3MUQ A;  3QIM A;  1ZU0 A;  3G3F A;  5CRY A;  2UVI A;  4DIG A;  1MM6 A;  2REG A;  3E9X A;  3OXN A;  3PU5 A;  4OER A;  3IB2 A;  3KGC A;  2DSF A;  4R73 A;  5CM6 A;  3K6W A;  1NH8 A;  1GTK A;  3T9U A;  1B05 A;  1FQE A;  4ELQ A;  3EF7 A;  2HCA A;  2THI A;  2Z8D A;  3VVE A;  2AL4 A;  3UOR A;  1VFD A;  1SD3 A;  3N26 A;  1LAH E;  1UIU A;  4ISU A;  5DVJ A;  1JVY A;  1ZKB A;  1JW1 A;  3RLF E;  2HZL A;  1D3K A;  5H8H B;  3V89 B;  3E4R A;  3GLB A;  1SQY A;  1PB8 A;  4I9D A;  3H6V A;  1MY0 A;  3KZG A;  5L9O A;  4QFL A;  3SDF A;  2A5S A;  4QRZ A;  5EYF A;  2HFB A;  4GL8 A;  5JEI A;  1YTV A;  4KCD A;  3DEL B;  4LZ8 A;  1N7W A;  3FV1 A;  4GXA A;  2Q2C A;  5DVF A;  5AA4 B;  3N6T A;  2O51 A;  2RIN A;  2WKY A;  4GXS B;  4R6K A;  4YU0 A;  2OLB A;  3HPI A;  3T9H B;  1LCF A;  2XXU A;  2R6G E;  2VHA A;  3W15 C;  2PT1 A;  4F2O A;  3IL1 B;  2DE2 A;  3IOW A;  2KLF A;  1JQF A;  2PBW A;  5TPA A;  4G77 A;  4X1D A;  1B5H A;  2PX1 A;  1DPE A;  4GF8 A;  1H76 A;  2O68 A;  2I0B A;  4IY5 A;  1OQG A;  1SI1 A;  1Y1M A;  1US4 A;  3MPL A;  4GRK A;  1EU8 A;  5KCJ B;  3D4G A;  3ECR A;  4LZ7 A;  1UTB A;  4H8J A;  3S9L C;  2FYI A;  4LAT A;  4NF8 A;  4NF6 A;  2F8D A;  5DEX B;  4F31 B;  2ZNT A;  1B2H A;  3SKP A;  4YIC A;  1QJM A;  4U2R A;  3E13 X;  1LFH A;  3B6W A;  3Q28 A;  3IOR A;  2M8C A;  2ONR A;  4G68 B;  1MPB A;  5JK4 A;  2VP1 A;  4IO3 A;  4C1U A;  5AA2 D;  4IO7 A;  4AQ4 A;  2XD3 A;  4BDQ A;  4OYV A;  1B52 A;  4R9F A;  4O3C A;  3S4U A;  1MXZ A;  4ESX A;  3PPP A;  4OMB A;  1FTJ A;  1XVX A;  3RUM A;  3BFU A;  2D21 A;  2Z8F A;  3T9X B;  2W7Y A;  5J1D A;  1CE2 A;  2F36 A;  3SET A;  4MF3 A;  2CZL A;  3FVO A;  3E3K A;  3A09 A;  3CSB A;  1AMF A;  1OMP A;  3JV9 A;  4YMB A;  2I4B A;  2PYY A;  2ZMB A;  3PUX E;  1GVC A;  1MXX A;  4ZEF A;  3UA8 A;  2RC7 A;  2ONK E;  2V84 A;  3ODB A;  4FEC A;  4YZZ A;  4F18 A;  1SW4 A;  4U4S A;  5EHS A;  3RTW B;  1XT8 A;  4F3P A;  4ZEC A;  5I59 A;  3PUY E;  1M5C A;  5I2K A;  3G3J A;  4JB7 A;  4OTE A;  3OO7 A;  3ZS6 A;  1SYH A;  3Q29 A;  2DWA A;  2ZXT A;  3FIR A;  2X7Q A;  4K3F A;  4ZS9 A;  3TCF A;  4YB6 A;  3IB1 A;  1M5D A;  5I2N B;  2DYX A;  2YPN A;  2OCU A;  5FHO A;  2H98 A;  3RNN A;  3TEL A;  2QRY A;  3OO6 A;  4LQ5 A;  1MQJ A;  4XKN A;  2VGQ A;  5DYH A;  1GGG A;  1H43 A;  1B40 A;  4XTC Q;  4QSC A;  5EHM A;  3SEV A;  1MH3 A;  3TDJ A;  2OJT A;  3PMW A;  3TTK A;  1UQW A;  3OOA A;  1POT A;  4RXL A;  1BIY A;  3FD3 A;  3HHG A;  4HW8 A;  3BBR A;  3KJT A;  1MY1 A;  1QKA A;  1ZMG A;  3CFZ A;  4QFO A;  4R2B A;  5H8H A;  3SES A;  2ZYO A;  2HAV A;  1A55 A;  2XXP A;  1B4H A;  3CG1 A;  3QUF A;  4JDF A;  3OO8 A;  4XKQ A;  5AA1 A;  3OSR A;  4OXV A;  3SEW A;  1Z7N E;  1S9T A;  4IO6 A;  4F19 A;  1QUK A;  1MY2 A;  3W9V A;  2XXR A;  2REJ A;  2RF1 A;  5HM4 B;  3R6U A;  4U23 A;  2GRV A;  3M3L A;  3V8X B;  1AOV A;  2F97 A;  4OZ9 A;  5FHM A;  2DXY A;  2I3V A;  4ZEB A;  3ZSF A;  4G8H A;  4PFU A;  4NWC A;  3UGW A;  4XKR A;  3QK6 A;  2AL5 A;  3EHS A;  3MBP A;  1I6A A;  2H99 A;  1B7H A;  3FAT A;  4FJP A;  3O28 A;  4KYD A;  4THI A;  1B7U A;  3P7I A;  1B1H A;  4UAC A;  3RGY A;  2B65 A;  3BFT A;  4QFP A;  1MXW A;  3S9N C;  5HPQ A;  2Y7W A;  3S9M C;  3TOD A; 
#chains in the Genus database with same CATH topology
 1P1W A;  1RKM A;  1NEI A;  4G68 C;  1A40 A;  3PPR A;  2D9H A;  5A5X A;  3IAZ A;  2RKM A;  3MP6 A;  4ZDM A;  5TPA B;  3PPN A;  2YTO A;  3IWC A;  3O97 A;  2GHF A;  2DE4 A;  1FCK A;  3IO6 A;  1FPK A;  4OA4 A;  3BKI B;  4F6M A;  5ICT A;  1LBZ A;  5I57 A;  1ZBM A;  1FTO A;  4F1U A;  1BB8 A;  3FAS A;  1DMB A;  1MS7 A;  3LSW A;  1BKA A;  1O63 A;  2QS4 A;  3PMV A;  4L5N C;  1ZAA C;  5IZ3 A;  4LVQ A;  4HCY A;  3ADG A;  1JP4 A;  2E72 A;  1J5E E;  1IUD A;  2EPU A;  3MP8 A;  3C9H A;  2QL3 A;  2UVH A;  2DE3 A;  3C4B A;  4BC9 A;  4U1O A;  5LL6 R;  4L17 A;  1JVX A;  3K01 A;  3H06 B;  4NTL A;  1HNX E;  1NCS A;  4NAP A;  3LLH A;  4PF8 A;  4F1V A;  1RYO A;  2EOJ A;  2XX7 A;  5F1Q A;  1LAF E;  1QW0 A;  4DV7 E;  4NE4 A;  1NV7 A;  4KFQ A;  4R2A A;  1B0L A;  4H67 A;  4PQJ A;  1EZP A;  3CRB A;  3J81 C;  1P1N A;  3RPW A;  1B32 A;  1MGT A;  5L9S A;  4PP0 A;  2P0S A;  1Q1K A;  1NUW A;  4K0K E;  4QF9 A;  1B7Z A;  2UVG A;  3FJG A;  5HBC A;  2H9B A;  3DLN A;  4MH5 A;  3TQM A;  2CZI A;  4MMP A;  1O0W A;  5CBS A;  2L5V A;  1IMD A;  1URD A;  5KCJ A;  4H0W A;  2A5T B;  2EPM X;  4BCA A;  4F29 A;  2YTE A;  1LBY A;  1ZTY A;  5AC5 A;  5IAI A;  1M5B A;  4BDO A;  1P99 A;  2ZNU A;  2EOY A;  4TLM B;  4WEP A;  3TUS A;  2PFY A;  1HSE A;  3UN6 A;  2KQZ A;  5A5X B;  2LBS B;  4PGN A;  3CFX A;  5J16 A;  1ZLQ A;  5TP9 B;  4R6Y A;  1IIW A;  1N0T A;  4PET A;  2EOR A;  2XXT A;  4GWW A;  2XXX A;  5I58 B;  1LAG E;  3TPA A;  3BBG A;  1XS5 A;  2EPK X;  5FHN A;  4Q30 B;  4QBA A;  1B58 A;  1X47 A;  1BLF A;  3GXA A;  4MCO A;  2YJP A;  4Q35 B;  3JZJ A;  4G2Z A;  2F7C A;  4R74 A;  2I3W A;  4GBV A;  3OEN A;  4M0V A;  4M4G A;  3KBZ A;  2K7I A;  4GLI A;  1Y4T A;  5AA4 A;  1PEB A;  3MPK A;  1NV4 A;  1TFA A;  3VLW A;  4OVS A;  4BS9 A;  3MZB A;  1A1G A;  1ZR9 A;  3U72 A;  3BF2 A;  3GBA A;  4R2F A;  4OEV A;  2L6M A;  3EQ1 A;  2EM0 A;  3RYD A;  4GEQ B;  4MNP A;  2ALU A;  1MH4 A;  1KZ8 A;  4H65 A;  1P1O A;  3I5O A;  4LQ2 A;  3T66 A;  2CZH A;  1A7L A;  4GOT A;  2GH9 A;  2LVH A;  2L2N A;  2KR0 A;  2WBT A;  3MP1 A;  3DM0 A;  2VD3 A;  2PVU A;  3G3H A;  3FVK A;  1JW5 A;  1RQ0 A;  3M99 B;  1FPL A;  3K6U A;  3RT8 A;  1Z1B A;  4BDR A;  3N94 A;  5ET7 A;  2H36 X;  1JEU A;  3ILT B;  1XNQ E;  1FPJ A;  2UXC E;  1TT1 A;  4X9J A;  3K6X A;  1SPI A;  3O2A A;  1DPP A;  1DTZ A;  1NUX A;  4RPN A;  4OQO A;  3RT6 B;  3LR1 A;  5FLX C;  3MVY A;  4RJZ A;  1HNW E;  2MKN A;  1NNP A;  4DCX A;  2EN2 A;  1MG1 A;  3FXQ A;  3Q25 A;  4P0I A;  3FXU A;  2L33 A;  4WED A;  4KQP A;  1O64 A;  4ZE8 A;  2M9A A;  4C1T A;  2V4C A;  3T93 B;  5KL4 A;  1P1Q A;  2B3F A;  1EZO A;  4EUO A;  4QSE A;  5FTI A;  4F3G A;  3JYR A;  4NHB A;  2JY9 A;  2FV4 B;  5EQ8 A;  1FJ9 A;  3T96 B;  2EPO A;  1FBF A;  3O6G A;  2B4L A;  1RDX A;  3T1B A;  4MLV A;  2R8T A;  1Y1Z A;  1N33 E;  4YKI A;  4RH8 A;  1SW2 A;  2XWO A;  4LA9 A;  1OQH A;  3CG3 A;  3F11 A;  2IEE A;  1X3C A;  2OBG A;  1PBP A;  3H6T A;  2Y7P A;  1ELJ A;  5CC2 A;  3HHF A;  4KYE A;  2R9J A;  3K1N A;  2K4V A;  4KD5 A;  1IMA A;  4EDP A;  2VPO A;  2HGH A;  4RHB B;  1NMU A;  1QUI A;  2F6P A;  2WYK A;  1N84 A;  3KZZ A;  5IM2 A;  2WBD A;  1BK4 A;  5T6J A;  1FPE A;  5TP9 A;  4H5G A;  2I0C A;  2MKZ A;  3VYX A;  2V3U A;  1L5T A;  4OEN A;  4O43 A;  2F3B A;  1N36 E;  3U92 A;  1LBW A;  3SEU A;  4DZ1 A;  4WKM A;  4JXI A;  1NV1 A;  2QS2 A;  1B0H A;  1ZBT A;  2I4C A;  1MXV A;  4JVI A;  4DV3 E;  5H8Q B;  4AB5 A;  3LML A;  3CHG A;  3SEX A;  4E0W A;  3HO7 A;  4BLA A;  3MVX A;  2F7B A;  4R8O A;  2Y5L A;  2OWS A;  2DIX A;  2UUC E;  4P1E A;  5IV8 B;  4Q5T A;  1AL3 A;  1FW0 A;  2MC5 A;  1S50 A;  2E0S A;  2ZYM A;  2EPA A;  3KN8 A;  2VOZ A;  4YY3 E;  1IBK E;  4QXD A;  1YZ9 A;  2EM8 A;  3PU5 A;  2WBU A;  3RPL B;  5T3J A;  1P47 A;  3H09 A;  4GWX A;  5EQ7 A;  1KJK A;  1T39 A;  2FTX B;  1WHQ A;  2XA5 A;  1VFD A;  1JW1 A;  4DV5 E;  3GLB A;  2A5S A;  5EYF A;  2EM2 A;  5JEI A;  3HPS A;  5IT9 C;  4LZ8 A;  3FV1 A;  2EN4 A;  5DVF A;  2WKY A;  2VRD A;  4YU0 A;  3W15 C;  4F2O A;  4PAI A;  3ADJ A;  1RDY A;  3AV0 A;  2JWO A;  4X1D A;  1B5H A;  2DRP A;  4IY5 A;  1US4 A;  4N81 A;  2I13 A;  3ECR A;  4NGU A;  1FBE A;  3S9L C;  4NF6 A;  4NF8 A;  1QJM A;  4U2R A;  1LFH A;  4ZYD A;  1G2F C;  2EM5 A;  2M8C A;  5JK4 A;  1IMU A;  4IO3 A;  2KHX A;  4AQ4 A;  4BDQ A;  4R9F A;  4O3C A;  4GKJ E;  5KL7 A;  4WYQ B;  1XVX A;  3T9X B;  1IQO A;  2W7Y A;  4JVD A;  4MF3 A;  2FIE A;  3FVO A;  3CSB A;  3JV9 A;  2ZMB A;  4P78 A;  4MHF A;  4ZEF A;  2RC7 A;  2ONK E;  4FEC A;  5KL3 A;  4JI6 E;  4ZEC A;  5I59 A;  1EKZ A;  4LF6 E;  4OTE A;  3Q29 A;  5LMU E;  2DWA A;  4PFB A;  4ZS9 A;  4K3F A;  4B3M E;  3HQ1 A;  3IB1 A;  2DYX A;  4PTK A;  2OCU A;  3RNN A;  1AWB A;  3ZOQ B;  1MH3 A;  3PMW A;  3OOA A;  1POT A;  3HHG A;  4HW8 A;  3BBR A;  1MY1 A;  1ZMG A;  3SZP A;  3SES A;  4R03 A;  2HPG A;  1A55 A;  3SEW A;  2QVV A;  1Z7N E;  3W9V A;  2XXR A;  3KZY A;  3R6U A;  5A6A A;  3M3L A;  1B69 A;  4OZ9 A;  3MHS C;  2YRM A;  2I3V A;  3RPL A;  2ENH A;  4PFU A;  3UGW A;  4XKR A;  3QK6 A;  4KYD A;  1I6A A;  3L00 A;  2EMC A;  2MKD A;  1B1H A;  2B65 A;  4QFP A;  3S9N C;  2XWV A;  3TOD A;  2OK2 A;  3OEK A;  4DR7 E;  2RQL A;  3C31 A;  4O7I A;  3HN0 A;  5B7D A;  1B51 A;  2DWJ A;  4MBP A;  4IO5 A;  3CSG A;  4HS7 A;  4R75 A;  4M1V A;  2QFL A;  4F9A B;  1A99 A;  2VT5 A;  1BBO A;  1POY 1;  3O66 A;  5ISU A;  2EOI A;  3S9E A;  3OD7 A;  4OET A;  1GZ6 A;  3FVN A;  4RK2 A;  5DNY A;  1MQG A;  3FJ7 A;  4GBW A;  2HAU A;  4F2Q A;  1IQ7 A;  2L92 A;  1CB6 A;  2ZNS A;  3B7D A;  4Z0I A;  5LTC A;  2EE8 A;  2O7I A;  1NNT A;  1IEJ A;  2YTP A;  4NHR A;  2D5W A;  3IX1 A;  4OFJ A;  2EN6 A;  4EF1 A;  1USY H;  2YU5 A;  3K1P A;  2QPQ A;  3H3G A;  2ABH A;  5CMC A;  4EXL A;  4LF8 E;  4E0X A;  5CFF E;  3FV2 A;  1LLM C;  4YKJ A;  4WSP A;  2WBB A;  1VDW A;  3L6G A;  3VXB A;  4F3B A;  4FAT A;  3G3I A;  4BHB A;  1PB7 A;  3ROJ A;  2VQF E;  3MC2 A;  2F4V E;  1MY4 A;  3KEI A;  3LBS A;  4NG7 A;  3BIH A;  2LMZ A;  2JP9 A;  3BIG A;  1I6B A;  3KC0 A;  1JET A;  2F8B A;  1A54 A;  4LTY A;  4PGP A;  3KG2 A;  3V5A A;  2UYF A;  2Y7I A;  2DLK A;  1UIV A;  3VDF A;  2V3Q A;  1FBG A;  4GFR A;  1FTK A;  4U21 A;  1INP A;  1A8E A;  1YAE A;  1B9J A;  1N04 A;  3M8U A;  1OVT A;  3TZA A;  3H6U A;  5H8S A;  3MVW A;  4PBQ A;  1YYO A;  1DSN A;  4LUB A;  4Q0C A;  5A5L A;  4LP2 B;  4F39 A;  4ZYH A;  2XX9 A;  5EYG A;  4FEB A;  4P9K A;  4MIJ A;  4P0G A;  4H5F A;  4MLQ A;  1NFT A;  1MPC A;  4WXJ A;  3PPO A;  1LCT A;  2FIX A;  2F7A A;  4BMJ A;  4YKP A;  4JI4 E;  2QS3 A;  5CI5 A;  4GWO A;  2GHA A;  2NA2 A;  4R2S A;  5EQA A;  4Q28 A;  2NUG A;  5I3S A;  3C6K A;  2EPC A;  3F6G A;  5DEX A;  2HEU A;  1DQ3 A;  4N4R B;  4MNC A;  3TFL A;  4F54 A;  3MYU A;  2EM6 A;  4QHQ A;  4PFW A;  4ELO A;  4PFR A;  2M7Q A;  2LAO A;  1IXG A;  3LSL A;  1DOT A;  1SDX A;  4EQ9 A;  2V83 A;  1N3W A;  3VK6 A;  3TTK A;  1QVS A;  2NUV A;  4IO2 A;  4OVR A;  4DI4 B;  4WX9 A;  2X26 A;  2NOO A;  4EXK A;  1OLA A;  4NWD A;  1B3L A;  3MHH C;  4F1Y A;  1LEV A;  3LSF B;  1FQB A;  4R2D A;  5ELV A;  3RTW B;  2O84 X;  5JTY A;  3OEM A;  2Q88 A;  1BBG A;  2UXA A;  3THN A;  3VLV A;  3DP6 A;  4HTG A;  3Q26 A;  4PE5 B;  1B46 A;  4DUZ E;  4X48 A;  4XKP A;  2Y7R A;  3O9P A;  1D4N A;  3K4U A;  1KWH A;  4OVQ A;  5I5P A;  2YTG A;  2JYA A;  3EHU A;  4JYA E;  3UIF A;  2XXV A;  5ICQ A;  4X65 E;  4DR6 E;  2YT4 A;  2PT2 A;  3MQ9 A;  1EH7 A;  3TTL A;  5EYH A;  4U4X A;  4DE8 A;  3C32 A;  3K02 A;  4ELP A;  5CBR A;  1Y3N A;  1FBP A;  4PDD A;  3DP8 A;  4EQ7 A;  1FTL A;  2CSH A;  2EMG A;  1N7X A;  3IO4 A;  3K6Q A;  2CTD A;  4P3L A;  2Y5K A;  4LF5 E;  1FPD A;  4N17 A;  2B9D A;  3HST A;  2ESN A;  4IJD A;  1LLS A;  1N32 E;  4LF7 E;  4EQB A;  1URS A;  4IY6 A;  2Q8M A;  4ELR A;  3K0V A;  3RY3 A;  5B70 A;  1NH7 A;  4RPO A;  4QFK A;  3U93 A;  3ADI A;  1SI0 A;  5A6J A;  4F3S A;  4BC7 A;  3TCH A;  4P47 A;  3ZKK A;  1NV5 A;  2IHR 1;  1IME A;  3RTF B;  3TEP A;  3D4C A;  1B3H A;  4DUY E;  4O24 A;  2DOJ A;  1B5I A;  4GWZ A;  3Q27 A;  4OES A;  3UK4 A;  3QUJ A;  2EPN A;  5FTH A;  3U8Q A;  1FPF A;  1J26 A;  1YYW A;  1FQF A;  2F78 A;  2O69 A;  3GYY A;  3OSQ A;  2Q74 A;  3JAM C;  3C4T A;  1I94 E;  1YYZ A;  2LTS A;  2X7P A;  4R2C A;  3FXR A;  4ZE9 A;  1SVX B;  5K2Y A;  5ESY A;  2ELY A;  3M3F A;  5IXM B;  1T38 A;  1USY E;  2UXB E;  2NWJ A;  2XD2 A;  2ONS A;  4O8M A;  2UU9 E;  1H45 A;  5DTB A;  3T22 A;  2HXW A;  3AXF A;  3TYH A;  3FVG A;  4B3S E;  1F2I G;  4BBY A;  4U1Z A;  1AOV A;  4FE8 A;  4O3B A;  1LFI A;  4N6P A;  1KYQ A;  1EYJ A;  2XHD A;  2R76 A;  1XNR E;  3N6U A;  4HE2 A;  2E1S A;  1Y3P A;  3MWB A;  4DV1 E;  3FZV A;  4BDM A;  4F9B B;  1PJT A;  5AE4 A;  4PFI A;  5LDZ A;  2LUQ A;  2QMW A;  4LN5 A;  5I56 A;  4GWS A;  1ZIU A;  5DVI A;  1X48 A;  2V8Q B;  3LUY A;  1MPD A;  1OIB A;  1A1L A;  1F9B A;  3KBR A;  3FJM A;  3KN7 A;  3PUZ E;  4RA1 A;  1Y3Q A;  4LON B;  3C34 A;  4NF5 A;  3MJN A;  2Z8E A;  1QGX A;  2N3H A;  2RSI A;  2WEF A;  3P1X A;  4OER A;  3IB2 A;  3KGC A;  1YSA C;  2DSF A;  1QU6 A;  1GTK A;  2VE7 C;  2ZZX A;  2HCA A;  2EN7 A;  5KL2 A;  1EH6 A;  1SD3 A;  4ISU A;  1ZKB A;  4I40 A;  5H8H B;  3V89 B;  2KON A;  3E4R A;  1SQY A;  1PB8 A;  4I9D A;  5L9O A;  3D1R A;  2RS7 A;  2HFB A;  4GL8 A;  4OX9 E;  1EH8 A;  1DBZ A;  2RIN A;  4R6K A;  1LCF A;  2XXU A;  2R6G E;  2VHA A;  2PT1 A;  3IL1 B;  3IOW A;  1JQF A;  5TPA A;  4GF8 A;  4BHC A;  1IMB A;  1OQG A;  1SI1 A;  1Y1M A;  1EU8 A;  3D4G A;  1SR9 A;  2V85 A;  2ZM6 E;  3U65 A;  2JPA A;  2ONR A;  2EL4 A;  2ADR A;  2EN1 A;  1MPB A;  2VP1 A;  1NV6 A;  4TUI A;  3HFU A;  4OAN A;  3S4U A;  1FPI A;  4OMB A;  1FTJ A;  3BFU A;  2Z8F A;  2EPX A;  3IWB A;  4JI2 E;  3SET A;  4HE1 A;  2PYY A;  4GX6 A;  1SW4 A;  1FJ6 A;  1JK1 A;  5I2K A;  3G3J A;  3OO7 A;  2ZXT A;  3FIR A;  2X7Q A;  3TCF A;  4DV6 E;  4GWY A;  3TEL A;  2QRY A;  4O5G A;  3OO6 A;  4XKN A;  5DYH A;  1GGG A;  1B40 A;  4QSC A;  2OJT A;  1UQW A;  1PJQ A;  1X6H A;  1QKA A;  2EOX A;  2RSM A;  3QUF A;  3U94 A;  3OO8 A;  4F19 A;  4OXV A;  4AQY E;  2DDK A;  1X6E A;  4GX3 A;  3V8X B;  1K9Z A;  1UIL A;  5FHM A;  2DXY A;  3ZSF A;  2KOU A;  2XWK A;  1FPG A;  1TF3 A;  3T1H E;  2AL5 A;  4ELQ A;  5IZ1 A;  3O28 A;  3P7I A;  3LV0 A;  1FSA A;  2PRT A;  1MXW A;  2UYE A;  4NF4 A;  5CMK A;  2EML A;  1IXC A;  4ONY A;  1R6Z A;  2RCB A;  2I48 A;  1TXF A;  5IWA E;  1IMF A;  1PC3 A;  4N6D A;  5DW8 A;  5H8N B;  1IXH A;  4F6N A;  2QSX A;  2DXR A;  4PBH A;  2XXH A;  5AAS A;  2ZZW A;  4RYA A;  1WJP A;  2RCA A;  5ET6 A;  1WOD A;  2EN3 A;  2H5Y A;  1YXI A;  2P2A A;  2EOS A;  2V25 A;  3MVZ A;  3VXC A;  4N8Y A;  5CMM A;  3A3C A;  5LLQ A;  1B3F A;  4P8B A;  4UA8 A;  3T0J A;  2DWI A;  4F2J C;  3EKI A;  1HSJ A;  2EOF A;  2B7V A;  2YWQ A;  1MQD A;  1NNF A;  1SYI A;  1EZ9 A;  4JSO A;  2CT1 A;  4GKK E;  2M1S A;  4R6H A;  1R9L A;  4FAJ A;  2AYS A;  5I59 B;  2XWI A;  4I1D A;  4DR2 E;  1FBH A;  1GV8 A;  1OLC A;  4R2R A;  3IOT A;  2ZYK A;  3QAX A;  2VD2 A;  3EN3 A;  4DXC A;  2OX3 A;  1LB9 A;  4KYS A;  4O7M A;  2WBS A;  3AUZ A;  1M5E A;  2IA4 A;  4ZYE A;  4PFY A;  1X49 A;  2MDR A;  4ZZA A;  1JK2 A;  3S2V A;  2JVA A;  4ECF A;  4NMY A;  3KJ7 A;  4NED A;  3TTN A;  2A5T A;  4R2E A;  2I9I A;  2AIX A;  1D9V A;  2DLQ A;  1J1N A;  2EN8 A;  1MM7 A;  1FQA A;  3T9V A;  1IIT A;  2YTF A;  2M4I A;  2CZK A;  1LBB A;  2DVC A;  2EMY A;  1WHN A;  2P1S A;  2FNC A;  5ITP A;  2XXQ A;  3VVF A;  5I7I A;  3EPE A;  4YKK A;  4N6K A;  1VE4 A;  4H6D A;  4NF6 B;  3LUZ A;  4H46 A;  3PPQ A;  1NNK A;  4M2Z A;  4NF4 B;  3J80 C;  4JV5 E;  1T4O A;  2R71 A;  5L9M A;  4TOZ A;  1GR2 A;  4G8M A;  1XC1 A;  1NUZ A;  2EPP A;  4GVO A;  3VLU A;  3EPH A;  4X66 E;  2O1L A;  4HCW A;  4HEI A;  3T1Y E;  3KOS A;  1WRJ A;  2DMY A;  1I69 A;  3FBP A;  3MAM A;  4G4P A;  1XMO E;  3C33 A;  1UTH A;  1IBM E;  4PF6 A;  1WDN A;  4KR5 A;  5LOM A;  1T4L B;  3K6V A;  4GWU A;  3A29 A;  2OZZ A;  1YFH A;  4JI8 E;  3IK6 B;  3I3V A;  5IZ3 B;  1HR0 E;  1YUJ A;  2DVZ A;  3VFJ A;  2G93 A;  5F7V A;  3K1M A;  4LFC E;  3VV5 A;  1UHZ A;  3MZ9 A;  4KPT A;  4WFT A;  1NKX A;  4MNI A;  3MST A;  3I6V A;  1QUJ A;  1ZJL A;  1O7T A;  4I8C A;  3QXM A;  3OTO E;  3ONM A;  3GZG A;  4OWD A;  5EQ9 A;  1VR5 A;  2HHH E;  2B3T B;  4N8G A;  5I57 B;  2BJJ X;  4ZZE A;  1AH5 A;  4PAK A;  4KHP E;  4TQU Q;  5AA2 A;  1URG A;  2HJJ A;  1MRP A;  2BJI A;  4NQ8 A;  3R7X A;  4JWY A;  2QS1 A;  4IGT A;  3ILU B;  1L4S A;  1FKA E;  2OWZ A;  1H44 A;  1TF6 A;  4JI7 E;  5TU0 A;  2L3C A;  4GX4 A;  3B6T A;  1ATG A;  2EMA A;  2V3T A;  3IR1 A;  4MAG A;  4NZV A;  3N5L A;  2R1F A;  4JI5 E;  2ZYN A;  4YAH X;  4PE3 A;  4OFL A;  5H8F A;  4ZEI A;  1S7Y A;  3B8B A;  4KCC A;  2Y7K A;  3HV1 A;  3LC8 A;  1T4N A;  3DF6 A;  3PD9 A;  4N07 A;  1IXI A;  4R9G A;  1XVY A;  2CEY A;  2N8X A;  2JOB A;  4FIM A;  1UTB B;  1NV3 A;  2EPL X;  1HSL A;  1Z7M E;  4XF5 A;  3TCG A;  2UVJ A;  2YTD A;  1IBL E;  2V89 A;  5JTY B;  2XXK A;  1MDP 1;  2DP8 A;  1DTG A;  3H03 A;  4GD5 A;  4O94 A;  5F24 A;  1PBQ A;  3VVD A;  2B3B A;  2YU8 A;  3PGF A;  2V88 A;  1YCJ A;  5I2N A;  2FBP A;  5M2V A;  3TTM A;  5KZT A;  4IR8 A;  5IKB A;  2V86 A;  4YB7 A;  1YZ0 A;  3HPZ A;  3U1O A;  2OWT A;  4GL0 A;  1UTH B;  2Y84 A;  4AS5 A;  4IB2 A;  4P56 A;  3SER A;  2A25 A;  2XXI A;  2B4M A;  4NF5 B;  2EWL A;  4KXP A;  2ENC A;  1LBV A;  2LE2 A;  2LTR A;  2H4I A;  1D9Y A;  1FTA A;  1AAY A;  4KHZ E;  4FED A;  4KWY A;  3H6W A;  4NXN E;  4XXU A;  5AE3 A;  2HZK A;  1NL5 A;  3C35 A;  4JBZ A;  3IFA A;  2EL6 A;  2CPN A;  1NV2 A;  3KSX A;  1IMC A;  3DP4 A;  4OVT A;  5K2X A;  2XXY A;  3MSW A;  3G3K A;  2N3G A;  1JEV A;  2EM7 A;  1LST A;  4ESW A;  1XOC A;  3KSJ A;  3QSL A;  4NX1 A;  2LUP B;  1RMD A;  2L2K B;  4LZ5 A;  3JU0 A;  3EPK A;  4PFT A;  2EMF A;  3WAE A;  3BID A;  3R26 A;  4N4U A;  2EM9 A;  3CVG A;  4POX A;  2V87 A;  4JWO A;  3EPL A;  1B5J A;  2Z23 A;  3ISP A;  1FTM A;  3EHT A;  4X04 A;  4POW A;  1JNF A;  1FBD A;  3O29 A;  2FHY A;  1US5 A;  2LV2 A;  2FGG A;  2YRK A;  5CRY A;  4DIG A;  4B3T E;  4R73 A;  2DSY A;  1B05 A;  1FQE A;  3EF7 A;  2Z8D A;  2THI A;  4LF4 E;  1RDZ A;  4G61 A;  2FVZ A;  1LAH E;  4FBP A;  1JVY A;  4NN3 A;  3RLF E;  2HZL A;  5ET8 A;  3H6V A;  1MY0 A;  4WSG A;  3KZG A;  3PTY A;  4QFL A;  4GZN C;  3SDF A;  5FBP A;  3VYY A;  1YTV A;  3DEL B;  2EMZ A;  3E78 A;  4M30 A;  2Q2C A;  4AS4 A;  3N6T A;  4GXS B;  3HPI A;  2DE2 A;  2PBW A;  2EPR A;  4DMI A;  2GQ1 A;  4G77 A;  2PX1 A;  1DPE A;  1H76 A;  2O68 A;  2I0B A;  3MPL A;  1SFE A;  5KCJ B;  4GRK A;  3IFC A;  3HTX A;  4LZ7 A;  2FYI A;  1D9Q A;  5DEX B;  2F8D A;  4F31 B;  1B2H A;  3SKP A;  4YIC A;  3Q28 A;  3IOR A;  1A1K A;  4C1U A;  5AA2 D;  4IO7 A;  2UUB E;  1A1I A;  2MC6 A;  4PAF A;  2EZ6 A;  2D21 A;  5J1D A;  2RS6 A;  4FK5 C;  4YMB A;  2I4B A;  3PUX E;  1MXX A;  2EMW A;  2V84 A;  4IS1 C;  4YZZ A;  4F18 A;  5EHS A;  1XT8 A;  4F3P A;  1A1J A;  1M5C A;  4JI3 E;  4F9C B;  4JB7 A;  3NOH A;  3ZS6 A;  1SYH A;  4HXV A;  4YB6 A;  2WCC 3;  1M5D A;  2H98 A;  2LJH A;  1DK4 A;  2VGQ A;  5EHM A;  4XTC Q;  2YSO A;  3SEV A;  3TDJ A;  1G0H A;  2BBG A;  2YRH A;  2G7H A;  3FD3 A;  2NAB A;  3KJT A;  4MEV A;  5AE2 A;  4DR5 E;  2ZYO A;  3RQT A;  1B4H A;  3OSR A;  1S9T A;  1MY2 A;  2REJ A;  5HM4 B;  4U23 A;  4WXD A;  1DGC A;  4J8Z A;  4ZEB A;  4G8H A;  4KZS A;  4PC9 A;  2L8T A;  4NWC A;  3V83 A;  1B7H A;  1B7U A;  3E79 A;  1ZBQ A;  3BFT A;  2F3D A;  1X6F A;  4L8N A;  3TAJ A;  5A6B A;  5A2Q C;  3IJO B;  2EOZ A;  5TSE A;  1WVJ A;  4XEQ A;  5ET5 A;  4EF2 A;  3CI8 A;  2VQE E;  2VPN A;  1ZU1 A;  2DB2 A;  2LCE A;  4TLL B;  4Z7E A;  3DJW A;  2LJU A;  1LBC A;  4FOR A;  2Q89 A;  1YUI A;  1SBP A;  2GHB A;  3FGS A;  4PCD A;  5I84 A;  3IOU A;  4ZED A;  1LB8 A;  1FQD A;  3B6Q A;  2HC5 A;  3HXL A;  2NUF A;  2Q8U A;  1Y4C A;  3W9W A;  2EL5 A;  3L6H A;  2F35 A;  4RNS A;  1YPN A;  3J7Y p;  1OVB A;  3O6H A;  5AA2 B;  4RY1 A;  2YSP A;  1SW5 A;  2HXR A;  3G3G A;  2QMX A;  2ZZV A;  2WX9 A;  4OEU A;  2EM4 A;  3MZ1 A;  4BDN A;  3THI A;  1B3G A;  4YHH E;  1SW1 A;  5CMB A;  3QG5 C;  2HQ0 A;  1R1N A;  2O6A A;  3IJX B;  5A69 A;  4QFN A;  5KL5 A;  1JW4 A;  3B50 A;  1TFD A;  3OMB A;  3QYT A;  3RN8 A;  1Y9U A;  2Q9T A;  2DS9 A;  4O4K A;  1IZ1 A;  1G2D C;  1LFG A;  4DLD A;  4NF8 B;  3GBB A;  2PFZ A;  4HE0 A;  4LU9 A;  2H25 A;  3TKD A;  2PCR A;  5DT6 A;  2YTJ A;  3FUZ A;  1I6Q A;  2PMS A;  1K9Y A;  4X9T A;  2I6E A;  3G7W A;  1B4Z A;  3C4M A;  4OHN A;  3TQL A;  4LFA E;  4JVC A;  5I58 A;  4DR3 E;  2EPZ A;  1EYI A;  4X8W A;  2RTX A;  2WZO A;  5BWJ A;  1PJS A;  5H8F B;  2BB8 A;  3H4Z A;  4N15 A;  3M3K A;  4P11 A;  1DCU A;  3TTR A;  2EMK A;  2UXD E;  2E1M A;  4XIG Q;  4MJO A;  2EOQ A;  1QUL A;  4DXB A;  1MXY A;  1PB9 A;  2FA7 A;  5KDT B;  4WXC A;  1N3X A;  4DV2 E;  4DR4 E;  4R2Q A;  1TN9 A;  1UN6 B;  3RMP A;  2L2M A;  3WAF A;  1DI2 A;  2DWH A;  4GIZ A;  3SEY A;  2ELZ A;  1BP5 A;  1LGB C;  4C0R A;  3LSX A;  2YTN A;  4JWX A;  3THO B;  1PKP A;  5LMN E;  5KL6 A;  1STU A;  2GPI A;  3TQW A;  3IOV A;  3ZKL A;  2XX8 A;  1MQH A;  3PV0 E;  1FBC A;  1II5 A;  1B6H A;  4QSD A;  1R9Q A;  3IB0 A;  3EPJ A;  2GFE A;  2P3V A;  1EH3 A;  2O1M A;  1Y20 A;  5IGA A;  2F34 A;  2XXW A;  2YLN A;  3O6I A;  4MFI A;  5AA3 A;  1B1X A;  3OO9 A;  1IQS A;  5A6B D;  2NUE A;  4WPY A;  2Z22 A;  4G8N A;  4I3Y A;  4N91 A;  1TWY A;  2EJ4 A;  3KN3 A;  2RPC A;  4ND9 A;  4RK9 A;  4I62 A;  1RYX A;  2O7U A;  3USD A;  2I58 A;  3K2D A;  5L8D A;  1A1H A;  4GQO A;  4G68 A;  1Q35 A;  2QJE A;  2RC8 A;  4X62 E;  2CMO A;  5I56 B;  4BDL A;  4P7D A;  1P1U A;  3KC1 A;  2ODR C;  1VSO A;  1N34 E;  3C36 A;  4I8O A;  1FQC A;  4U22 A;  2LO3 A;  1ANF A;  4DV0 E;  5BUU A;  2DGC A;  1NUY A;  4H8I A;  5I2K B;  2JOX A;  3MW0 A;  4R72 A;  3A3U A;  1XMQ E;  2HHM A;  2NVU B;  1M5F A;  1MY3 A;  1A8F A;  1MDQ A;  3FXB A;  3UK3 C;  4X1B A;  3PUW E;  2EMX A;  3TMG A;  2VF1 A;  3BGH A;  3CIJ A;  4OFO A;  2EMB A;  1VFE A;  1MQI A;  2EMH A;  2G29 A;  2EQ3 A;  3H7M A;  2Q2A A;  2WYP A;  1PDA A;  1BTJ A;  2D3I A;  3HCQ A;  1FPB A;  1HNZ E;  4JSD A;  4ZEK A;  4I3E A;  4XFE A;  1NV0 A;  3KFM A;  4DI3 D;  1G0I A;  2ENA A;  2YTI A;  2QVR A;  5ITO A;  2NXO A;  2YZT A;  4N13 A;  4F22 A;  4IO4 A;  2RC9 A;  4DCY A;  1T0K A;  1QKB A;  1MXU A;  1N76 A;  1AIV A;  3KOT A;  4O3A A;  2DMI A;  4DV4 E;  3OEL A;  2B7T A;  4JI1 E;  1A1F A;  5H8Q A;  3IWD A;  2MDG A;  3K00 A;  1B3E A;  2I49 A;  3PUV E;  4Q8R A;  4OVJ A;  5KDT A;  3CR9 A;  4R2P A;  4LFB E;  1NI9 A;  1XHY A;  2F6G A;  2QVU A;  2V93 A;  5H8N A;  3VHT B;  3PMX A;  4IGR A;  4UAB A;  3UP9 A;  3CFL A;  5AE1 A;  4AB6 A;  2JR1 A;  2ANJ A;  4TUG A;  1LAX A;  4DKK A;  4H1X A;  3F6H A;  4DDD A;  3ADL A;  2F5X A;  4PDH A;  3VE1 B;  4DXU A;  3PD8 A;  2Q8J A;  2J7J A;  4KI0 E;  1H3D A;  2DQV A;  4H45 A;  1QNT A;  3MUQ A;  3QIM A;  1ZU0 A;  3G3F A;  2UVI A;  1MM6 A;  2REG A;  3E9X A;  3OXN A;  5CM6 A;  3K6W A;  1NH8 A;  3T9U A;  4ZYG A;  4DR1 E;  3VVE A;  2AL4 A;  3UOR A;  3N26 A;  2P3N A;  2EOH A;  1UIU A;  5DVJ A;  1UBD C;  4MX6 A;  1D3K A;  1Q9D A;  4OVP A;  4QRZ A;  1KA0 A;  4KCD A;  1N7W A;  4GXA A;  5AA4 B;  5BR8 E;  2O51 A;  1CNQ A;  2OLB A;  3T9H B;  2ODR D;  2KLF A;  5F3W A;  4M9V C;  1RC7 A;  5IZZ A;  2EP3 A;  1LBX A;  1KA1 A;  1UTB A;  4H8J A;  4LAT A;  1N3G A;  2ZNT A;  3E13 X;  3B6W A;  3FIG A;  4G68 B;  2EOE A;  2XD3 A;  4OYV A;  2EMI A;  2GLI A;  1B52 A;  1MXZ A;  4X64 E;  4ESX A;  3PPP A;  3RUM A;  3J7A G;  1CE2 A;  2F36 A;  2CZL A;  3E3K A;  3A09 A;  1AMF A;  1OMP A;  1GVC A;  3OML A;  2CEX A;  3UA8 A;  3ODB A;  5AC4 A;  2EOO A;  4NXM E;  4U4S A;  1MEY C;  2EOM A;  3PUY E;  5A6K A;  1FRP A;  2JJK A;  3QMF A;  2JXP A;  4P1L A;  3JTZ A;  2E5L E;  1GQE A;  5I2N B;  2EQ0 A;  2YPN A;  5FHO A;  4LQ5 A;  1MQJ A;  4B3R E;  1H43 A;  2YTQ A;  4RXL A;  1BIY A;  4JI0 E;  4R2B A;  4QFO A;  3CFZ A;  4OOG C;  1EYK A;  5H8H A;  2LT7 A;  2HAV A;  2XXP A;  5AA1 A;  4JDF A;  3CG1 A;  4XKQ A;  4YMA A;  3C6M A;  4IO6 A;  4NF0 A;  1QUK A;  3KWR A;  2RF1 A;  2UUA E;  2GRV A;  4LF9 E;  2F97 A;  2EM3 A;  2L3J A;  1YYK A;  3MBP A;  1XI6 A;  3EHS A;  4FJP A;  2H99 A;  3FAT A;  4THI A;  4YB5 A;  2LRS A;  4X8R A;  3RGY A;  2EQ1 A;  1FJG E;  4UAC A;  1X5W A;  5HPQ A;  5ADZ A;  2Y7W A;  1WXR A;  3S9M C; 
#chains in the Genus database with same CATH homology
 1P1W A;  2UYE A;  4NF4 A;  3TAJ A;  1RKM A;  5CMK A;  3IJO B;  2OK2 A;  1A40 A;  3OEK A;  3PPR A;  4G68 C;  1WVJ A;  2RKM A;  3IAZ A;  3MP6 A;  3C31 A;  4ZDM A;  3PPN A;  5TPA B;  4EF2 A;  3CI8 A;  1IXC A;  3HN0 A;  4ONY A;  5B7D A;  1B51 A;  1R6Z A;  4TLL B;  2RCB A;  3O97 A;  2I48 A;  2DWJ A;  2DE4 A;  4MBP A;  4IO5 A;  1FCK A;  1TXF A;  3CSG A;  3IO6 A;  4HS7 A;  4R75 A;  1LBC A;  4M1V A;  4FOR A;  2Q89 A;  1SBP A;  2GHB A;  3FGS A;  1PC3 A;  5H8N B;  5I84 A;  1A99 A;  1IXH A;  3BKI B;  2QSX A;  1POY 1;  2DXR A;  3IOU A;  3O66 A;  4ZED A;  5ISU A;  4YB5 A;  5ICT A;  3S9E A;  1LB8 A;  3OD7 A;  1ZBM A;  5I57 A;  4OET A;  2XXH A;  1FQD A;  1FTO A;  3B6Q A;  4RYA A;  4F1U A;  3FVN A;  2RCA A;  4RK2 A;  1WOD A;  1MQG A;  3FAS A;  1Y4C A;  3W9W A;  3FJ7 A;  1DMB A;  2H5Y A;  1MS7 A;  2HAU A;  3LSW A;  1BKA A;  4F2Q A;  2P2A A;  2F35 A;  3L6H A;  4RNS A;  1IQ7 A;  1YPN A;  1O63 A;  2V25 A;  2QS4 A;  1CB6 A;  2ZNS A;  3B7D A;  4Z0I A;  1OVB A;  2O7I A;  1NNT A;  1IEJ A;  3O6H A;  3MVZ A;  3PMV A;  2D5W A;  4RY1 A;  5CMM A;  3IX1 A;  3VXC A;  4LVQ A;  4OFJ A;  5AA2 B;  3A3C A;  4EF1 A;  1SW5 A;  1B3F A;  1USY H;  2QMX A;  3G3G A;  4HCY A;  4OEU A;  3K1P A;  2QPQ A;  3H3G A;  2ABH A;  5CMC A;  3MZ1 A;  4EXL A;  4E0X A;  4BDN A;  1IUD A;  3FV2 A;  4UA8 A;  3THI A;  1B3G A;  4YKJ A;  1SW1 A;  3MP8 A;  3C9H A;  2HQ0 A;  2QL3 A;  2DWI A;  1R1N A;  2O6A A;  3IJX B;  5CMB A;  4DXC A;  2UVH A;  4TLM B;  1HSJ A;  2DE3 A;  3L6G A;  3VXB A;  4F3B A;  1MQD A;  4OWD A;  4U1O A;  4FAT A;  4QFN A;  3G3I A;  1NNF A;  1PB7 A;  4L17 A;  1JVX A;  3K01 A;  1SYI A;  1EZ9 A;  4JSO A;  3H06 B;  4NTL A;  1JW4 A;  1TFD A;  3MC2 A;  3OMB A;  3QYT A;  4R6H A;  1R9L A;  3RN8 A;  3LBS A;  1MY4 A;  3KEI A;  1Y9U A;  4F1V A;  2Q9T A;  4FAJ A;  2AYS A;  1RYO A;  2DS9 A;  5I59 B;  1I6B A;  2XX7 A;  1IZ1 A;  1LAF E;  5F1Q A;  1JET A;  1QW0 A;  1A54 A;  4I1D A;  4NE4 A;  1LFG A;  1OLC A;  4KFQ A;  3IOT A;  1GV8 A;  2ZYK A;  1B0L A;  2VD2 A;  3QAX A;  4H67 A;  3CRB A;  3EN3 A;  3KG2 A;  2UYF A;  2Y7I A;  4PQJ A;  1LB9 A;  1P1N A;  4KYS A;  3RPW A;  1B32 A;  3V5A A;  4NF8 B;  1UIV A;  1M5E A;  2IA4 A;  4PFY A;  5L9S A;  4PP0 A;  4ZZA A;  3GBB A;  3S2V A;  3VDF A;  2P0S A;  4ECF A;  2V3Q A;  2H25 A;  4GFR A;  1Q1K A;  3TKD A;  1FTK A;  4NMY A;  4U21 A;  5DT6 A;  3KJ7 A;  4QF9 A;  1YAE A;  1A8E A;  4NED A;  1B9J A;  1B7Z A;  1N04 A;  2A5T A;  1I6Q A;  2AIX A;  2UVG A;  3FJG A;  3FUZ A;  3M8U A;  5HBC A;  1OVT A;  2PMS A;  1D9V A;  2H9B A;  3DLN A;  3TZA A;  1J1N A;  4MH5 A;  1MM7 A;  1FQA A;  3T9V A;  1IIT A;  4X9T A;  1LBB A;  2DVC A;  5CBS A;  3H6U A;  2I6E A;  4Z7E A;  1URD A;  1B4Z A;  2P1S A;  3G7W A;  3MVW A;  5H8S A;  3C4M A;  4OHN A;  2FNC A;  3TQL A;  1DSN A;  5ITP A;  4H0W A;  5KCJ A;  2XXQ A;  3VVF A;  5I58 A;  4LUB A;  2A5T B;  4Q0C A;  3EPE A;  4YKK A;  4F29 A;  1VE4 A;  4LP2 B;  1ZTY A;  4H6D A;  4NF6 B;  4F39 A;  2XX9 A;  5BWJ A;  4FEB A;  5H8F B;  3TUS A;  3H4Z A;  5IAI A;  4P0G A;  1M5B A;  3M3K A;  4MLQ A;  1P99 A;  2ZNU A;  1NFT A;  3PPQ A;  1MPC A;  4H5F A;  1NNK A;  4P11 A;  1HSE A;  3PPO A;  1LCT A;  4WEP A;  4WXJ A;  3UN6 A;  2F7A A;  4XIG Q;  4YKP A;  3CFX A;  1QUL A;  4DXB A;  5A5X B;  1MXY A;  1PB9 A;  2FA7 A;  4NF4 B;  2QS3 A;  5KDT B;  5CI5 A;  1N3X A;  2R71 A;  5L9M A;  4GWO A;  1ZLQ A;  2GHA A;  5TP9 B;  4R6Y A;  1IIW A;  1N0T A;  4PET A;  4TOZ A;  1GR2 A;  4G8M A;  1XC1 A;  3TTN A;  3WAF A;  4GIZ A;  2DWH A;  4GVO A;  3SEY A;  3VLU A;  2XXT A;  5A5X A;  2O1L A;  1BP5 A;  1LGB C;  1LAG E;  2XXX A;  3LSX A;  4HCW A;  4JWX A;  4C0R A;  5I58 B;  5DEX A;  3KOS A;  3TPA A;  2HEU A;  1I69 A;  1XS5 A;  3MAM A;  4G4P A;  3TFL A;  3TQW A;  5FHN A;  3IOV A;  4Q30 B;  3C33 A;  3ZKL A;  3U94 A;  2XX8 A;  4QHQ A;  1MQH A;  1UTH A;  4PFW A;  4ELO A;  1B58 A;  1BLF A;  3GXA A;  3PV0 E;  1WDN A;  4KR5 A;  2LAO A;  2YJP A;  1II5 A;  5LOM A;  1IXG A;  3LSL A;  1B6H A;  3JZJ A;  4G2Z A;  2F7C A;  1DOT A;  3K6V A;  4QSD A;  1SDX A;  4R74 A;  1R9Q A;  2I3W A;  1N3W A;  3IB0 A;  4EQ9 A;  2OZZ A;  3OEN A;  3TTR A;  1QVS A;  2NUV A;  2GFE A;  3I3V A;  3IK6 B;  4IO2 A;  4M4G A;  2DVZ A;  4GLI A;  2X26 A;  2NOO A;  4EXK A;  1OLA A;  4NWD A;  1EH3 A;  2O1M A;  1B3L A;  1Y20 A;  3VFJ A;  1Y4T A;  5AA4 A;  4F1Y A;  1PEB A;  1FQB A;  2F34 A;  3LSF B;  2G93 A;  2O84 X;  3MPK A;  2XXW A;  5ELV A;  2YLN A;  3O6I A;  4MFI A;  3K1M A;  3OEM A;  5F7V A;  3VV5 A;  2Q88 A;  5AA3 A;  5JTY A;  1TFA A;  1B1X A;  3MZ9 A;  3OO9 A;  3MZB A;  4KPT A;  3VLW A;  2UXA A;  3U72 A;  1NKX A;  3GBA A;  4R2F A;  4OEV A;  3I6V A;  3VLV A;  1QUJ A;  3DP6 A;  1ZJL A;  2Z22 A;  4G8N A;  3EQ1 A;  4HTG A;  1O7T A;  3Q26 A;  2ALU A;  4PE5 B;  1TWY A;  1B46 A;  1MH4 A;  3KN3 A;  3QXM A;  4H65 A;  1P1O A;  4I8C A;  3ONM A;  3I5O A;  4ND9 A;  4X48 A;  4RK9 A;  3GZG A;  4XKP A;  2Y7R A;  4I62 A;  1VR5 A;  3O9P A;  1RYX A;  1D4N A;  2O7U A;  3K4U A;  4LQ2 A;  1A7L A;  4GOT A;  3T66 A;  2GH9 A;  2I58 A;  3K2D A;  3USD A;  1KWH A;  5L8D A;  5I57 B;  2BJJ X;  4ZZE A;  1AH5 A;  3EHU A;  4GQO A;  3MP1 A;  4TQU Q;  3UIF A;  1URG A;  2XXV A;  3DM0 A;  1MRP A;  4G68 A;  2VD3 A;  5AA2 A;  5ICQ A;  2PVU A;  3G3H A;  2PT2 A;  1Q35 A;  2QJE A;  3FVK A;  1JW5 A;  2RC8 A;  2CMO A;  3R7X A;  3MQ9 A;  2QS1 A;  4JWY A;  3K6U A;  3RT8 A;  4BDR A;  4BDL A;  3TTL A;  4EQB A;  5I56 B;  3N94 A;  4IGT A;  4U4X A;  1EZP A;  4DE8 A;  3ILU B;  1P1U A;  1JEU A;  3C32 A;  3ILT B;  3K02 A;  4ELP A;  5CBR A;  1H44 A;  1Y3N A;  1VSO A;  4EQ7 A;  3DP8 A;  1FTL A;  1TT1 A;  3K6X A;  3O2A A;  5TU0 A;  3C36 A;  1DPP A;  1N7X A;  3B6T A;  1DTZ A;  1ATG A;  4RPN A;  2V3T A;  3IO4 A;  3IR1 A;  4OQO A;  1FQC A;  4U22 A;  3N5L A;  3RT6 B;  1ANF A;  3LR1 A;  2ZYN A;  3MVY A;  4RJZ A;  4OFL A;  4YAH X;  4H8I A;  5I2K B;  4ZEI A;  5BUU A;  3RQT A;  1NNP A;  1S7Y A;  3HST A;  5H8F A;  4KCC A;  2Y7K A;  3HV1 A;  3MW0 A;  3LC8 A;  2ESN A;  4R72 A;  4DCX A;  3A3U A;  1LLS A;  1MG1 A;  3FXQ A;  3PD9 A;  3Q25 A;  3FXU A;  4N07 A;  1IXI A;  4P0I A;  1XVY A;  1URS A;  4KQP A;  4IY6 A;  4R9G A;  1O64 A;  2NVU B;  4ZE8 A;  4ELR A;  3K0V A;  1M5F A;  3RY3 A;  4C1T A;  5B70 A;  1NH7 A;  4FIM A;  4RPO A;  1MY3 A;  1UTB B;  1A8F A;  4QFK A;  3T93 B;  1MDQ A;  1P1Q A;  1HSL A;  1Z7M E;  2B3F A;  4WED A;  3U93 A;  1EZO A;  4X1B A;  1SI0 A;  3TCG A;  3PUW E;  4EUO A;  4QSE A;  2UVJ A;  3TMG A;  3CIJ A;  4OFO A;  5FTI A;  4F3G A;  1VFE A;  3JYR A;  4F3S A;  3TCH A;  5JTY B;  1MQI A;  2G29 A;  1MDP 1;  2DP8 A;  1DTG A;  3H03 A;  4GD5 A;  3T96 B;  3ZKK A;  1PBQ A;  3O6G A;  3VVD A;  3H7M A;  4MLV A;  2B3B A;  2Q2A A;  1Y1Z A;  1PDA A;  3D4C A;  3PGF A;  3RTF B;  3TEP A;  1B3H A;  1BTJ A;  1YCJ A;  4YKI A;  2DOJ A;  2D3I A;  1B5I A;  3HCQ A;  5I2N A;  1SW2 A;  3Q27 A;  4LA9 A;  5M2V A;  3TTM A;  1OQH A;  4OES A;  4JSD A;  3CG3 A;  3UK4 A;  5KZT A;  3QUJ A;  4ZEK A;  3F11 A;  5FTH A;  3U8Q A;  2IEE A;  5IKB A;  4YB7 A;  1FQF A;  2F78 A;  2OBG A;  2O69 A;  1PBP A;  3KFM A;  3U1O A;  3H6T A;  3VE1 B;  3OSQ A;  2OWT A;  4GL0 A;  1UTH B;  2Y7P A;  1ELJ A;  5CC2 A;  5ITO A;  3HHF A;  4KYE A;  2R9J A;  2Y84 A;  2NXO A;  4IB2 A;  3SER A;  4N13 A;  4F22 A;  3K1N A;  2XXI A;  4IO4 A;  4KD5 A;  2X7P A;  3FXR A;  2RC9 A;  4NF5 B;  1SVX B;  4DCY A;  4EDP A;  4ZE9 A;  1T0K A;  2H4I A;  1QKB A;  5K2Y A;  1NMU A;  1MXU A;  1QUI A;  1D9Y A;  2F6P A;  1N84 A;  1N76 A;  3M3F A;  4KHZ E;  4FED A;  3H6W A;  1USY E;  2NWJ A;  2XD2 A;  4BDO A;  1AIV A;  3KOT A;  2ONS A;  4XXU A;  5TP9 A;  4H5G A;  4O3A A;  4YMA A;  2HZK A;  2I0C A;  3OEL A;  1NL5 A;  2V3U A;  1H45 A;  5DTB A;  3C35 A;  3T22 A;  1L5T A;  2HXW A;  3AXF A;  4JBZ A;  4OEN A;  3FVG A;  3TYH A;  5H8Q A;  3KSX A;  3K00 A;  1B3E A;  3U92 A;  2I49 A;  3DP4 A;  3PUV E;  5K2X A;  2XXY A;  3G3K A;  4FE8 A;  4OVJ A;  4U1Z A;  3SEU A;  4DLD A;  4DZ1 A;  4O3B A;  4Q8R A;  4WKM A;  1LFI A;  4JXI A;  4N6P A;  5KDT A;  3CR9 A;  3V83 A;  1JEV A;  1XHY A;  1LST A;  2QS2 A;  2XHD A;  3N6U A;  4ESW A;  1B0H A;  2F6G A;  1XOC A;  2I4C A;  2E1S A;  3KSJ A;  1Y3P A;  3MWB A;  1MXV A;  3QSL A;  2V93 A;  3FZV A;  4BDM A;  5H8N A;  5H8Q B;  4AB5 A;  5AE4 A;  3PMX A;  4IGR A;  4LZ5 A;  2QMW A;  5I56 A;  3UP9 A;  3CFL A;  4PFT A;  1ZIU A;  4AB6 A;  2ANJ A;  5DVI A;  3SEX A;  3WAE A;  1LAX A;  4E0W A;  3HO7 A;  3R26 A;  4H1X A;  3LUY A;  4BLA A;  1MPD A;  1OIB A;  3CVG A;  4POX A;  4DDD A;  1F9B A;  3KBR A;  3MVX A;  2F7B A;  3FJM A;  4DXU A;  2F5X A;  3KN7 A;  3PUZ E;  2Z23 A;  1B5J A;  3PD8 A;  2OWS A;  1FTM A;  4JWO A;  3EHT A;  4RA1 A;  2Q8J A;  4POW A;  1Y3Q A;  4Q5T A;  1AL3 A;  1FW0 A;  1S50 A;  2E0S A;  3C34 A;  2ZYM A;  4LON B;  4NF5 A;  3MJN A;  4KI0 E;  1H3D A;  2DQV A;  1JNF A;  3KN8 A;  2VOZ A;  3O29 A;  1US5 A;  2Z8E A;  3MUQ A;  3QIM A;  1ZU0 A;  3G3F A;  5CRY A;  2UVI A;  4DIG A;  1MM6 A;  2REG A;  3E9X A;  3OXN A;  3PU5 A;  4OER A;  3IB2 A;  3KGC A;  2DSF A;  4R73 A;  5CM6 A;  3K6W A;  1NH8 A;  1GTK A;  3T9U A;  1B05 A;  1FQE A;  4ELQ A;  3EF7 A;  2HCA A;  2THI A;  2Z8D A;  3VVE A;  2AL4 A;  3UOR A;  1VFD A;  1SD3 A;  3N26 A;  1LAH E;  1UIU A;  4ISU A;  5DVJ A;  1JVY A;  1ZKB A;  1JW1 A;  3RLF E;  2HZL A;  1D3K A;  5H8H B;  3V89 B;  3E4R A;  3GLB A;  1SQY A;  1PB8 A;  4I9D A;  3H6V A;  1MY0 A;  3KZG A;  5L9O A;  4QFL A;  3SDF A;  2A5S A;  4QRZ A;  5EYF A;  2HFB A;  4GL8 A;  5JEI A;  1YTV A;  4KCD A;  3DEL B;  4LZ8 A;  1N7W A;  3FV1 A;  4GXA A;  2Q2C A;  5DVF A;  5AA4 B;  3N6T A;  2O51 A;  2RIN A;  2WKY A;  4GXS B;  4R6K A;  4YU0 A;  2OLB A;  3HPI A;  3T9H B;  1LCF A;  2XXU A;  2R6G E;  2VHA A;  3W15 C;  2PT1 A;  4F2O A;  3IL1 B;  2DE2 A;  3IOW A;  2KLF A;  1JQF A;  2PBW A;  5TPA A;  4G77 A;  4X1D A;  1B5H A;  2PX1 A;  1DPE A;  4GF8 A;  1H76 A;  2O68 A;  2I0B A;  4IY5 A;  1OQG A;  1SI1 A;  1Y1M A;  1US4 A;  3MPL A;  4GRK A;  1EU8 A;  5KCJ B;  3D4G A;  3ECR A;  4LZ7 A;  1UTB A;  4H8J A;  3S9L C;  2FYI A;  4LAT A;  4NF8 A;  4NF6 A;  2F8D A;  5DEX B;  4F31 B;  2ZNT A;  1B2H A;  3SKP A;  4YIC A;  1QJM A;  4U2R A;  3E13 X;  1LFH A;  3B6W A;  3Q28 A;  3IOR A;  2M8C A;  2ONR A;  4G68 B;  1MPB A;  5JK4 A;  2VP1 A;  4IO3 A;  4C1U A;  5AA2 D;  4IO7 A;  4AQ4 A;  2XD3 A;  4BDQ A;  4OYV A;  1B52 A;  4R9F A;  4O3C A;  3S4U A;  1MXZ A;  4ESX A;  3PPP A;  4OMB A;  1FTJ A;  1XVX A;  3RUM A;  3BFU A;  2D21 A;  2Z8F A;  3T9X B;  2W7Y A;  5J1D A;  1CE2 A;  2F36 A;  3SET A;  4MF3 A;  2CZL A;  3FVO A;  3E3K A;  3A09 A;  3CSB A;  1AMF A;  1OMP A;  3JV9 A;  4YMB A;  2I4B A;  2PYY A;  2ZMB A;  3PUX E;  1GVC A;  1MXX A;  4ZEF A;  3UA8 A;  2RC7 A;  2ONK E;  2V84 A;  3ODB A;  4FEC A;  4YZZ A;  4F18 A;  1SW4 A;  4U4S A;  5EHS A;  3RTW B;  1XT8 A;  4F3P A;  4ZEC A;  5I59 A;  3PUY E;  1M5C A;  5I2K A;  3G3J A;  4JB7 A;  4OTE A;  3OO7 A;  3ZS6 A;  1SYH A;  3Q29 A;  2DWA A;  2ZXT A;  3FIR A;  2X7Q A;  4K3F A;  4ZS9 A;  3TCF A;  4YB6 A;  3IB1 A;  1M5D A;  5I2N B;  2DYX A;  2YPN A;  2OCU A;  5FHO A;  2H98 A;  3RNN A;  3TEL A;  2QRY A;  3OO6 A;  4LQ5 A;  1MQJ A;  4XKN A;  2VGQ A;  5DYH A;  1GGG A;  1H43 A;  1B40 A;  4XTC Q;  4QSC A;  5EHM A;  3SEV A;  1MH3 A;  3TDJ A;  2OJT A;  3PMW A;  3TTK A;  1UQW A;  3OOA A;  1POT A;  4RXL A;  1BIY A;  3FD3 A;  3HHG A;  4HW8 A;  3BBR A;  3KJT A;  1MY1 A;  1QKA A;  1ZMG A;  3CFZ A;  4QFO A;  4R2B A;  5H8H A;  3SES A;  2ZYO A;  2HAV A;  1A55 A;  2XXP A;  1B4H A;  3CG1 A;  3QUF A;  4JDF A;  3OO8 A;  4XKQ A;  5AA1 A;  3OSR A;  4OXV A;  3SEW A;  1Z7N E;  1S9T A;  4IO6 A;  4F19 A;  1QUK A;  1MY2 A;  3W9V A;  2XXR A;  2REJ A;  2RF1 A;  5HM4 B;  3R6U A;  4U23 A;  2GRV A;  3M3L A;  3V8X B;  1AOV A;  2F97 A;  4OZ9 A;  5FHM A;  2DXY A;  2I3V A;  4ZEB A;  3ZSF A;  4G8H A;  4PFU A;  4NWC A;  3UGW A;  4XKR A;  3QK6 A;  2AL5 A;  3EHS A;  3MBP A;  1I6A A;  2H99 A;  1B7H A;  3FAT A;  4FJP A;  3O28 A;  4KYD A;  4THI A;  1B7U A;  3P7I A;  1B1H A;  4UAC A;  3RGY A;  2B65 A;  3BFT A;  4QFP A;  1MXW A;  3S9N C;  5HPQ A;  2Y7W A;  3S9M C;  3TOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...