4MLQA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
289
Chain Sequence
SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Porphobilinogen deaminase
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
total genus 95
structure length 289
sequence length 310
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlqA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlqA02
3KJTA 5IAIA 2RCAA 4ND9A 4WEPA 1SDXA 1LBCA 4GL0A 1GV8A 2DS9A 4PETA 3C9HA 3SKPA 3IK6B 3DELB 2I58A 2PT1A 5B7DA 3OO9A 1B32A 3WAEA 1FW0A 2H25A 5AA2D 1QJMA 1B1HA 3KN8A 4N13A 1S7YA 3V89B 4DXCA 1XT8A 4R73A 4IO4A 3VXBA 1VFDA 1XVYA 3HCQA 4OEVA 4EQ9A 2I0BA 1EZPA 4POXA 2HZKA 2V25A 5JTYA 3IX1A 1I6AA 3DP8A 3RNNA 1H44A 2PYYA 3MQ9A 2LAOA 3K4UA 4JSOA 3O6IA 1Y20A 3O6HA 1H45A 1I6QA 1UTBA 2DVZA 3TODA 1FTMA 2YLNA 2XXPA 5DEXB 4LQ5A 1JNFA 4FEDA 5TU0A 4DLDA 3BBRA 1EH3A 1WODA 4JB7A 5F1QA 1ELJA 4R6HA 2RC9A 4ELQA 2O6AA 2PMSA 1EZOA 1N7WA 3U1OA 5H8QB 5K2YA 4TOZA 3TAJA 4ECFA 4PQJA 2UVJA 1B5IA 1UIUA 1OMPA 1LBBA 3HN0A 1RKMA 4QFNA 3K6WA 3H06B 2DVCA 2Y7KA 3UA8A 2KLFA 4KD5A 2DXRA 2OK2A 2Y7RA 3GXAA 3KBRA 1B5JA 4OFJA 4MLQA 5I57B 1LFIA 2RKMA 1D9VA 2P2AA 3H7MA 3TELA 4LATA 1Y4TA 3BKIB 1CB6A 3LSXA 3IL1B 1LAHE 4I1DA 5FHOA 3P7IA 1URGA 3TCHA 2ONRA 3IO6A 5I59B 2ONKE 3OEMA 3H3GA 2NOOA 2QS3A 1UIVA 2W7YA 3GBAA 1P1OA 1PBQA 1MXUA 3RGYA 3TQLA 3D4GA 2F35A 5DEXA 3PUVE 3CG3A 3K1NA 4FIMA 2A5TB 4NF4A 3RUMA 3Q27A 1JEUA 1QW0A 4C1TA 5KCJB 4NE4A 3JV9A 4YKPA 5H8QA 2ALUA 1QKAA 4ESXA 4Z0IA 4OEUA 2GRVA 3K6UA 4OMBA 2HEUA 2F6PA 4LQ2A 1B3LA 3A09A 4GIZA 4R6KA 2OWTA 5AA1A 2IEEA 3KOSA 3K0VA 3EPEA 2Z23A 2F36A 2Z8FA 4OVJA 3CG1A 1JQFA 2ZYNA 1Y3NA 2XXUA 2OZZA 3MVXA 5I57A 3RT8A 1DPPA 3N26A 3OSRA 3EHTA 2B65A 2UVIA 3TTRA 4ZDMA 4F2QA 3W9WA 3C36A 4G68B 1NKXA 4R6YA 4P0IA 2GFEA 3OO8A 3USDA 1S9TA 2DWHA 1B4ZA 5I59A 5AA4B 5J1DA 2VD3A 3IR1A 3SEVA 3CSBA 2E1SA 3QUFA 3PUYE 3K1MA 1B9JA 1JW5A 3TCFA 1HSLA 2A5TA 4KYDA 3EHUA 1YAEA 2O84X 1IXGA 5H8FB 4FAJA 1B6HA 3H6WA 4JWYA 2UXAA 4U4XA 1B52A 1T0KA 4H5FA 2QMWA 2O68A 1YPNA 4R74A 3ILUB 3MJNA 2OWSA 1LAFE 1VSOA 1Y3QA 3FD3A 4DIGA 3U94A 4I62A 5DYHA 1NNKA 4EUOA 1SW5A 3C33A 3MZ1A 2REJA 2DWJA 1USYH 5TPAB 4R9FA 3OD7A 3TDJA 1FQCA 4QFPA 5ELVA 1NL5A 4RA1A 1NNFA 4G68A 4I9DA 4FE8A 2F8DA 4KCCA 1FQEA 5CMKA 3O28A 4MLVA 4QHQA 3T9XB 1MDQA 3TQWA 3LSFB 4ZEBA 3E4RA 1QUIA 4PFYA 5JEIA 3IOVA 3TUSA 4YB5A 1ANFA 3MPLA 4KYSA 3Q28A 4RK9A 3HPIA 2DXYA 5H8FA 2DSFA 3C4MA 2ZXTA 4N6PA 4HCYA 3HHFA 1Y4CA 4F1UA 1ZMGA 4QSEA 5I58A 1P1UA 3R6UA 4YKJA 4KPTA 4OTEA 3R26A 1P1NA 2X7QA 3VV5A 5L9OA 4DE8A 2ESNA 3IOTA 2QL3A 2ABHA 1URDA 3ILTB 2Z8EA 1I6BA 4ISUA 3UP9A 2I48A 4H0WA 2XXTA 5TPAA 4BDOA 4JWXA 1MPDA 1IIWA 1MM7A 1MS7A 4NTLA 3S9LC 2Y7PA 5DT6A 4GF8A 3O9PA 3SESA 1AL3A 4WEDA 4XKQA 2RINA 3K6VA 3OELA 1AMFA 3W9VA 1PB8A 4LZ8A 5IKBA 4QFOA 3CRBA 1N76A 1MY2A 3MP8A 1MXYA 3FVNA 1N84A 4LZ5A 2D21A 1Q1KA 2GHAA 3SDFA 3QAXA 1NNTA 4C1UA 5JTYB 4E0XA 1ZIUA 2RC8A 1D9YA 3DP6A 4MH5A 4U22A 5H8SA 2Q2AA 3PUZE 4F22A 3B7DA 3DM0A 4F3GA 5CM6A 3OENA 1LSTA 2QJEA 3MW0A 2XXWA 1FTOA 5M2VA 3CIJA 3VE1B 4H6DA 4NWCA 1NFTA 3PPOA 3EHSA 3B6WA 4KHZE 1URSA 4IB2A 2QS2A 4LONB 1PB7A 4X48A 4OFLA 4OZ9A 4HCWA 5HM4B 4Q30B 1OIBA 1R1NA 4WXJA 1M5CA 4GWOA 1CE2A 4QF9A 3SERA 4NF6B 4TQUQ 4DXBA 5KDTA 4MF3A 2QS4A 2V3QA 3KZGA 2XD2A 1B1XA 3RTWB 2V84A 5K2XA 3FV1A 1IEJA 3UORA 2F97A 1MXZA 4PFUA 3SEUA 1UQWA 1GTKA 2XXXA 4FEBA 4OQOA 4FORA 1NMUA 4EXLA 4ZE8A 5FTIA 3IORA 3PU5A 1JW4A 5CBSA 1LCFA 3VVEA 1JETA 1XC1A 3VLVA 4NF8B 3OMBA 1MM6A 2THIA 1MY3A 5TP9B 3C35A 3HSTA 4IY6A 1ZLQA 4NF4B 3FGSA 4OETA 3LUYA 2X7PA 4P11A 4ELRA 2QMXA 3PD8A 4YB6A 5AA3A 2DWAA 4KYEA 3H03A 4PE5B 3IAZA 1GVCA 2HQ0A 3TTMA 3MVWA 3LSWA 4NF6A 2AL5A 4JSDA 4GL8A 3Q29A 4QSCA 1SBPA 4EDPA 4XXUA 2REGA 4M1VA 4FATA 4RK2A 1QUKA 3U92A 4F1YA 3K2DA 3U93A 1B46A 2UYFA 1FTLA 2F6GA 5EYFA 2OJTA 3QXMA 1BLFA 4GXSB 1S50A 4DZ1A 3KN7A 3CFZA 3VFJA 5FHNA 3O97A 3OEKA 1VE4A 2DE4A 4ELPA 4GOTA 1LFGA 3M3LA 1M5FA 3C34A 1USYE 5CC2A 5CMCA 1YCJA 1B05A 2E0SA 4NF8A 1MY4A 5TP9A 4H8JA 4PFTA 1MY1A 2F7AA 2DWIA 3FATA 2NUVA 3MP1A 4MFIA 2XXHA 4ONYA 3F11A 5CI5A 1MH3A 4F39A 1DTGA 3K1PA 4NF5B 4HW8A 5HBCA 3S9EA 5H8NB 2HXWA 3ODBA 3WAFA 1LAXA 5FTHA 3G7WA 3O6GA 1MQGA 2XX8A 5ITPA 3CR9A 1M5DA 2Q88A 1P1QA 4H8IA 3ZSFA 1EU8A 2H4IA 4DCXA 5AE4A 3N6TA 4XKPA 4LA9A 3UIFA 3EQ1A 4BLAA 3KFMA 2ANJA 2RCBA 2D5WA 4F29A 1ZJLA 3KSXA 1B40A 4G77A 3TYHA 4KR5A 5ITOA 2XXYA 1US4A 4EF1A 3S2VA 3RY3A 5I84A 1B0HA 4THIA 4U21A 4NMYA 3VLWA 1MPBA 4C0RA 3I5OA 1PB9A 1B51A 4ZS9A 3RN8A 2Y7IA 5DVJA 1A55A 1IXCA 4RNSA 3L6HA 5FHMA 3N5LA 3QSLA 3RT6B 2G29A 2F5XA 2HAUA 1RYOA 4OXVA 3SEYA 1B58A 2F7CA 4H67A 4U2RA 4JDFA 3FZVA 5I2KB 1SYIA 5DVIA 1POTA 2FYIA 2O51A 4IO7A 4NF5A 5I58B 3I6VA 3TMGA 5H8NA 4O3CA 2VOZA 4YMAA 3Q26A 4DXUA 5AA2B 1FCKA 3T93B 3DP4A 4ZECA 3OOAA 3T9VA 3B6QA 4IO3A 4OERA 3IJOB 1PDAA 4UA8A 1HSEA 2UVGA 4GLIA 2WKYA 2R9JA 2V3TA 3MVYA 2FNCA 4X1BA 1AIVA 4GFRA 1WVJA 2V93A 3FJMA 3O29A 2P0SA 3K01A 1XS5A 5BUUA 3IOWA 1NH7A 3FV2A 4BDNA 3CI8A 3TCGA 3I3VA 3IB0A 3S4UA 1BIYA 1LB8A 1FTJA 3KJ7A 3PD9A 4YICA 2AL4A 5KZTA 4GRKA 3PGFA 4EQ7A 1PBPA 2DYXA 4U1OA 3UN6A 4ZEIA 4IO6A 3A3UA 1MG1A 2I0CA 3S9MC 1N3WA 1IQ7A 4GVOA 5CMMA 4AB6A 4G68C 4U23A 2VD2A 1MRPA 2DP8A 5I2KA 3TTNA 2OLBA 1JVXA 4H5GA 4BDMA 2Y84A 4IO2A 3AXFA 2XX9A 1ATGA 3RLFE 1OVBA 3FIRA 4F1VA 5AA2A 1LB9A 3FVGA 1POY1 1F9BA 5L8DA 3V8XB 4QFLA 3FVKA 1VFEA 1NH8A 2CMOA 5EHMA 1LAGE 3QK6A 2H98A 3PPNA 3PPPA 2VP1A 1O7TA 2I4CA 3QYTA 1UTHB 3GBBA 3T22A 1MY0A 2VHAA 2IA4A 5KDTB 3FASA 1MH4A 1A7LA 1OQGA 1EZ9A 1I69A 1YTVA 4ELOA 1B3GA 2B3BA 1BKAA 1R9LA 4KI0E 4IGTA 1R6ZA 1XOCA 3MZ9A 1HSJA 2NXOA 1JVYA 1QULA 3T9UA 3MBPA 2I3WA 2O7IA 5JK4A 1SVXB 4RXLA 1B0LA 5A5XA 1B3HA 1FQDA 4E0WA 3PUXE 1BP5A 3E13X 4QSDA 1MQHA 1B7HA 4WKMA 3PMXA 3IB2A 2AIXA 4RYAA 4RJZA 3O66A 4JXIA 3TZAA 2FA7A 5EHSA 3PMWA 2XXRA 3N94A 3PUWE 1LGBC 1XVXA 3PPQA 5DVFA 3MAMA 4RY1A 1D3KA 4YZZA 3KSJA 2PX1A 2HFBA 4OYVA 1SI1A 1B7UA 1UTHA 4EF2A 3OO7A 3CFXA 4UACA 4X9TA 4Q5TA 4OENA 1LFHA 5ICQA 4BDLA 2YPNA 4OHNA 3FXRA 1O64A 4AB5A 4XKNA 3ZKKA 2UVHA 1D4NA 3ECRA 4F19A 4PFWA 2DQVA 4HS7A 1LLSA 4FJPA 2XX7A 2QPQA 2RC7A 1FQFA 3LBSA 3S9NC 2ZNUA 1MXWA 4LZ7A 4BDRA 3H6UA 3T66A 1IXIA 1DPEA 5CBRA 3D4CA 3HHGA 4YKIA 3W15C 3KEIA 1DTZA 4F2OA 4OWDA 2HCAA 4KQPA 3SEWA 4LP2B 3KG2A 3UGWA 4RPOA 3O2AA 4U4SA 1R9QA 4YAHX 3IB1A 2XXQA 3CFLA 4XTCQ 5LOMA 3SEXA 1Z7NE 4ZZAA 1MDP1 4M4GA 1GR2A 4QFKA 3RQTA 1IITA 2H9BA 1N0TA 1P99A 3JZJA 1SI0A 2Y7WA 3K6XA 5CRYA 1SW1A 1A8FA 5I2NB 4YKKA 3PPRA 2ZYKA 3BFTA 4G8HA 3BFUA 3R7XA 5I56B 2I49A 4HTGA 2OCUA 2QSXA 2F7BA 5B70A 5L9MA 1MPCA 3VVDA 1US5A 1OQHA 4P0GA 3VLUA 3UK4A 3IOUA 2YJPA 2Q9TA 3THIA 2GH9A 5HPQA 2I6EA 3HO7A 4G2ZA 4DDDA 1Y9UA 5DTBA 3MVZA 2DE3A 2R71A 3G3HA 1L5TA 1Y1MA 4G8NA 1TT1A 3V83A 4G8MA 3GZGA 3U8QA 4EXKA 3G3IA 3TTLA 3ONMA 4R72A 4Q0CA 1H76A 1SQYA 1MXXA 3CSGA 1MQIA 1LCTA 2ZMBA 3SETA 4YMBA 2D3IA 4ZEKA 4X1DA 4F31B 2UYEA 4QRZA 4YB7A 4JWOA 1DMBA 3TTKA 1IZ1A 4YU0A 4I8CA 3C31A 3T9HB 2XXVA 3MWBA 2F78A 4O3BA 5I2NA 1IXHA 4XKRA 2H5YA 3FVOA 2I3VA 2XD3A 3TPAA 1B2HA 3MUQA 5I56A 3M3KA 2A5SA 1B7ZA 2XXIA 4LUBA 4NWDA 1N3XA 3JYRA 3A3CA 4KCDA 3MPKA 3OXNA 4RPNA 4N07A 1JEVA 3EF7A 1ZU0A 1FQBA 1WDNA 3RTFB 1SD3A 1QKBA 3FXQA 3H6VA 1KWHA 3E9XA 1H43A 2X26A 4BDQA 3OSQA 2Z8DA 1Y3PA 1ZBMA 2RF1A 4Z7EA 1MQJA 1TFAA 3LC8A 2DE2A 2H99A 5F7VA 3QUJA 1PEBA 3RPWA 1MXVA 3TEPA 1OLAA 3FXUA 3K00A 2HZLA 1H3DA 3MC2A 1OLCA 4FECA 4KFQA 1TXFA 4ZEDA 3N6UA 2NVUB 3H4ZA 4NEDA 3V5AA 3LR1A 4TLLB 3VXCA 5KCJA 4OESA 4F3SA 2ZNSA 2O1LA 1A99A 1J1NA 2PT2A 2Q2CA 2CZLA 3FJ7A 1B3EA 1Q35A 2DOJA 4L17A 1AH5A 1AOVA 1M5EA 2QS1A 2VGQA 3VDFA 4DCYA 2AYSA 1Y1ZA 3M3FA 1A8EA 1FQAA 1P1WA 2NWJA 5H8HB 5ICTA 1TFDA 1TWYA 1SW2A 1VR5A 3H6TA 2PBWA 3U72A 4XIGQ 1DSNA 4IGRA 3OO6A 1SW4A 4LVQA 3EN3A 2PVUA 1A40A 3TFLA 4G4PA 5L9SA 1O63A 3ZS6A 5ISUA 3QIMA 3PMVA 3L6GA 5AA4A 1NNPA 3FJGA 4GXAA 1QUJA 4POWA 2O7UA 1JW1A 5A5XB 2O1MA 1N04A 5BWJA 4TLMB 4IY5A 1ZKBA 2BJJX 4Q8RA 2ONSA 1GGGA 2P1SA 4H1XA 1QVSA 1IUDA 2G93A 3IO4A 1B5HA 3C32A 2Q8JA 2M8CA 3DLNA 2ZNTA 4F18A 3IJXB 3GLBA 3LSLA 3CVGA 3T96B 2I4BA 3TKDA 2OBGA 2XHDA 4ZZEA 4R9GA 4F3PA 5H8HA 4R2BA 4GQOA 1SYHA 1II5A 3MZBA 4H65A 4R75A 2Z22A 2ZYMA 2V3UA 1DOTA 3K02A 4U1ZA 1RYXA 3PV0E 4O3AA 3G3KA 3G3FA 2QRYA 1OVTA 3KOTA 3E3KA 2B3FA 3KN3A 4AQ4A 2HAVA 1XHYA 3FUZA 4ZE9A 1B4HA 3Q25A 3MP6A 4GD5A 3M8UA 4K3FA 3VVFA 3G3JA 1A54A 1M5BA 1Z7ME 4ZEFA 2Q89A 3B6TA 4EQBA 1N7XA 4ESWA 1B3FA 4JBZA 4R2FA 1FTKA 4F3BA 3KGCA 1UTBB 2ZYOA 4MBPA 2F34A 1ZTYA 2GHBA 4OFOA 4PP0A 3G3GA 3ZKLA 1BTJA 2O69A 2R6GE 1PC3A 1MQDA 3HV1A 4IO5A 5CMBA
chains in the Genus database with same CATH superfamily
3KJTA 5IAIA 2RCAA 4ND9A 4WEPA 1SDXA 1LBCA 4GL0A 2EMIA 1N36E 1GV8A 2DS9A 4PETA 2J7JA 3C9HA 3SKPA 3IK6B 4DV6E 3DELB 2I58A 1RQ0A 2PT1A 5B7DA 3NOHA 3OO9A 1B32A 3WAEA 1FW0A 2JJKA 2H25A 2L2NA 4X8WA 5AA2D 2JY9A 1QJMA 1IMCA 1B1HA 3KN8A 4N13A 2YTFA 2RSIA 1S7YA 4B3ME 5J16A 3V89B 3FBPA 4DXCA 1XT8A 4R73A 2EM0A 2XA5A 4IO4A 1J26A 3VXBA 1VFDA 2V86A 4N91A 1XVYA 3HCQA 4BCAA 4OEVA 4EQ9A 3JTZA 1X47A 2I0BA 4NAPA 1EZPA 4POXA 2HZKA 4L8NA 4DV0E 2DMYA 2V25A 4FBPA 2BJIA 5JTYA 3IX1A 2EM5A 1FPJA 3F6HA 5A69A 4LF4E 1I6AA 3DP8A 3RNNA 1H44A 1RDXA 2PYYA 3MQ9A 2LAOA 3K4UA 4JSOA 3O6IA 1Y20A 3O6HA 3F6GA 1H45A 1I6QA 2L2MA 2EN8A 1N3GA 1NUZA 1O0WA 1AAYA 1UTBA 1G2DC 2DVZA 3TODA 1FTMA 2YLNA 2XXPA 5DEXB 4H46A 1NUYA 4LQ5A 5DW8A 4GZNC 4N6DA 4DV2E 1JNFA 4FEDA 3J80C 5TU0A 4DLDA 2G7HA 5T6JA 3BBRA 1EH3A 1WODA 4JB7A 5F1QA 1ELJA 4R6HA 2RC9A 4ELQA 2O6AA 4DKKA 4L5NC 2PMSA 1EZOA 4MNCA 1N7WA 3U1OA 5H8QB 5K2YA 4TOZA 3TAJA 4ECFA 4PQJA 2UVJA 1SPIA 1B5IA 1NV3A 1UIUA 2YTOA 1OMPA 1LBBA 3HN0A 1RKMA 4QFNA 4M0VA 1TN9A 4JVIA 1X6EA 3K6WA 4WXCA 3H06B 1NV7A 2DVCA 2Y7KA 5KL4A 3UA8A 4OA4A 2UXCE 2KLFA 4KD5A 2DXRA 4R2EA 2OK2A 2EN6A 2Y7RA 3GXAA 3KBRA 2WZOA 1VDWA 4GWUA 1B5JA 4OFJA 4MLQA 4JI0E 5I57B 4X9JA 5AASA 1LFIA 2RKMA 1D9VA 2P2AA 3H7MA 4MX6A 3TELA 4LATA 1Y4TA 3BKIB 1CB6A 3L00A 3LSXA 4O43A 3IL1B 3E78A 1LAHE 4I1DA 5LDZA 5FHOA 3P7IA 1URGA 3TCHA 1FBDA 1HR0E 2ONRA 2YTDA 3IO6A 2K4VA 2BBGA 5I59B 4GBVA 4R2AA 2ONKE 1T39A 4PAIA 3OEMA 3H3GA 2NOOA 2QS3A 1UIVA 2W7YA 1STUA 3GBAA 3ISPA 3LMLA 1GQEA 1P1OA 1PBQA 1MXUA 3RGYA 3TQLA 3OTOE 4BHBA 3D4GA 2F35A 5DEXA 3PUVE 4JI3E 5LMNE 4DV4E 3CG3A 3K1NA 5IZ3A 1WRJA 4FIMA 2A5TB 2L3JA 1EH7A 4NF4A 4PFRA 3T1YE 3CHGA 5F3WA 3RUMA 3Q27A 1JEUA 1QW0A 5A6JA 4C1TA 3BIDA 2R1FA 5KCJB 1UILA 4NE4A 1IBME 3JV9A 5KL2A 4YKPA 5H8QA 1YYKA 4BMJA 3TQMA 2ALUA 1MEYC 2V8QB 2CPNA 4PGPA 2QFLA 1QKAA 4ESXA 1L4SA 4Z0IA 2EWLA 4OEUA 2GRVA 3K6UA 4OMBA 3KC1A 2HEUA 2F6PA 4LQ2A 1B3LA 3A09A 4GIZA 1PJQA 4R6KA 2OWTA 5ESYA 2IEEA 3KOSA 5AA1A 3K0VA 3EPEA 2Z23A 2EOQA 2EPKX 2F36A 4JI6E 2Z8FA 2YRHA 3OMLA 1NV2A 4OVJA 4LF9E 1FBGA 3CG1A 2WYKA 1JQFA 2DB2A 2YTJA 5IV8B 2ZYNA 3C6KA 1Y3NA 2XXUA 2KHXA 2EORA 2OZZA 3MVXA 5I57A 3RT8A 1DPPA 3N26A 2UU9E 3OSRA 2EJ4A 4NF0A 3EHTA 4DI4B 2PFZA 3C4TA 2B65A 2DDKA 4ZYEA 2UVIA 3TTRA 4GX6A 4ZDMA 4F2QA 1SR9A 1YYZA 3W9WA 3C36A 4G68B 1NKXA 4R6YA 1WJPA 2YTPA 4P0IA 2GFEA 3OO8A 3USDA 1ZAAC 1S9TA 2DWHA 1NEIA 1B4ZA 5I59A 5AA4B 5J1DA 4YY3E 2WBUA 2VD3A 3IR1A 2CSHA 3SEVA 5ADZA 3IWBA 3CSBA 2E1SA 1YYOA 3QUFA 4P56A 3PUYE 3K1MA 4MNIA 1B9JA 4GX3A 1JW5A 3TCFA 1FBEA 1HSLA 2A5TA 4F9CB 3IWDA 4KYDA 2CT1A 2WEFA 3THOB 3EHUA 1YAEA 2O84X 1IXGA 2LE2A 5H8FB 4O94A 4FAJA 1B6HA 3VYYA 3H6WA 4JWYA 5EQ7A 2UXAA 4U4XA 1B52A 1T0KA 4H5FA 1N34E 2EZ6A 2QMWA 2O68A 1YPNA 4R74A 3ILUB 2LUQA 3MJNA 2OWSA 1LAFE 4QXDA 1VSOA 1Y3QA 3FD3A 4DIGA 2EE8A 3U94A 2M9AA 4I62A 5DYHA 4JI4E 3MSTA 2MDGA 2ELYA 1NNKA 4EUOA 4DV5E 1SW5A 3C33A 3MZ1A 4R2SA 2YRMA 2REJA 2DWJA 1USYH 5TPAB 4AS5A 4R9FA 2FVZA 3OD7A 3TDJA 1FQCA 4QFPA 5ELVA 1NL5A 4RA1A 5LL6R 1K9YA 1NNFA 2EMKA 1QGXA 4G68A 4I9DA 4FE8A 2EL6A 4K0KE 4MHFA 2F8DA 1IBLE 4KCCA 1FQEA 5CMKA 1PJTA 2EPNA 2E5LE 3O28A 4MLVA 4P1LA 4QHQA 3T9XB 1MDQA 3TQWA 3LSFB 4ZEBA 1IQOA 4WXDA 3E4RA 4NG7A 1QUIA 2PCRA 1LBYA 2GHFA 4O7MA 4PFYA 5JEIA 3HPZA 3IOVA 3TUSA 4YB5A 1ANFA 3MPLA 4KYSA 3Q28A 4NHRA 4ZYGA 5AC4A 4RK9A 3HPIA 2DXYA 2EN1A 5H8FA 2EPXA 2DSFA 3C4MA 2WBDA 2ZXTA 4N6PA 4HCYA 4NN3A 3HHFA 1Y4CA 3KWRA 4GEQB 3KZZA 4F1UA 1ZMGA 4QSEA 5I58A 1P1UA 3ZOQB 1XMQE 2F3DA 2ENAA 3R6UA 4YKJA 2R76A 1HNWE 4PC9A 4KPTA 4OTEA 3R26A 1P1NA 2X7QA 3VV5A 5L9OA 4DE8A 2ESNA 3IOTA 1INPA 2ABHA 2QL3A 1URDA 3ILTB 2Z8EA 1I6BA 4ISUA 3UP9A 2I48A 4H0WA 2WBBA 2V87A 2XXTA 5ET5A 5TPAA 4HEIA 4BDOA 4LF8E 4JWXA 4M9VC 1MPDA 1IIWA 4DV1E 1MM7A 1MS7A 4FK5C 4NTLA 1IMDA 3S9LC 2Y7PA 5DT6A 4GF8A 1KJKA 3O9PA 4PBHA 3SESA 2LUPB 1AL3A 4WEDA 4XKQA 2RINA 4RH8A 2DRPA 3K6VA 3OELA 1AMFA 3W9VA 1PB8A 4LZ8A 1YUIA 4GWYA 1IMBA 5IKBA 4O5GA 2KR0A 3B50A 4QFOA 3CRBA 1LBXA 1N76A 3K6QA 1MY2A 3LV0A 1MXYA 3MP8A 3FVNA 4G61A 3J81C 1N84A 2EPUA 4LZ5A 2D21A 1Q1KA 2GHAA 3SDFA 3QAXA 1NNTA 4C1UA 5JTYB 4E0XA 4PF6A 1ZIUA 2RC8A 1D9YA 3DP6A 4MH5A 4U22A 5H8SA 2Q2AA 3PUZE 2UXBE 4F22A 3B7DA 3DM0A 4F3GA 5CM6A 3OENA 1LSTA 2QJEA 2P3NA 3MW0A 1IMFA 2XXWA 1FTOA 2EN4A 5AE2A 5M2VA 1T4LB 4N17A 3CIJA 3VE1B 4H6DA 1QNTA 4DV7E 4NWCA 1EH8A 5EQ8A 4R2RA 1NFTA 3JU0A 3PPOA 2CEYA 4OVSA 3EHSA 3UK3C 3B6WA 1A1LA 4UABA 1X6HA 4KHZE 2MC6A 1URSA 4IB2A 1MGTA 2EM7A 2KOUA 2QS2A 5A6AA 4KXPA 4LONB 1PB7A 4X48A 4OFLA 1NUWA 4N4UA 1FPGA 4HCWA 4OZ9A 5HM4B 4Q30B 1OIBA 1YZ9A 5F24A 1R1NA 5DNYA 4WXJA 1M5CA 4GWOA 1CE2A 4DV3E 4F6NA 2B7TA 4QF9A 3SERA 4NQ8A 2JR1A 4NF6B 4TQUQ 4DXBA 5KDTA 4MF3A 2QS4A 4GKKE 4Q28A 2LV2A 2V3QA 3KZGA 2EN2A 2EM2A 1TF6A 2XD2A 4M30A 1B1XA 3RTWB 2DLQA 2V84A 5K2XA 3M99B 3FV1A 4HE0A 4N81A 2XWIA 1IEJA 3SZPA 3UORA 2F97A 1MXZA 4LFBE 1UN6B 4PFUA 4N4RB 4XFEA 3SEUA 1UQWA 1GTKA 2XXXA 4FEBA 4MJOA 4O24A 4OQOA 4FORA 1NMUA 4EXLA 4ZE8A 5FTIA 4WSPA 5LMUE 1PKPA 3IORA 2EMZA 3PU5A 1JW4A 2YRKA 5CBSA 1LCFA 3H09A 3VVEA 4O4KA 1JETA 3HFUA 1XC1A 3BIGA 4LN5A 3VLVA 3RYDA 4N6KA 2Y5LA 4NF8B 2EPOA 3OMBA 1MM6A 5IZ3B 2Q8UA 2THIA 1MY3A 5TP9B 2VF1A 3C35A 1ZR9A 2DGCA 2QVUA 2RS7A 1HNZE 3HSTA 4IY6A 2DSYA 1X3CA 1ZLQA 4PCDA 4WSGA 5AC5A 4NF4B 1X48A 3FGSA 4OETA 2ZZVA 4R03A 3LUYA 2X7PA 4P11A 2BB8A 4ELRA 2QMXA 3PD8A 3EKIA 4YB6A 4P9KA 3GYYA 4DR3E 5AA3A 2N3GA 2DWAA 4KYEA 2YSPA 2LRSA 2RSMA 4Q35B 1DBZA 3H03A 4PE5B 1JK1A 2LCEA 3ADJA 1XI6A 2NA2A 4PTKA 3IAZA 2FGGA 1GVCA 2HQ0A 3TTMA 2F3BA 3MVWA 1WHNA 3LSWA 4OVRA 4NF6A 2AL5A 4JSDA 4GL8A 3Q29A 4QSCA 1SBPA 4EDPA 4XXUA 2REGA 4M1VA 4FATA 1RMDA 4YHHE 4RK2A 1QUKA 3U92A 2EN3A 1YZ0A 4F1YA 2EP3A 2UUBE 3K2DA 3IFAA 3U93A 1B46A 2UYFA 1FTLA 2F6GA 5ET7A 3EPHA 5EYFA 2OJTA 3EPKA 3QXMA 1BLFA 4JI5E 4NXNE 4N8YA 4OANA 4GXSB 1LBZA 1S50A 4DZ1A 3KN7A 3CFZA 3IWCA 3VFJA 1IQSA 4JV5E 5FHNA 3O97A 3OEKA 1VE4A 2DE4A 1NV1A 4ELPA 4GOTA 4P78A 2YTIA 1LFGA 4NXME 3M3LA 1M5FA 1DK4A 5TSEA 2CZKA 3VHTB 3HTXA 3C34A 5T3JA 2Q74A 1USYE 4DI3D 5CC2A 5CMCA 3THNA 4GWZA 4DR7E 1YCJA 1B05A 2E0SA 4NF8A 1MY4A 5TP9A 4H8JA 4PFTA 4F6MA 1MY1A 3VK6A 3BBGA 1NUXA 2F7AA 1EYIA 2DWIA 3FATA 4X04A 2NUVA 2EMFA 3HPSA 3MP1A 4MFIA 2EOZA 3J7Yp 2XXHA 4ONYA 3F11A 2EPCA 5CI5A 1BB8A 3EPLA 1MH3A 4F39A 4WPYA 1DTGA 3K1PA 3ADLA 4O7IA 3A29A 4NF5B 2VPOA 2JXPA 5HBCA 4HW8A 3S9EA 5H8NB 1IMEA 2HXWA 4HXVA 3ODBA 3WAFA 1PJSA 1LAXA 5FTHA 3G7WA 3O6GA 1MQGA 2XX8A 5ITPA 3CR9A 1XMOE 1M5DA 2Q88A 1P1QA 2R8TA 4H8IA 1P47A 3ZSFA 2VPNA 1EU8A 3JAMC 1JP4A 2H4IA 4DCXA 5AE4A 3N6TA 1BBGA 4XKPA 4LA9A 3UIFA 3EQ1A 4BLAA 3KFMA 5A2QC 4BC7A 2ANJA 3MHHC 2RCBA 2NABA 2D5WA 4F29A 1ZJLA 3KSXA 1B40A 4G77A 3TYHA 4KR5A 5ITOA 2YU5A 5BR8E 2XXYA 1US4A 2EMXA 4EF1A 2EL5A 2EMGA 2VQFE 3D1RA 4ZYDA 3S2VA 2EOJA 3RY3A 5I84A 4NZVA 2QVVA 1B0HA 4THIA 4U21A 4NMYA 3VLWA 1MPBA 4C0RA 3I5OA 1PB9A 4IR8A 1B51A 4ZS9A 3RN8A 2Y7IA 5DVJA 3HQ1A 4X66E 1A55A 2EOSA 1IXCA 4RNSA 2N3HA 2EM6A 3L6HA 5FHMA 2JVAA 1FKAE 2UUAE 4OVQA 2MC5A 2RS6A 4F2JC 1BK4A 3N5LA 4ZYHA 3QSLA 5A6BA 2MKZA 3RT6B 4LU9A 2G29A 2F5XA 2HAUA 2GQ1A 1RYOA 4OXVA 3SEYA 1B58A 2F7CA 2UXDE 4H67A 4U2RA 2V4CA 4JDFA 3FZVA 2FIEA 5I2KB 1SYIA 1YXIA 1POTA 5DVIA 2FYIA 2O51A 4IO7A 4NF5A 5I58B 3I6VA 3MYUA 3TMGA 5H8NA 2M7QA 4O3CA 2VOZA 4YMAA 5EYGA 3Q26A 4DXUA 5AA2B 1FCKA 4I3YA 3T93B 3DP4A 4GWSA 4ZECA 3OOAA 1AWBA 4PAKA 3T9VA 3B6QA 2EM8A 4IO3A 2EMBA 4OERA 3IJOB 5EYHA 1PDAA 4UA8A 4BS9A 1HSEA 2UVGA 4GLIA 2WKYA 5AE3A 3P1XA 1XNRE 2R9JA 2HPGA 2F8BA 2V3TA 3MVYA 2EM3A 1FJGE 2FNCA 4X1BA 1AIVA 1B69A 4GFRA 5LTCA 1WVJA 2V93A 1T4NA 3FJMA 5A6KA 1A1JA 3O29A 4J8ZA 2P0SA 3LLHA 3K01A 1XS5A 1X49A 4JI8E 5BUUA 3IOWA 1NH7A 3FV2A 5EQ9A 4BDNA 3CI8A 3TCGA 3I3VA 3IB0A 3S4UA 1BIYA 4MEVA 1LB8A 5ET8A 1FTJA 3KJ7A 4BHCA 1TF3A 3PD9A 4YICA 2AL4A 2QVRA 5KZTA 5IZZA 4R2CA 1A1FA 4JVCA 2OWZA 4GRKA 1N33E 3PGFA 4EQ7A 1PBPA 2DYXA 4U1OA 2A25A 4ZEIA 2NUEA 4IO6A 3UN6A 3A3UA 3DJWA 1MG1A 1GZ6A 2EQ3A 2I0CA 3S9MC 1N3WA 1IQ7A 4GVOA 2M4IA 5CMMA 4AB6A 4MIJA 4G68C 4LF6E 2XWVA 4U23A 2VD2A 1MRPA 1YUJA 2DP8A 5I2KA 3TTNA 1EYJA 2OLBA 1JVXA 4H5GA 4BDMA 2Y84A 4IO2A 4R2PA 2D9HA 3KZYA 2ADRA 1J5EE 2CEXA 2LTRA 3AXFA 4OOGC 1ATGA 2XX9A 1OVBA 3FIRA 3RLFE 4F1VA 5AA2A 1DQ3A 1UHZA 1KA1A 1LB9A 1A1GA 3FVGA 1POY1 1F9BA 5L8DA 1FBCA 3V8XB 2UUCE 2LJUA 4QFLA 3FVKA 3PTYA 1VFEA 4WX9A 1NH8A 2CMOA 2GPIA 5EHMA 1I94E 2HJJA 1X6FA 1LAGE 3QK6A 1CNQA 2H98A 3PPNA 4P7DA 1KA0A 1LBWA 3PPPA 4XF5A 1X5WA 2I9IA 2VP1A 1O7TA 4HE1A 2EM4A 4JI1E 1NI9A 2I4CA 3QYTA 1UTHB 5KL6A 3GBBA 3T22A 1MY0A 2VHAA 1YFHA 4HE2A 3KC0A 2IA4A 5KDTB 3FASA 1MH4A 1A7LA 2NUGA 1OQGA 1EZ9A 1I69A 3AV0A 2EOMA 3C4BA 1YTVA 4ELOA 1B3GA 2B3BA 1BKAA 4X64E 1R9LA 4KI0E 4IGTA 1R6ZA 2EOIA 2EOHA 2RTXA 1XOCA 3MZ9A 5A5LA 1HSJA 2WYPA 2YTNA 2NXOA 3T1HE 1JVYA 1QULA 3T9UA 3MBPA 2I3WA 2O7IA 5JK4A 1SVXB 4RXLA 1B0LA 2ODRD 4B3SE 5A5XA 1B3HA 1A1HA 1FQDA 2MDRA 4E0WA 3PUXE 4PGNA 1BP5A 3E13X 4KWYA 4QSDA 5KL7A 2FV4B 1MQHA 1B7HA 4JVDA 4WKMA 2EOXA 1RC7A 2EOEA 4DUYE 3PMXA 4AQYE 3IB2A 2AIXA 4M2ZA 4RYAA 4RJZA 2B4LA 3O66A 4JXIA 3TZAA 2FA7A 1IBKE 2EM9A 5EHSA 3PMWA 2DLKA 1FJ9A 3E79A 2XXRA 4QBAA 3N94A 3PUWE 1LGBC 1XVXA 2E1MA 3VYXA 3EPJA 5IXMB 3PPQA 4AS4A 5IZ1A 5DVFA 2ELZA 3MAMA 2JP9A 4R2DA 4RY1A 1K9ZA 2EMHA 1D3KA 4YZZA 4DR5E 3B8BA 3KSJA 2PX1A 2HFBA 4OYVA 1SI1A 2YTGA 1B7UA 1UTHA 1ZBQA 4EF2A 3OO7A 2EN7A 3CFXA 4UACA 1IMUA 4X9TA 4Q5TA 4OENA 1LFHA 1F2IG 2YTEA 2JPAA 5ICQA 2L5VA 4BDLA 2YPNA 1DI2A 4OHNA 4I8OA 3FXRA 1O64A 4AB5A 4XKNA 3ZKKA 2KONA 2UVHA 1D4NA 3ECRA 4F19A 4PFWA 2DQVA 4HS7A 2P3VA 3QG5C 1LLSA 4FJPA 2EOFA 2XX7A 2QPQA 1FPKA 4DR1E 2RC7A 1FQFA 3LBSA 3S9NC 2ZNUA 1MXWA 4LZ7A 4NX1A 4BDRA 3H6UA 3T66A 1IXIA 1DPEA 4B3TE 5CBRA 3D4CA 3HHGA 1FBFA 2EQ0A 4YKIA 2Y5KA 2EMWA 3W15C 1YYWA 5FLXC 3KEIA 4MMPA 1DTZA 2B4MA 4F2OA 4DUZE 4OWDA 2HCAA 4KQPA 3SEWA 4LP2B 3KG2A 3UGWA 4RPOA 2ENHA 3O2AA 4U4SA 1R9QA 4YAHX 3IB1A 2XXQA 3CFLA 4XTCQ 2L2KB 4KZSA 5LOMA 2LTSA 2B7VA 3SEXA 5I5PA 1Z7NE 4ZZAA 2WBTA 4H45A 1MDP1 2HHHE 2FBPA 4R2QA 1NCSA 1DGCA 2JYAA 4M4GA 3AUZA 1GR2A 4JI7E 4QFKA 3RQTA 1IITA 2RPCA 2H9BA 1N0TA 1P99A 3JZJA 1SI0A 4F9BB 2Y7WA 3K6XA 5CRYA 2IHR1 1SW1A 1A8FA 5I2NB 2EPAA 3PPRA 4YKKA 2ZYKA 3BFTA 1KZ8A 2L92A 2L33A 4G8HA 4R8OA 3BFUA 1FTAA 3R7XA 5I56B 2WBSA 3FXBA 2I49A 4HTGA 2VE7C 4I40A 2OCUA 2QSXA 4P1EA 1G2FC 2F7BA 5B70A 5L9MA 1MPCA 2LT7A 3VVDA 5CFFE 1US5A 1FPBA 1OQHA 4P0GA 2L8TA 3VLUA 3UK4A 3IOUA 2L3CA 2YJPA 2Q9TA 2HXRA 3THIA 2GH9A 5HPQA 2I6EA 2V85A 4OVPA 3HO7A 4G2ZA 4DDDA 2EMCA 1EH6A 1Y9UA 5DTBA 3MVZA 1XNQE 2DE3A 2R71A 3G3HA 4F54A 2HHMA 1L5TA 1Y1MA 4G8NA 1TT1A 3V83A 1NV0A 4G8MA 3GZGA 3U8QA 4EXKA 3G3IA 4TUIA 1YSAC 1T38A 2EPPA 2N8XA 3TTLA 1A1IA 1ZBTA 4DR6E 4JYAE 3ONMA 4R72A 4Q0CA 4MAGA 5KL3A 1H76A 1SQYA 3C6MA 3ADGA 1MXXA 3CSGA 4F9AB 1MQIA 2Q8MA 1FBHA 4B3RE 1G0HA 1LCTA 2ZMBA 4DR4E 2FIXA 4N15A 3SETA 4YMBA 2D3IA 2VT5A 4ZEKA 4X1DA 4F31B 2UYEA 4QRZA 4YB7A 2V89A 4JWOA 2LBSB 3RPLB 1DMBA 1FPDA 3TTKA 2FHYA 1IZ1A 1KYQA 3KBZA 4YU0A 4I8CA 3C31A 2LO3A 4PBQA 4WYQB 2XXKA 2XXVA 3T9HB 2YU8A 4PE3A 3J7AG 3MWBA 2F78A 2CZHA 4O3BA 5I2NA 1IXHA 2F4VE 2PFYA 4XKRA 1FBPA 2H5YA 1JK2A 3FVOA 2I3VA 2XD3A 4OX9E 3TPAA 5IT9C 1B2HA 1HNXE 3MUQA 5I56A 2VQEE 4PAFA 3M3KA 2A5SA 1B7ZA 2XXIA 4PDDA 5KL5A 2I13A 2VRDA 4LUBA 4NWDA 1N3XA 3JYRA 1EYKA 3A3CA 4KCDA 3MPKA 3T1BA 2EPRA 3OXNA 4TUGA 2V83A 4RPNA 1FPIA 4N07A 1JEVA 2RQLA 2EOOA 2JOBA 3EF7A 1ZU0A 1FQBA 1WDNA 3RTFB 3T0JA 4P47A 2XWOA 1SD3A 4NHBA 1RDZA 4PDHA 1QKBA 3FXQA 3H6VA 1KWHA 3E9XA 1H43A 2EQ1A 2HC5A 2M1SA 4IS1C 2X26A 4BDQA 2CZIA 2V88A 1NV4A 5IWAE 3OSQA 5EQAA 2Z8DA 3FIGA 1Y3PA 1ZBMA 2RF1A 4GKJE 1ZU1A 4Z7EA 2ENCA 4DR2E 1MQJA 4PFIA 1TFAA 3LC8A 2DE2A 2H99A 5F7VA 3QUJA 1PEBA 3RPWA 1MXVA 2LJHA 2YTQA 2ZZWA 3TEPA 1OLAA 3FXUA 3K00A 2HZLA 4BBYA 4LFCE 1H3DA 3MC2A 1OLCA 4FECA 4KFQA 1TXFA 4ZEDA 3N6UA 2NVUB 3H4ZA 1SFEA 2YSOA 1IMAA 4NEDA 5FBPA 3V5AA 3LR1A 3RPLA 4LF5E 2ZZXA 4TLLB 4MCOA 3VXCA 4LFAE 5KCJA 4OESA 4F3SA 2ZNSA 2O1LA 1A99A 1J1NA 2PT2A 2Q2CA 4GWWA 1FPEA 4GX4A 2CZLA 3FJ7A 1B3EA 5I7IA 1Q35A 2DOJA 4L17A 2EPLX 2GLIA 1AH5A 1AOVA 1M5EA 2QS1A 3ROJA 2VGQA 4XEQA 2KQZA 4P8BA 3VDFA 4DCYA 2AYSA 1Y1ZA 3M3FA 3RMPA 1A8EA 1FQAA 1P1WA 2NWJA 1Q9DA 5H8HB 5ICTA 1TFDA 4I3EA 1TWYA 1SW2A 5IGAA 1VR5A 3H6TA 2EMAA 2PBWA 3U72A 4XIGQ 1DSNA 4IGRA 3OO6A 1SW4A 4LVQA 2DMIA 1T4OA 4JI2E 5ET6A 2MKDA 3EN3A 2PVUA 1A40A 3TFLA 4G4PA 2HGHA 5L9SA 1O63A 3ZS6A 5ISUA 3QIMA 4NGUA 3DF6A 2EMYA 5IM2A 1D9QA 3PMVA 3L6GA 3MSWA 1EKZA 5AA4A 1NNPA 3FJGA 2YZTA 4GXAA 2LMZA 1QUJA 4RHBB 4KHPE 3LUZA 3IFCA 2YT4A 1DCUA 4POWA 1FJ6A 2O7UA 1JW1A 5A5XB 2O1MA 1N04A 5BWJA 4TLMB 4IY5A 1ZKBA 2BJJX 4Q8RA 2ODRC 2ONSA 2JOXA 1GGGA 2PRTA 2P1SA 4H1XA 1QVSA 1NV5A 1IUDA 4X8RA 2G93A 3IO4A 1B5HA 3C32A 2Q8JA 2M8CA 3DLNA 2ZNTA 4F18A 3IJXB 4OVTA 3GLBA 3LSLA 5A6BD 3CVGA 3T96B 2I4BA 3MHSC 1UBDC 3TKDA 2OBGA 2WX9A 2XHDA 4ZZEA 2B9DA 1BBOA 2L6MA 4R9GA 1LBVA 4N8GA 4F3PA 5H8HA 4R2BA 4GQOA 2B3TB 1SYHA 1II5A 3MZBA 3HXLA 3BIHA 4H65A 4R75A 4X62E 2ZM6E 2EMLA 1QU6A 2NUFA 3ADIA 2Z22A 2EOYA 1WHQA 2MKNA 4GBWA 2ZYMA 4X65E 1FPLA 2V3UA 2EPZA 1DOTA 1WXRA 3K02A 4U1ZA 1Z1BA 2DIXA 2FTXB 1RYXA 3PV0E 4O3AA 5AE1A 2K7IA 5LLQA 1G0IA 3G3KA 3G3FA 2QRYA 1OVTA 3KOTA 3E3KA 2B3FA 3KN3A 4GWXA 4AQ4A 2E72A 2HAVA 2YWQA 1XHYA 3FUZA 4ZE9A 1FRPA 1NV6A 1B4HA 3Q25A 3MP6A 4GD5A 3M8UA 1A1KA 2EPMX 3U65A 4K3FA 2XWKA 4PFBA 4IJDA 4PF8A 3BGHA 4O8MA 2EL4A 3VVFA 3G3JA 1A54A 3QMFA 1M5BA 1Z7ME 1N32E 4ZEFA 1RDYA 4WFTA 1FPFA 2Q89A 4DMIA 3B6TA 4EQBA 4P3LA 1N7XA 4ESWA 2H36X 5I3SA 1B3FA 4JBZA 4R2FA 1FTKA 4MNPA 4F3BA 2WCC3 3KGCA 4LTYA 2CTDA 1UTBB 2ZYOA 1FSAA 4MBPA 2LVHA 1LEVA 2F34A 1ZTYA 4BC9A 3BF2A 2GHBA 4OFOA 4PP0A 3G3GA 4LF7E 3ZKLA 1BTJA 2O69A 2OX3A 2R6GE 2JWOA 1LLMC 1PC3A 1MQDA 3HV1A 4IO5A 5CMBA
chains in the Genus database with same CATH topology
3KJTA 5IAIA 2RCAA 4ND9A 4WEPA 1SDXA 1LBCA 4GL0A 1GV8A 2DS9A 4PETA 3C9HA 3SKPA 3IK6B 3DELB 2I58A 2PT1A 5B7DA 3OO9A 1B32A 3WAEA 1FW0A 2H25A 5AA2D 1QJMA 1B1HA 3KN8A 4N13A 1S7YA 3V89B 4DXCA 1XT8A 4R73A 4IO4A 3VXBA 1VFDA 1XVYA 3HCQA 4OEVA 4EQ9A 2I0BA 1EZPA 4POXA 2HZKA 2V25A 5JTYA 3IX1A 1I6AA 3DP8A 3RNNA 1H44A 2PYYA 3MQ9A 2LAOA 3K4UA 4JSOA 3O6IA 1Y20A 3O6HA 1H45A 1I6QA 1UTBA 2DVZA 3TODA 1FTMA 2YLNA 2XXPA 5DEXB 4LQ5A 1JNFA 4FEDA 5TU0A 4DLDA 3BBRA 1EH3A 1WODA 4JB7A 5F1QA 1ELJA 4R6HA 2RC9A 4ELQA 2O6AA 2PMSA 1EZOA 1N7WA 3U1OA 5H8QB 5K2YA 4TOZA 3TAJA 4ECFA 4PQJA 2UVJA 1B5IA 1UIUA 1OMPA 1LBBA 3HN0A 1RKMA 4QFNA 3K6WA 3H06B 2DVCA 2Y7KA 3UA8A 2KLFA 4KD5A 2DXRA 2OK2A 2Y7RA 3GXAA 3KBRA 1B5JA 4OFJA 4MLQA 5I57B 1LFIA 2RKMA 1D9VA 2P2AA 3H7MA 3TELA 4LATA 1Y4TA 3BKIB 1CB6A 3LSXA 3IL1B 1LAHE 4I1DA 5FHOA 3P7IA 1URGA 3TCHA 2ONRA 3IO6A 5I59B 2ONKE 3OEMA 3H3GA 2NOOA 2QS3A 1UIVA 2W7YA 3GBAA 1P1OA 1PBQA 1MXUA 3RGYA 3TQLA 3D4GA 2F35A 5DEXA 3PUVE 3CG3A 3K1NA 4FIMA 2A5TB 4NF4A 3RUMA 3Q27A 1JEUA 1QW0A 4C1TA 5KCJB 4NE4A 3JV9A 4YKPA 5H8QA 2ALUA 1QKAA 4ESXA 4Z0IA 4OEUA 2GRVA 3K6UA 4OMBA 2HEUA 2F6PA 4LQ2A 1B3LA 3A09A 4GIZA 4R6KA 2OWTA 5AA1A 2IEEA 3KOSA 3K0VA 3EPEA 2Z23A 2F36A 2Z8FA 4OVJA 3CG1A 1JQFA 2ZYNA 1Y3NA 2XXUA 2OZZA 3MVXA 5I57A 3RT8A 1DPPA 3N26A 3OSRA 3EHTA 2B65A 2UVIA 3TTRA 4ZDMA 4F2QA 3W9WA 3C36A 4G68B 1NKXA 4R6YA 4P0IA 2GFEA 3OO8A 3USDA 1S9TA 2DWHA 1B4ZA 5I59A 5AA4B 5J1DA 2VD3A 3IR1A 3SEVA 3CSBA 2E1SA 3QUFA 3PUYE 3K1MA 1B9JA 1JW5A 3TCFA 1HSLA 2A5TA 4KYDA 3EHUA 1YAEA 2O84X 1IXGA 5H8FB 4FAJA 1B6HA 3H6WA 4JWYA 2UXAA 4U4XA 1B52A 1T0KA 4H5FA 2QMWA 2O68A 1YPNA 4R74A 3ILUB 3MJNA 2OWSA 1LAFE 1VSOA 1Y3QA 3FD3A 4DIGA 3U94A 4I62A 5DYHA 1NNKA 4EUOA 1SW5A 3C33A 3MZ1A 2REJA 2DWJA 1USYH 5TPAB 4R9FA 3OD7A 3TDJA 1FQCA 4QFPA 5ELVA 1NL5A 4RA1A 1NNFA 4G68A 4I9DA 4FE8A 2F8DA 4KCCA 1FQEA 5CMKA 3O28A 4MLVA 4QHQA 3T9XB 1MDQA 3TQWA 3LSFB 4ZEBA 3E4RA 1QUIA 4PFYA 5JEIA 3IOVA 3TUSA 4YB5A 1ANFA 3MPLA 4KYSA 3Q28A 4RK9A 3HPIA 2DXYA 5H8FA 2DSFA 3C4MA 2ZXTA 4N6PA 4HCYA 3HHFA 1Y4CA 4F1UA 1ZMGA 4QSEA 5I58A 1P1UA 3R6UA 4YKJA 4KPTA 4OTEA 3R26A 1P1NA 2X7QA 3VV5A 5L9OA 4DE8A 2ESNA 3IOTA 2QL3A 2ABHA 1URDA 3ILTB 2Z8EA 1I6BA 4ISUA 3UP9A 2I48A 4H0WA 2XXTA 5TPAA 4BDOA 4JWXA 1MPDA 1IIWA 1MM7A 1MS7A 4NTLA 3S9LC 2Y7PA 5DT6A 4GF8A 3O9PA 3SESA 1AL3A 4WEDA 4XKQA 2RINA 3K6VA 3OELA 1AMFA 3W9VA 1PB8A 4LZ8A 5IKBA 4QFOA 3CRBA 1N76A 1MY2A 3MP8A 1MXYA 3FVNA 1N84A 4LZ5A 2D21A 1Q1KA 2GHAA 3SDFA 3QAXA 1NNTA 4C1UA 5JTYB 4E0XA 1ZIUA 2RC8A 1D9YA 3DP6A 4MH5A 4U22A 5H8SA 2Q2AA 3PUZE 4F22A 3B7DA 3DM0A 4F3GA 5CM6A 3OENA 1LSTA 2QJEA 3MW0A 2XXWA 1FTOA 5M2VA 3CIJA 3VE1B 4H6DA 4NWCA 1NFTA 3PPOA 3EHSA 3B6WA 4KHZE 1URSA 4IB2A 2QS2A 4LONB 1PB7A 4X48A 4OFLA 4OZ9A 4HCWA 5HM4B 4Q30B 1OIBA 1R1NA 4WXJA 1M5CA 4GWOA 1CE2A 4QF9A 3SERA 4NF6B 4TQUQ 4DXBA 5KDTA 4MF3A 2QS4A 2V3QA 3KZGA 2XD2A 1B1XA 3RTWB 2V84A 5K2XA 3FV1A 1IEJA 3UORA 2F97A 1MXZA 4PFUA 3SEUA 1UQWA 1GTKA 2XXXA 4FEBA 4OQOA 4FORA 1NMUA 4EXLA 4ZE8A 5FTIA 3IORA 3PU5A 1JW4A 5CBSA 1LCFA 3VVEA 1JETA 1XC1A 3VLVA 4NF8B 3OMBA 1MM6A 2THIA 1MY3A 5TP9B 3C35A 3HSTA 4IY6A 1ZLQA 4NF4B 3FGSA 4OETA 3LUYA 2X7PA 4P11A 4ELRA 2QMXA 3PD8A 4YB6A 5AA3A 2DWAA 4KYEA 3H03A 4PE5B 3IAZA 1GVCA 2HQ0A 3TTMA 3MVWA 3LSWA 4NF6A 2AL5A 4JSDA 4GL8A 3Q29A 4QSCA 1SBPA 4EDPA 4XXUA 2REGA 4M1VA 4FATA 4RK2A 1QUKA 3U92A 4F1YA 3K2DA 3U93A 1B46A 2UYFA 1FTLA 2F6GA 5EYFA 2OJTA 3QXMA 1BLFA 4GXSB 1S50A 4DZ1A 3KN7A 3CFZA 3VFJA 5FHNA 3O97A 3OEKA 1VE4A 2DE4A 4ELPA 4GOTA 1LFGA 3M3LA 1M5FA 3C34A 1USYE 5CC2A 5CMCA 1YCJA 1B05A 2E0SA 4NF8A 1MY4A 5TP9A 4H8JA 4PFTA 1MY1A 2F7AA 2DWIA 3FATA 2NUVA 3MP1A 4MFIA 2XXHA 4ONYA 3F11A 5CI5A 1MH3A 4F39A 1DTGA 3K1PA 4NF5B 4HW8A 5HBCA 3S9EA 5H8NB 2HXWA 3ODBA 3WAFA 1LAXA 5FTHA 3G7WA 3O6GA 1MQGA 2XX8A 5ITPA 3CR9A 1M5DA 2Q88A 1P1QA 4H8IA 3ZSFA 1EU8A 2H4IA 4DCXA 5AE4A 3N6TA 4XKPA 4LA9A 3UIFA 3EQ1A 4BLAA 3KFMA 2ANJA 2RCBA 2D5WA 4F29A 1ZJLA 3KSXA 1B40A 4G77A 3TYHA 4KR5A 5ITOA 2XXYA 1US4A 4EF1A 3S2VA 3RY3A 5I84A 1B0HA 4THIA 4U21A 4NMYA 3VLWA 1MPBA 4C0RA 3I5OA 1PB9A 1B51A 4ZS9A 3RN8A 2Y7IA 5DVJA 1A55A 1IXCA 4RNSA 3L6HA 5FHMA 3N5LA 3QSLA 3RT6B 2G29A 2F5XA 2HAUA 1RYOA 4OXVA 3SEYA 1B58A 2F7CA 4H67A 4U2RA 4JDFA 3FZVA 5I2KB 1SYIA 5DVIA 1POTA 2FYIA 2O51A 4IO7A 4NF5A 5I58B 3I6VA 3TMGA 5H8NA 4O3CA 2VOZA 4YMAA 3Q26A 4DXUA 5AA2B 1FCKA 3T93B 3DP4A 4ZECA 3OOAA 3T9VA 3B6QA 4IO3A 4OERA 3IJOB 1PDAA 4UA8A 1HSEA 2UVGA 4GLIA 2WKYA 2R9JA 2V3TA 3MVYA 2FNCA 4X1BA 1AIVA 4GFRA 1WVJA 2V93A 3FJMA 3O29A 2P0SA 3K01A 1XS5A 5BUUA 3IOWA 1NH7A 3FV2A 4BDNA 3CI8A 3TCGA 3I3VA 3IB0A 3S4UA 1BIYA 1LB8A 1FTJA 3KJ7A 3PD9A 4YICA 2AL4A 5KZTA 4GRKA 3PGFA 4EQ7A 1PBPA 2DYXA 4U1OA 3UN6A 4ZEIA 4IO6A 3A3UA 1MG1A 2I0CA 3S9MC 1N3WA 1IQ7A 4GVOA 5CMMA 4AB6A 4G68C 4U23A 2VD2A 1MRPA 2DP8A 5I2KA 3TTNA 2OLBA 1JVXA 4H5GA 4BDMA 2Y84A 4IO2A 3AXFA 2XX9A 1ATGA 3RLFE 1OVBA 3FIRA 4F1VA 5AA2A 1LB9A 3FVGA 1POY1 1F9BA 5L8DA 3V8XB 4QFLA 3FVKA 1VFEA 1NH8A 2CMOA 5EHMA 1LAGE 3QK6A 2H98A 3PPNA 3PPPA 2VP1A 1O7TA 2I4CA 3QYTA 1UTHB 3GBBA 3T22A 1MY0A 2VHAA 2IA4A 5KDTB 3FASA 1MH4A 1A7LA 1OQGA 1EZ9A 1I69A 1YTVA 4ELOA 1B3GA 2B3BA 1BKAA 1R9LA 4KI0E 4IGTA 1R6ZA 1XOCA 3MZ9A 1HSJA 2NXOA 1JVYA 1QULA 3T9UA 3MBPA 2I3WA 2O7IA 5JK4A 1SVXB 4RXLA 1B0LA 5A5XA 1B3HA 1FQDA 4E0WA 3PUXE 1BP5A 3E13X 4QSDA 1MQHA 1B7HA 4WKMA 3PMXA 3IB2A 2AIXA 4RYAA 4RJZA 3O66A 4JXIA 3TZAA 2FA7A 5EHSA 3PMWA 2XXRA 3N94A 3PUWE 1LGBC 1XVXA 3PPQA 5DVFA 3MAMA 4RY1A 1D3KA 4YZZA 3KSJA 2PX1A 2HFBA 4OYVA 1SI1A 1B7UA 1UTHA 4EF2A 3OO7A 3CFXA 4UACA 4X9TA 4Q5TA 4OENA 1LFHA 5ICQA 4BDLA 2YPNA 4OHNA 3FXRA 1O64A 4AB5A 4XKNA 3ZKKA 2UVHA 1D4NA 3ECRA 4F19A 4PFWA 2DQVA 4HS7A 1LLSA 4FJPA 2XX7A 2QPQA 2RC7A 1FQFA 3LBSA 3S9NC 2ZNUA 1MXWA 4LZ7A 4BDRA 3H6UA 3T66A 1IXIA 1DPEA 5CBRA 3D4CA 3HHGA 4YKIA 3W15C 3KEIA 1DTZA 4F2OA 4OWDA 2HCAA 4KQPA 3SEWA 4LP2B 3KG2A 3UGWA 4RPOA 3O2AA 4U4SA 1R9QA 4YAHX 3IB1A 2XXQA 3CFLA 4XTCQ 5LOMA 3SEXA 1Z7NE 4ZZAA 1MDP1 4M4GA 1GR2A 4QFKA 3RQTA 1IITA 2H9BA 1N0TA 1P99A 3JZJA 1SI0A 2Y7WA 3K6XA 5CRYA 1SW1A 1A8FA 5I2NB 4YKKA 3PPRA 2ZYKA 3BFTA 4G8HA 3BFUA 3R7XA 5I56B 2I49A 4HTGA 2OCUA 2QSXA 2F7BA 5B70A 5L9MA 1MPCA 3VVDA 1US5A 1OQHA 4P0GA 3VLUA 3UK4A 3IOUA 2YJPA 2Q9TA 3THIA 2GH9A 5HPQA 2I6EA 3HO7A 4G2ZA 4DDDA 1Y9UA 5DTBA 3MVZA 2DE3A 2R71A 3G3HA 1L5TA 1Y1MA 4G8NA 1TT1A 3V83A 4G8MA 3GZGA 3U8QA 4EXKA 3G3IA 3TTLA 3ONMA 4R72A 4Q0CA 1H76A 1SQYA 1MXXA 3CSGA 1MQIA 1LCTA 2ZMBA 3SETA 4YMBA 2D3IA 4ZEKA 4X1DA 4F31B 2UYEA 4QRZA 4YB7A 4JWOA 1DMBA 3TTKA 1IZ1A 4YU0A 4I8CA 3C31A 3T9HB 2XXVA 3MWBA 2F78A 4O3BA 5I2NA 1IXHA 4XKRA 2H5YA 3FVOA 2I3VA 2XD3A 3TPAA 1B2HA 3MUQA 5I56A 3M3KA 2A5SA 1B7ZA 2XXIA 4LUBA 4NWDA 1N3XA 3JYRA 3A3CA 4KCDA 3MPKA 3OXNA 4RPNA 4N07A 1JEVA 3EF7A 1ZU0A 1FQBA 1WDNA 3RTFB 1SD3A 1QKBA 3FXQA 3H6VA 1KWHA 3E9XA 1H43A 2X26A 4BDQA 3OSQA 2Z8DA 1Y3PA 1ZBMA 2RF1A 4Z7EA 1MQJA 1TFAA 3LC8A 2DE2A 2H99A 5F7VA 3QUJA 1PEBA 3RPWA 1MXVA 3TEPA 1OLAA 3FXUA 3K00A 2HZLA 1H3DA 3MC2A 1OLCA 4FECA 4KFQA 1TXFA 4ZEDA 3N6UA 2NVUB 3H4ZA 4NEDA 3V5AA 3LR1A 4TLLB 3VXCA 5KCJA 4OESA 4F3SA 2ZNSA 2O1LA 1A99A 1J1NA 2PT2A 2Q2CA 2CZLA 3FJ7A 1B3EA 1Q35A 2DOJA 4L17A 1AH5A 1AOVA 1M5EA 2QS1A 2VGQA 3VDFA 4DCYA 2AYSA 1Y1ZA 3M3FA 1A8EA 1FQAA 1P1WA 2NWJA 5H8HB 5ICTA 1TFDA 1TWYA 1SW2A 1VR5A 3H6TA 2PBWA 3U72A 4XIGQ 1DSNA 4IGRA 3OO6A 1SW4A 4LVQA 3EN3A 2PVUA 1A40A 3TFLA 4G4PA 5L9SA 1O63A 3ZS6A 5ISUA 3QIMA 3PMVA 3L6GA 5AA4A 1NNPA 3FJGA 4GXAA 1QUJA 4POWA 2O7UA 1JW1A 5A5XB 2O1MA 1N04A 5BWJA 4TLMB 4IY5A 1ZKBA 2BJJX 4Q8RA 2ONSA 1GGGA 2P1SA 4H1XA 1QVSA 1IUDA 2G93A 3IO4A 1B5HA 3C32A 2Q8JA 2M8CA 3DLNA 2ZNTA 4F18A 3IJXB 3GLBA 3LSLA 3CVGA 3T96B 2I4BA 3TKDA 2OBGA 2XHDA 4ZZEA 4R9GA 4F3PA 5H8HA 4R2BA 4GQOA 1SYHA 1II5A 3MZBA 4H65A 4R75A 2Z22A 2ZYMA 2V3UA 1DOTA 3K02A 4U1ZA 1RYXA 3PV0E 4O3AA 3G3KA 3G3FA 2QRYA 1OVTA 3KOTA 3E3KA 2B3FA 3KN3A 4AQ4A 2HAVA 1XHYA 3FUZA 4ZE9A 1B4HA 3Q25A 3MP6A 4GD5A 3M8UA 4K3FA 3VVFA 3G3JA 1A54A 1M5BA 1Z7ME 4ZEFA 2Q89A 3B6TA 4EQBA 1N7XA 4ESWA 1B3FA 4JBZA 4R2FA 1FTKA 4F3BA 3KGCA 1UTBB 2ZYOA 4MBPA 2F34A 1ZTYA 2GHBA 4OFOA 4PP0A 3G3GA 3ZKLA 1BTJA 2O69A 2R6GE 1PC3A 1MQDA 3HV1A 4IO5A 5CMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJT A;  5IAI A;  2RCA A;  4ND9 A;  4WEP A;  1SDX A;  1LBC A;  4GL0 A;  1GV8 A;  2DS9 A;  4PET A;  3C9H A;  3SKP A;  3IK6 B;  3DEL B;  2I58 A;  2PT1 A;  5B7D A;  3OO9 A;  1B32 A;  3WAE A;  1FW0 A;  2H25 A;  5AA2 D;  1QJM A;  1B1H A;  3KN8 A;  4N13 A;  1S7Y A;  3V89 B;  4DXC A;  1XT8 A;  4R73 A;  4IO4 A;  3VXB A;  1VFD A;  1XVY A;  3HCQ A;  4OEV A;  4EQ9 A;  2I0B A;  1EZP A;  4POX A;  2HZK A;  2V25 A;  5JTY A;  3IX1 A;  1I6A A;  3DP8 A;  3RNN A;  1H44 A;  2PYY A;  3MQ9 A;  2LAO A;  3K4U A;  4JSO A;  3O6I A;  1Y20 A;  3O6H A;  1H45 A;  1I6Q A;  1UTB A;  2DVZ A;  3TOD A;  1FTM A;  2YLN A;  2XXP A;  5DEX B;  4LQ5 A;  1JNF A;  4FED A;  5TU0 A;  4DLD A;  3BBR A;  1EH3 A;  1WOD A;  4JB7 A;  5F1Q A;  1ELJ A;  4R6H A;  2RC9 A;  4ELQ A;  2O6A A;  2PMS A;  1EZO A;  1N7W A;  3U1O A;  5H8Q B;  5K2Y A;  4TOZ A;  3TAJ A;  4ECF A;  4PQJ A;  2UVJ A;  1B5I A;  1UIU A;  1OMP A;  1LBB A;  3HN0 A;  1RKM A;  4QFN A;  3K6W A;  3H06 B;  2DVC A;  2Y7K A;  3UA8 A;  2KLF A;  4KD5 A;  2DXR A;  2OK2 A;  2Y7R A;  3GXA A;  3KBR A;  1B5J A;  4OFJ A;  4MLQ A;  5I57 B;  1LFI A;  2RKM A;  1D9V A;  2P2A A;  3H7M A;  3TEL A;  4LAT A;  1Y4T A;  3BKI B;  1CB6 A;  3LSX A;  3IL1 B;  1LAH E;  4I1D A;  5FHO A;  3P7I A;  1URG A;  3TCH A;  2ONR A;  3IO6 A;  5I59 B;  2ONK E;  3OEM A;  3H3G A;  2NOO A;  2QS3 A;  1UIV A;  2W7Y A;  3GBA A;  1P1O A;  1PBQ A;  1MXU A;  3RGY A;  3TQL A;  3D4G A;  2F35 A;  5DEX A;  3PUV E;  3CG3 A;  3K1N A;  4FIM A;  2A5T B;  4NF4 A;  3RUM A;  3Q27 A;  1JEU A;  1QW0 A;  4C1T A;  5KCJ B;  4NE4 A;  3JV9 A;  4YKP A;  5H8Q A;  2ALU A;  1QKA A;  4ESX A;  4Z0I A;  4OEU A;  2GRV A;  3K6U A;  4OMB A;  2HEU A;  2F6P A;  4LQ2 A;  1B3L A;  3A09 A;  4GIZ A;  4R6K A;  2OWT A;  5AA1 A;  2IEE A;  3KOS A;  3K0V A;  3EPE A;  2Z23 A;  2F36 A;  2Z8F A;  4OVJ A;  3CG1 A;  1JQF A;  2ZYN A;  1Y3N A;  2XXU A;  2OZZ A;  3MVX A;  5I57 A;  3RT8 A;  1DPP A;  3N26 A;  3OSR A;  3EHT A;  2B65 A;  2UVI A;  3TTR A;  4ZDM A;  4F2Q A;  3W9W A;  3C36 A;  4G68 B;  1NKX A;  4R6Y A;  4P0I A;  2GFE A;  3OO8 A;  3USD A;  1S9T A;  2DWH A;  1B4Z A;  5I59 A;  5AA4 B;  5J1D A;  2VD3 A;  3IR1 A;  3SEV A;  3CSB A;  2E1S A;  3QUF A;  3PUY E;  3K1M A;  1B9J A;  1JW5 A;  3TCF A;  1HSL A;  2A5T A;  4KYD A;  3EHU A;  1YAE A;  2O84 X;  1IXG A;  5H8F B;  4FAJ A;  1B6H A;  3H6W A;  4JWY A;  2UXA A;  4U4X A;  1B52 A;  1T0K A;  4H5F A;  2QMW A;  2O68 A;  1YPN A;  4R74 A;  3ILU B;  3MJN A;  2OWS A;  1LAF E;  1VSO A;  1Y3Q A;  3FD3 A;  4DIG A;  3U94 A;  4I62 A;  5DYH A;  1NNK A;  4EUO A;  1SW5 A;  3C33 A;  3MZ1 A;  2REJ A;  2DWJ A;  1USY H;  5TPA B;  4R9F A;  3OD7 A;  3TDJ A;  1FQC A;  4QFP A;  5ELV A;  1NL5 A;  4RA1 A;  1NNF A;  4G68 A;  4I9D A;  4FE8 A;  2F8D A;  4KCC A;  1FQE A;  5CMK A;  3O28 A;  4MLV A;  4QHQ A;  3T9X B;  1MDQ A;  3TQW A;  3LSF B;  4ZEB A;  3E4R A;  1QUI A;  4PFY A;  5JEI A;  3IOV A;  3TUS A;  4YB5 A;  1ANF A;  3MPL A;  4KYS A;  3Q28 A;  4RK9 A;  3HPI A;  2DXY A;  5H8F A;  2DSF A;  3C4M A;  2ZXT A;  4N6P A;  4HCY A;  3HHF A;  1Y4C A;  4F1U A;  1ZMG A;  4QSE A;  5I58 A;  1P1U A;  3R6U A;  4YKJ A;  4KPT A;  4OTE A;  3R26 A;  1P1N A;  2X7Q A;  3VV5 A;  5L9O A;  4DE8 A;  2ESN A;  3IOT A;  2QL3 A;  2ABH A;  1URD A;  3ILT B;  2Z8E A;  1I6B A;  4ISU A;  3UP9 A;  2I48 A;  4H0W A;  2XXT A;  5TPA A;  4BDO A;  4JWX A;  1MPD A;  1IIW A;  1MM7 A;  1MS7 A;  4NTL A;  3S9L C;  2Y7P A;  5DT6 A;  4GF8 A;  3O9P A;  3SES A;  1AL3 A;  4WED A;  4XKQ A;  2RIN A;  3K6V A;  3OEL A;  1AMF A;  3W9V A;  1PB8 A;  4LZ8 A;  5IKB A;  4QFO A;  3CRB A;  1N76 A;  1MY2 A;  3MP8 A;  1MXY A;  3FVN A;  1N84 A;  4LZ5 A;  2D21 A;  1Q1K A;  2GHA A;  3SDF A;  3QAX A;  1NNT A;  4C1U A;  5JTY B;  4E0X A;  1ZIU A;  2RC8 A;  1D9Y A;  3DP6 A;  4MH5 A;  4U22 A;  5H8S A;  2Q2A A;  3PUZ E;  4F22 A;  3B7D A;  3DM0 A;  4F3G A;  5CM6 A;  3OEN A;  1LST A;  2QJE A;  3MW0 A;  2XXW A;  1FTO A;  5M2V A;  3CIJ A;  3VE1 B;  4H6D A;  4NWC A;  1NFT A;  3PPO A;  3EHS A;  3B6W A;  4KHZ E;  1URS A;  4IB2 A;  2QS2 A;  4LON B;  1PB7 A;  4X48 A;  4OFL A;  4OZ9 A;  4HCW A;  5HM4 B;  4Q30 B;  1OIB A;  1R1N A;  4WXJ A;  1M5C A;  4GWO A;  1CE2 A;  4QF9 A;  3SER A;  4NF6 B;  4TQU Q;  4DXB A;  5KDT A;  4MF3 A;  2QS4 A;  2V3Q A;  3KZG A;  2XD2 A;  1B1X A;  3RTW B;  2V84 A;  5K2X A;  3FV1 A;  1IEJ A;  3UOR A;  2F97 A;  1MXZ A;  4PFU A;  3SEU A;  1UQW A;  1GTK A;  2XXX A;  4FEB A;  4OQO A;  4FOR A;  1NMU A;  4EXL A;  4ZE8 A;  5FTI A;  3IOR A;  3PU5 A;  1JW4 A;  5CBS A;  1LCF A;  3VVE A;  1JET A;  1XC1 A;  3VLV A;  4NF8 B;  3OMB A;  1MM6 A;  2THI A;  1MY3 A;  5TP9 B;  3C35 A;  3HST A;  4IY6 A;  1ZLQ A;  4NF4 B;  3FGS A;  4OET A;  3LUY A;  2X7P A;  4P11 A;  4ELR A;  2QMX A;  3PD8 A;  4YB6 A;  5AA3 A;  2DWA A;  4KYE A;  3H03 A;  4PE5 B;  3IAZ A;  1GVC A;  2HQ0 A;  3TTM A;  3MVW A;  3LSW A;  4NF6 A;  2AL5 A;  4JSD A;  4GL8 A;  3Q29 A;  4QSC A;  1SBP A;  4EDP A;  4XXU A;  2REG A;  4M1V A;  4FAT A;  4RK2 A;  1QUK A;  3U92 A;  4F1Y A;  3K2D A;  3U93 A;  1B46 A;  2UYF A;  1FTL A;  2F6G A;  5EYF A;  2OJT A;  3QXM A;  1BLF A;  4GXS B;  1S50 A;  4DZ1 A;  3KN7 A;  3CFZ A;  3VFJ A;  5FHN A;  3O97 A;  3OEK A;  1VE4 A;  2DE4 A;  4ELP A;  4GOT A;  1LFG A;  3M3L A;  1M5F A;  3C34 A;  1USY E;  5CC2 A;  5CMC A;  1YCJ A;  1B05 A;  2E0S A;  4NF8 A;  1MY4 A;  5TP9 A;  4H8J A;  4PFT A;  1MY1 A;  2F7A A;  2DWI A;  3FAT A;  2NUV A;  3MP1 A;  4MFI A;  2XXH A;  4ONY A;  3F11 A;  5CI5 A;  1MH3 A;  4F39 A;  1DTG A;  3K1P A;  4NF5 B;  4HW8 A;  5HBC A;  3S9E A;  5H8N B;  2HXW A;  3ODB A;  3WAF A;  1LAX A;  5FTH A;  3G7W A;  3O6G A;  1MQG A;  2XX8 A;  5ITP A;  3CR9 A;  1M5D A;  2Q88 A;  1P1Q A;  4H8I A;  3ZSF A;  1EU8 A;  2H4I A;  4DCX A;  5AE4 A;  3N6T A;  4XKP A;  4LA9 A;  3UIF A;  3EQ1 A;  4BLA A;  3KFM A;  2ANJ A;  2RCB A;  2D5W A;  4F29 A;  1ZJL A;  3KSX A;  1B40 A;  4G77 A;  3TYH A;  4KR5 A;  5ITO A;  2XXY A;  1US4 A;  4EF1 A;  3S2V A;  3RY3 A;  5I84 A;  1B0H A;  4THI A;  4U21 A;  4NMY A;  3VLW A;  1MPB A;  4C0R A;  3I5O A;  1PB9 A;  1B51 A;  4ZS9 A;  3RN8 A;  2Y7I A;  5DVJ A;  1A55 A;  1IXC A;  4RNS A;  3L6H A;  5FHM A;  3N5L A;  3QSL A;  3RT6 B;  2G29 A;  2F5X A;  2HAU A;  1RYO A;  4OXV A;  3SEY A;  1B58 A;  2F7C A;  4H67 A;  4U2R A;  4JDF A;  3FZV A;  5I2K B;  1SYI A;  5DVI A;  1POT A;  2FYI A;  2O51 A;  4IO7 A;  4NF5 A;  5I58 B;  3I6V A;  3TMG A;  5H8N A;  4O3C A;  2VOZ A;  4YMA A;  3Q26 A;  4DXU A;  5AA2 B;  1FCK A;  3T93 B;  3DP4 A;  4ZEC A;  3OOA A;  3T9V A;  3B6Q A;  4IO3 A;  4OER A;  3IJO B;  1PDA A;  4UA8 A;  1HSE A;  2UVG A;  4GLI A;  2WKY A;  2R9J A;  2V3T A;  3MVY A;  2FNC A;  4X1B A;  1AIV A;  4GFR A;  1WVJ A;  2V93 A;  3FJM A;  3O29 A;  2P0S A;  3K01 A;  1XS5 A;  5BUU A;  3IOW A;  1NH7 A;  3FV2 A;  4BDN A;  3CI8 A;  3TCG A;  3I3V A;  3IB0 A;  3S4U A;  1BIY A;  1LB8 A;  1FTJ A;  3KJ7 A;  3PD9 A;  4YIC A;  2AL4 A;  5KZT A;  4GRK A;  3PGF A;  4EQ7 A;  1PBP A;  2DYX A;  4U1O A;  3UN6 A;  4ZEI A;  4IO6 A;  3A3U A;  1MG1 A;  2I0C A;  3S9M C;  1N3W A;  1IQ7 A;  4GVO A;  5CMM A;  4AB6 A;  4G68 C;  4U23 A;  2VD2 A;  1MRP A;  2DP8 A;  5I2K A;  3TTN A;  2OLB A;  1JVX A;  4H5G A;  4BDM A;  2Y84 A;  4IO2 A;  3AXF A;  2XX9 A;  1ATG A;  3RLF E;  1OVB A;  3FIR A;  4F1V A;  5AA2 A;  1LB9 A;  3FVG A;  1POY 1;  1F9B A;  5L8D A;  3V8X B;  4QFL A;  3FVK A;  1VFE A;  1NH8 A;  2CMO A;  5EHM A;  1LAG E;  3QK6 A;  2H98 A;  3PPN A;  3PPP A;  2VP1 A;  1O7T A;  2I4C A;  3QYT A;  1UTH B;  3GBB A;  3T22 A;  1MY0 A;  2VHA A;  2IA4 A;  5KDT B;  3FAS A;  1MH4 A;  1A7L A;  1OQG A;  1EZ9 A;  1I69 A;  1YTV A;  4ELO A;  1B3G A;  2B3B A;  1BKA A;  1R9L A;  4KI0 E;  4IGT A;  1R6Z A;  1XOC A;  3MZ9 A;  1HSJ A;  2NXO A;  1JVY A;  1QUL A;  3T9U A;  3MBP A;  2I3W A;  2O7I A;  5JK4 A;  1SVX B;  4RXL A;  1B0L A;  5A5X A;  1B3H A;  1FQD A;  4E0W A;  3PUX E;  1BP5 A;  3E13 X;  4QSD A;  1MQH A;  1B7H A;  4WKM A;  3PMX A;  3IB2 A;  2AIX A;  4RYA A;  4RJZ A;  3O66 A;  4JXI A;  3TZA A;  2FA7 A;  5EHS A;  3PMW A;  2XXR A;  3N94 A;  3PUW E;  1LGB C;  1XVX A;  3PPQ A;  5DVF A;  3MAM A;  4RY1 A;  1D3K A;  4YZZ A;  3KSJ A;  2PX1 A;  2HFB A;  4OYV A;  1SI1 A;  1B7U A;  1UTH A;  4EF2 A;  3OO7 A;  3CFX A;  4UAC A;  4X9T A;  4Q5T A;  4OEN A;  1LFH A;  5ICQ A;  4BDL A;  2YPN A;  4OHN A;  3FXR A;  1O64 A;  4AB5 A;  4XKN A;  3ZKK A;  2UVH A;  1D4N A;  3ECR A;  4F19 A;  4PFW A;  2DQV A;  4HS7 A;  1LLS A;  4FJP A;  2XX7 A;  2QPQ A;  2RC7 A;  1FQF A;  3LBS A;  3S9N C;  2ZNU A;  1MXW A;  4LZ7 A;  4BDR A;  3H6U A;  3T66 A;  1IXI A;  1DPE A;  5CBR A;  3D4C A;  3HHG A;  4YKI A;  3W15 C;  3KEI A;  1DTZ A;  4F2O A;  4OWD A;  2HCA A;  4KQP A;  3SEW A;  4LP2 B;  3KG2 A;  3UGW A;  4RPO A;  3O2A A;  4U4S A;  1R9Q A;  4YAH X;  3IB1 A;  2XXQ A;  3CFL A;  4XTC Q;  5LOM A;  3SEX A;  1Z7N E;  4ZZA A;  1MDP 1;  4M4G A;  1GR2 A;  4QFK A;  3RQT A;  1IIT A;  2H9B A;  1N0T A;  1P99 A;  3JZJ A;  1SI0 A;  2Y7W A;  3K6X A;  5CRY A;  1SW1 A;  1A8F A;  5I2N B;  4YKK A;  3PPR A;  2ZYK A;  3BFT A;  4G8H A;  3BFU A;  3R7X A;  5I56 B;  2I49 A;  4HTG A;  2OCU A;  2QSX A;  2F7B A;  5B70 A;  5L9M A;  1MPC A;  3VVD A;  1US5 A;  1OQH A;  4P0G A;  3VLU A;  3UK4 A;  3IOU A;  2YJP A;  2Q9T A;  3THI A;  2GH9 A;  5HPQ A;  2I6E A;  3HO7 A;  4G2Z A;  4DDD A;  1Y9U A;  5DTB A;  3MVZ A;  2DE3 A;  2R71 A;  3G3H A;  1L5T A;  1Y1M A;  4G8N A;  1TT1 A;  3V83 A;  4G8M A;  3GZG A;  3U8Q A;  4EXK A;  3G3I A;  3TTL A;  3ONM A;  4R72 A;  4Q0C A;  1H76 A;  1SQY A;  1MXX A;  3CSG A;  1MQI A;  1LCT A;  2ZMB A;  3SET A;  4YMB A;  2D3I A;  4ZEK A;  4X1D A;  4F31 B;  2UYE A;  4QRZ A;  4YB7 A;  4JWO A;  1DMB A;  3TTK A;  1IZ1 A;  4YU0 A;  4I8C A;  3C31 A;  3T9H B;  2XXV A;  3MWB A;  2F78 A;  4O3B A;  5I2N A;  1IXH A;  4XKR A;  2H5Y A;  3FVO A;  2I3V A;  2XD3 A;  3TPA A;  1B2H A;  3MUQ A;  5I56 A;  3M3K A;  2A5S A;  1B7Z A;  2XXI A;  4LUB A;  4NWD A;  1N3X A;  3JYR A;  3A3C A;  4KCD A;  3MPK A;  3OXN A;  4RPN A;  4N07 A;  1JEV A;  3EF7 A;  1ZU0 A;  1FQB A;  1WDN A;  3RTF B;  1SD3 A;  1QKB A;  3FXQ A;  3H6V A;  1KWH A;  3E9X A;  1H43 A;  2X26 A;  4BDQ A;  3OSQ A;  2Z8D A;  1Y3P A;  1ZBM A;  2RF1 A;  4Z7E A;  1MQJ A;  1TFA A;  3LC8 A;  2DE2 A;  2H99 A;  5F7V A;  3QUJ A;  1PEB A;  3RPW A;  1MXV A;  3TEP A;  1OLA A;  3FXU A;  3K00 A;  2HZL A;  1H3D A;  3MC2 A;  1OLC A;  4FEC A;  4KFQ A;  1TXF A;  4ZED A;  3N6U A;  2NVU B;  3H4Z A;  4NED A;  3V5A A;  3LR1 A;  4TLL B;  3VXC A;  5KCJ A;  4OES A;  4F3S A;  2ZNS A;  2O1L A;  1A99 A;  1J1N A;  2PT2 A;  2Q2C A;  2CZL A;  3FJ7 A;  1B3E A;  1Q35 A;  2DOJ A;  4L17 A;  1AH5 A;  1AOV A;  1M5E A;  2QS1 A;  2VGQ A;  3VDF A;  4DCY A;  2AYS A;  1Y1Z A;  3M3F A;  1A8E A;  1FQA A;  1P1W A;  2NWJ A;  5H8H B;  5ICT A;  1TFD A;  1TWY A;  1SW2 A;  1VR5 A;  3H6T A;  2PBW A;  3U72 A;  4XIG Q;  1DSN A;  4IGR A;  3OO6 A;  1SW4 A;  4LVQ A;  3EN3 A;  2PVU A;  1A40 A;  3TFL A;  4G4P A;  5L9S A;  1O63 A;  3ZS6 A;  5ISU A;  3QIM A;  3PMV A;  3L6G A;  5AA4 A;  1NNP A;  3FJG A;  4GXA A;  1QUJ A;  4POW A;  2O7U A;  1JW1 A;  5A5X B;  2O1M A;  1N04 A;  5BWJ A;  4TLM B;  4IY5 A;  1ZKB A;  2BJJ X;  4Q8R A;  2ONS A;  1GGG A;  2P1S A;  4H1X A;  1QVS A;  1IUD A;  2G93 A;  3IO4 A;  1B5H A;  3C32 A;  2Q8J A;  2M8C A;  3DLN A;  2ZNT A;  4F18 A;  3IJX B;  3GLB A;  3LSL A;  3CVG A;  3T96 B;  2I4B A;  3TKD A;  2OBG A;  2XHD A;  4ZZE A;  4R9G A;  4F3P A;  5H8H A;  4R2B A;  4GQO A;  1SYH A;  1II5 A;  3MZB A;  4H65 A;  4R75 A;  2Z22 A;  2ZYM A;  2V3U A;  1DOT A;  3K02 A;  4U1Z A;  1RYX A;  3PV0 E;  4O3A A;  3G3K A;  3G3F A;  2QRY A;  1OVT A;  3KOT A;  3E3K A;  2B3F A;  3KN3 A;  4AQ4 A;  2HAV A;  1XHY A;  3FUZ A;  4ZE9 A;  1B4H A;  3Q25 A;  3MP6 A;  4GD5 A;  3M8U A;  4K3F A;  3VVF A;  3G3J A;  1A54 A;  1M5B A;  1Z7M E;  4ZEF A;  2Q89 A;  3B6T A;  4EQB A;  1N7X A;  4ESW A;  1B3F A;  4JBZ A;  4R2F A;  1FTK A;  4F3B A;  3KGC A;  1UTB B;  2ZYO A;  4MBP A;  2F34 A;  1ZTY A;  2GHB A;  4OFO A;  4PP0 A;  3G3G A;  3ZKL A;  1BTJ A;  2O69 A;  2R6G E;  1PC3 A;  1MQD A;  3HV1 A;  4IO5 A;  5CMB A; 
#chains in the Genus database with same CATH topology
 3KJT A;  5IAI A;  2RCA A;  4ND9 A;  4WEP A;  1SDX A;  1LBC A;  4GL0 A;  2EMI A;  1N36 E;  1GV8 A;  2DS9 A;  4PET A;  2J7J A;  3C9H A;  3SKP A;  3IK6 B;  4DV6 E;  3DEL B;  2I58 A;  1RQ0 A;  2PT1 A;  5B7D A;  3NOH A;  3OO9 A;  1B32 A;  3WAE A;  1FW0 A;  2JJK A;  2H25 A;  2L2N A;  4X8W A;  5AA2 D;  2JY9 A;  1QJM A;  1IMC A;  1B1H A;  3KN8 A;  4N13 A;  2YTF A;  2RSI A;  1S7Y A;  4B3M E;  5J16 A;  3V89 B;  3FBP A;  4DXC A;  1XT8 A;  4R73 A;  2EM0 A;  2XA5 A;  4IO4 A;  1J26 A;  3VXB A;  1VFD A;  2V86 A;  4N91 A;  1XVY A;  3HCQ A;  4BCA A;  4OEV A;  4EQ9 A;  3JTZ A;  1X47 A;  2I0B A;  4NAP A;  1EZP A;  4POX A;  2HZK A;  4L8N A;  4DV0 E;  2DMY A;  2V25 A;  4FBP A;  2BJI A;  5JTY A;  3IX1 A;  2EM5 A;  1FPJ A;  3F6H A;  5A69 A;  4LF4 E;  1I6A A;  3DP8 A;  3RNN A;  1H44 A;  1RDX A;  2PYY A;  3MQ9 A;  2LAO A;  3K4U A;  4JSO A;  3O6I A;  1Y20 A;  3O6H A;  3F6G A;  1H45 A;  1I6Q A;  2L2M A;  2EN8 A;  1N3G A;  1NUZ A;  1O0W A;  1AAY A;  1UTB A;  1G2D C;  2DVZ A;  3TOD A;  1FTM A;  2YLN A;  2XXP A;  5DEX B;  4H46 A;  1NUY A;  4LQ5 A;  5DW8 A;  4GZN C;  4N6D A;  4DV2 E;  1JNF A;  4FED A;  3J80 C;  5TU0 A;  4DLD A;  2G7H A;  5T6J A;  3BBR A;  1EH3 A;  1WOD A;  4JB7 A;  5F1Q A;  1ELJ A;  4R6H A;  2RC9 A;  4ELQ A;  2O6A A;  4DKK A;  4L5N C;  2PMS A;  1EZO A;  4MNC A;  1N7W A;  3U1O A;  5H8Q B;  5K2Y A;  4TOZ A;  3TAJ A;  4ECF A;  4PQJ A;  2UVJ A;  1SPI A;  1B5I A;  1NV3 A;  1UIU A;  2YTO A;  1OMP A;  1LBB A;  3HN0 A;  1RKM A;  4QFN A;  4M0V A;  1TN9 A;  4JVI A;  1X6E A;  3K6W A;  4WXC A;  3H06 B;  1NV7 A;  2DVC A;  2Y7K A;  5KL4 A;  3UA8 A;  4OA4 A;  2UXC E;  2KLF A;  4KD5 A;  2DXR A;  4R2E A;  2OK2 A;  2EN6 A;  2Y7R A;  3GXA A;  3KBR A;  2WZO A;  1VDW A;  4GWU A;  1B5J A;  4OFJ A;  4MLQ A;  4JI0 E;  5I57 B;  4X9J A;  5AAS A;  1LFI A;  2RKM A;  1D9V A;  2P2A A;  3H7M A;  4MX6 A;  3TEL A;  4LAT A;  1Y4T A;  3BKI B;  1CB6 A;  3L00 A;  3LSX A;  4O43 A;  3IL1 B;  3E78 A;  1LAH E;  4I1D A;  5LDZ A;  5FHO A;  3P7I A;  1URG A;  3TCH A;  1FBD A;  1HR0 E;  2ONR A;  2YTD A;  3IO6 A;  2K4V A;  2BBG A;  5I59 B;  4GBV A;  4R2A A;  2ONK E;  1T39 A;  4PAI A;  3OEM A;  3H3G A;  2NOO A;  2QS3 A;  1UIV A;  2W7Y A;  1STU A;  3GBA A;  3ISP A;  3LML A;  1GQE A;  1P1O A;  1PBQ A;  1MXU A;  3RGY A;  3TQL A;  3OTO E;  4BHB A;  3D4G A;  2F35 A;  5DEX A;  3PUV E;  4JI3 E;  5LMN E;  4DV4 E;  3CG3 A;  3K1N A;  5IZ3 A;  1WRJ A;  4FIM A;  2A5T B;  2L3J A;  1EH7 A;  4NF4 A;  4PFR A;  3T1Y E;  3CHG A;  5F3W A;  3RUM A;  3Q27 A;  1JEU A;  1QW0 A;  5A6J A;  4C1T A;  3BID A;  2R1F A;  5KCJ B;  1UIL A;  4NE4 A;  1IBM E;  3JV9 A;  5KL2 A;  4YKP A;  5H8Q A;  1YYK A;  4BMJ A;  3TQM A;  2ALU A;  1MEY C;  2V8Q B;  2CPN A;  4PGP A;  2QFL A;  1QKA A;  4ESX A;  1L4S A;  4Z0I A;  2EWL A;  4OEU A;  2GRV A;  3K6U A;  4OMB A;  3KC1 A;  2HEU A;  2F6P A;  4LQ2 A;  1B3L A;  3A09 A;  4GIZ A;  1PJQ A;  4R6K A;  2OWT A;  5ESY A;  2IEE A;  3KOS A;  5AA1 A;  3K0V A;  3EPE A;  2Z23 A;  2EOQ A;  2EPK X;  2F36 A;  4JI6 E;  2Z8F A;  2YRH A;  3OML A;  1NV2 A;  4OVJ A;  4LF9 E;  1FBG A;  3CG1 A;  2WYK A;  1JQF A;  2DB2 A;  2YTJ A;  5IV8 B;  2ZYN A;  3C6K A;  1Y3N A;  2XXU A;  2KHX A;  2EOR A;  2OZZ A;  3MVX A;  5I57 A;  3RT8 A;  1DPP A;  3N26 A;  2UU9 E;  3OSR A;  2EJ4 A;  4NF0 A;  3EHT A;  4DI4 B;  2PFZ A;  3C4T A;  2B65 A;  2DDK A;  4ZYE A;  2UVI A;  3TTR A;  4GX6 A;  4ZDM A;  4F2Q A;  1SR9 A;  1YYZ A;  3W9W A;  3C36 A;  4G68 B;  1NKX A;  4R6Y A;  1WJP A;  2YTP A;  4P0I A;  2GFE A;  3OO8 A;  3USD A;  1ZAA C;  1S9T A;  2DWH A;  1NEI A;  1B4Z A;  5I59 A;  5AA4 B;  5J1D A;  4YY3 E;  2WBU A;  2VD3 A;  3IR1 A;  2CSH A;  3SEV A;  5ADZ A;  3IWB A;  3CSB A;  2E1S A;  1YYO A;  3QUF A;  4P56 A;  3PUY E;  3K1M A;  4MNI A;  1B9J A;  4GX3 A;  1JW5 A;  3TCF A;  1FBE A;  1HSL A;  2A5T A;  4F9C B;  3IWD A;  4KYD A;  2CT1 A;  2WEF A;  3THO B;  3EHU A;  1YAE A;  2O84 X;  1IXG A;  2LE2 A;  5H8F B;  4O94 A;  4FAJ A;  1B6H A;  3VYY A;  3H6W A;  4JWY A;  5EQ7 A;  2UXA A;  4U4X A;  1B52 A;  1T0K A;  4H5F A;  1N34 E;  2EZ6 A;  2QMW A;  2O68 A;  1YPN A;  4R74 A;  3ILU B;  2LUQ A;  3MJN A;  2OWS A;  1LAF E;  4QXD A;  1VSO A;  1Y3Q A;  3FD3 A;  4DIG A;  2EE8 A;  3U94 A;  2M9A A;  4I62 A;  5DYH A;  4JI4 E;  3MST A;  2MDG A;  2ELY A;  1NNK A;  4EUO A;  4DV5 E;  1SW5 A;  3C33 A;  3MZ1 A;  4R2S A;  2YRM A;  2REJ A;  2DWJ A;  1USY H;  5TPA B;  4AS5 A;  4R9F A;  2FVZ A;  3OD7 A;  3TDJ A;  1FQC A;  4QFP A;  5ELV A;  1NL5 A;  4RA1 A;  5LL6 R;  1K9Y A;  1NNF A;  2EMK A;  1QGX A;  4G68 A;  4I9D A;  4FE8 A;  2EL6 A;  4K0K E;  4MHF A;  2F8D A;  1IBL E;  4KCC A;  1FQE A;  5CMK A;  1PJT A;  2EPN A;  2E5L E;  3O28 A;  4MLV A;  4P1L A;  4QHQ A;  3T9X B;  1MDQ A;  3TQW A;  3LSF B;  4ZEB A;  1IQO A;  4WXD A;  3E4R A;  4NG7 A;  1QUI A;  2PCR A;  1LBY A;  2GHF A;  4O7M A;  4PFY A;  5JEI A;  3HPZ A;  3IOV A;  3TUS A;  4YB5 A;  1ANF A;  3MPL A;  4KYS A;  3Q28 A;  4NHR A;  4ZYG A;  5AC4 A;  4RK9 A;  3HPI A;  2DXY A;  2EN1 A;  5H8F A;  2EPX A;  2DSF A;  3C4M A;  2WBD A;  2ZXT A;  4N6P A;  4HCY A;  4NN3 A;  3HHF A;  1Y4C A;  3KWR A;  4GEQ B;  3KZZ A;  4F1U A;  1ZMG A;  4QSE A;  5I58 A;  1P1U A;  3ZOQ B;  1XMQ E;  2F3D A;  2ENA A;  3R6U A;  4YKJ A;  2R76 A;  1HNW E;  4PC9 A;  4KPT A;  4OTE A;  3R26 A;  1P1N A;  2X7Q A;  3VV5 A;  5L9O A;  4DE8 A;  2ESN A;  3IOT A;  1INP A;  2ABH A;  2QL3 A;  1URD A;  3ILT B;  2Z8E A;  1I6B A;  4ISU A;  3UP9 A;  2I48 A;  4H0W A;  2WBB A;  2V87 A;  2XXT A;  5ET5 A;  5TPA A;  4HEI A;  4BDO A;  4LF8 E;  4JWX A;  4M9V C;  1MPD A;  1IIW A;  4DV1 E;  1MM7 A;  1MS7 A;  4FK5 C;  4NTL A;  1IMD A;  3S9L C;  2Y7P A;  5DT6 A;  4GF8 A;  1KJK A;  3O9P A;  4PBH A;  3SES A;  2LUP B;  1AL3 A;  4WED A;  4XKQ A;  2RIN A;  4RH8 A;  2DRP A;  3K6V A;  3OEL A;  1AMF A;  3W9V A;  1PB8 A;  4LZ8 A;  1YUI A;  4GWY A;  1IMB A;  5IKB A;  4O5G A;  2KR0 A;  3B50 A;  4QFO A;  3CRB A;  1LBX A;  1N76 A;  3K6Q A;  1MY2 A;  3LV0 A;  1MXY A;  3MP8 A;  3FVN A;  4G61 A;  3J81 C;  1N84 A;  2EPU A;  4LZ5 A;  2D21 A;  1Q1K A;  2GHA A;  3SDF A;  3QAX A;  1NNT A;  4C1U A;  5JTY B;  4E0X A;  4PF6 A;  1ZIU A;  2RC8 A;  1D9Y A;  3DP6 A;  4MH5 A;  4U22 A;  5H8S A;  2Q2A A;  3PUZ E;  2UXB E;  4F22 A;  3B7D A;  3DM0 A;  4F3G A;  5CM6 A;  3OEN A;  1LST A;  2QJE A;  2P3N A;  3MW0 A;  1IMF A;  2XXW A;  1FTO A;  2EN4 A;  5AE2 A;  5M2V A;  1T4L B;  4N17 A;  3CIJ A;  3VE1 B;  4H6D A;  1QNT A;  4DV7 E;  4NWC A;  1EH8 A;  5EQ8 A;  4R2R A;  1NFT A;  3JU0 A;  3PPO A;  2CEY A;  4OVS A;  3EHS A;  3UK3 C;  3B6W A;  1A1L A;  4UAB A;  1X6H A;  4KHZ E;  2MC6 A;  1URS A;  4IB2 A;  1MGT A;  2EM7 A;  2KOU A;  2QS2 A;  5A6A A;  4KXP A;  4LON B;  1PB7 A;  4X48 A;  4OFL A;  1NUW A;  4N4U A;  1FPG A;  4HCW A;  4OZ9 A;  5HM4 B;  4Q30 B;  1OIB A;  1YZ9 A;  5F24 A;  1R1N A;  5DNY A;  4WXJ A;  1M5C A;  4GWO A;  1CE2 A;  4DV3 E;  4F6N A;  2B7T A;  4QF9 A;  3SER A;  4NQ8 A;  2JR1 A;  4NF6 B;  4TQU Q;  4DXB A;  5KDT A;  4MF3 A;  2QS4 A;  4GKK E;  4Q28 A;  2LV2 A;  2V3Q A;  3KZG A;  2EN2 A;  2EM2 A;  1TF6 A;  2XD2 A;  4M30 A;  1B1X A;  3RTW B;  2DLQ A;  2V84 A;  5K2X A;  3M99 B;  3FV1 A;  4HE0 A;  4N81 A;  2XWI A;  1IEJ A;  3SZP A;  3UOR A;  2F97 A;  1MXZ A;  4LFB E;  1UN6 B;  4PFU A;  4N4R B;  4XFE A;  3SEU A;  1UQW A;  1GTK A;  2XXX A;  4FEB A;  4MJO A;  4O24 A;  4OQO A;  4FOR A;  1NMU A;  4EXL A;  4ZE8 A;  5FTI A;  4WSP A;  5LMU E;  1PKP A;  3IOR A;  2EMZ A;  3PU5 A;  1JW4 A;  2YRK A;  5CBS A;  1LCF A;  3H09 A;  3VVE A;  4O4K A;  1JET A;  3HFU A;  1XC1 A;  3BIG A;  4LN5 A;  3VLV A;  3RYD A;  4N6K A;  2Y5L A;  4NF8 B;  2EPO A;  3OMB A;  1MM6 A;  5IZ3 B;  2Q8U A;  2THI A;  1MY3 A;  5TP9 B;  2VF1 A;  3C35 A;  1ZR9 A;  2DGC A;  2QVU A;  2RS7 A;  1HNZ E;  3HST A;  4IY6 A;  2DSY A;  1X3C A;  1ZLQ A;  4PCD A;  4WSG A;  5AC5 A;  4NF4 B;  1X48 A;  3FGS A;  4OET A;  2ZZV A;  4R03 A;  3LUY A;  2X7P A;  4P11 A;  2BB8 A;  4ELR A;  2QMX A;  3PD8 A;  3EKI A;  4YB6 A;  4P9K A;  3GYY A;  4DR3 E;  5AA3 A;  2N3G A;  2DWA A;  4KYE A;  2YSP A;  2LRS A;  2RSM A;  4Q35 B;  1DBZ A;  3H03 A;  4PE5 B;  1JK1 A;  2LCE A;  3ADJ A;  1XI6 A;  2NA2 A;  4PTK A;  3IAZ A;  2FGG A;  1GVC A;  2HQ0 A;  3TTM A;  2F3B A;  3MVW A;  1WHN A;  3LSW A;  4OVR A;  4NF6 A;  2AL5 A;  4JSD A;  4GL8 A;  3Q29 A;  4QSC A;  1SBP A;  4EDP A;  4XXU A;  2REG A;  4M1V A;  4FAT A;  1RMD A;  4YHH E;  4RK2 A;  1QUK A;  3U92 A;  2EN3 A;  1YZ0 A;  4F1Y A;  2EP3 A;  2UUB E;  3K2D A;  3IFA A;  3U93 A;  1B46 A;  2UYF A;  1FTL A;  2F6G A;  5ET7 A;  3EPH A;  5EYF A;  2OJT A;  3EPK A;  3QXM A;  1BLF A;  4JI5 E;  4NXN E;  4N8Y A;  4OAN A;  4GXS B;  1LBZ A;  1S50 A;  4DZ1 A;  3KN7 A;  3CFZ A;  3IWC A;  3VFJ A;  1IQS A;  4JV5 E;  5FHN A;  3O97 A;  3OEK A;  1VE4 A;  2DE4 A;  1NV1 A;  4ELP A;  4GOT A;  4P78 A;  2YTI A;  1LFG A;  4NXM E;  3M3L A;  1M5F A;  1DK4 A;  5TSE A;  2CZK A;  3VHT B;  3HTX A;  3C34 A;  5T3J A;  2Q74 A;  1USY E;  4DI3 D;  5CC2 A;  5CMC A;  3THN A;  4GWZ A;  4DR7 E;  1YCJ A;  1B05 A;  2E0S A;  4NF8 A;  1MY4 A;  5TP9 A;  4H8J A;  4PFT A;  4F6M A;  1MY1 A;  3VK6 A;  3BBG A;  1NUX A;  2F7A A;  1EYI A;  2DWI A;  3FAT A;  4X04 A;  2NUV A;  2EMF A;  3HPS A;  3MP1 A;  4MFI A;  2EOZ A;  3J7Y p;  2XXH A;  4ONY A;  3F11 A;  2EPC A;  5CI5 A;  1BB8 A;  3EPL A;  1MH3 A;  4F39 A;  4WPY A;  1DTG A;  3K1P A;  3ADL A;  4O7I A;  3A29 A;  4NF5 B;  2VPO A;  2JXP A;  5HBC A;  4HW8 A;  3S9E A;  5H8N B;  1IME A;  2HXW A;  4HXV A;  3ODB A;  3WAF A;  1PJS A;  1LAX A;  5FTH A;  3G7W A;  3O6G A;  1MQG A;  2XX8 A;  5ITP A;  3CR9 A;  1XMO E;  1M5D A;  2Q88 A;  1P1Q A;  2R8T A;  4H8I A;  1P47 A;  3ZSF A;  2VPN A;  1EU8 A;  3JAM C;  1JP4 A;  2H4I A;  4DCX A;  5AE4 A;  3N6T A;  1BBG A;  4XKP A;  4LA9 A;  3UIF A;  3EQ1 A;  4BLA A;  3KFM A;  5A2Q C;  4BC7 A;  2ANJ A;  3MHH C;  2RCB A;  2NAB A;  2D5W A;  4F29 A;  1ZJL A;  3KSX A;  1B40 A;  4G77 A;  3TYH A;  4KR5 A;  5ITO A;  2YU5 A;  5BR8 E;  2XXY A;  1US4 A;  2EMX A;  4EF1 A;  2EL5 A;  2EMG A;  2VQF E;  3D1R A;  4ZYD A;  3S2V A;  2EOJ A;  3RY3 A;  5I84 A;  4NZV A;  2QVV A;  1B0H A;  4THI A;  4U21 A;  4NMY A;  3VLW A;  1MPB A;  4C0R A;  3I5O A;  1PB9 A;  4IR8 A;  1B51 A;  4ZS9 A;  3RN8 A;  2Y7I A;  5DVJ A;  3HQ1 A;  4X66 E;  1A55 A;  2EOS A;  1IXC A;  4RNS A;  2N3H A;  2EM6 A;  3L6H A;  5FHM A;  2JVA A;  1FKA E;  2UUA E;  4OVQ A;  2MC5 A;  2RS6 A;  4F2J C;  1BK4 A;  3N5L A;  4ZYH A;  3QSL A;  5A6B A;  2MKZ A;  3RT6 B;  4LU9 A;  2G29 A;  2F5X A;  2HAU A;  2GQ1 A;  1RYO A;  4OXV A;  3SEY A;  1B58 A;  2F7C A;  2UXD E;  4H67 A;  4U2R A;  2V4C A;  4JDF A;  3FZV A;  2FIE A;  5I2K B;  1SYI A;  1YXI A;  1POT A;  5DVI A;  2FYI A;  2O51 A;  4IO7 A;  4NF5 A;  5I58 B;  3I6V A;  3MYU A;  3TMG A;  5H8N A;  2M7Q A;  4O3C A;  2VOZ A;  4YMA A;  5EYG A;  3Q26 A;  4DXU A;  5AA2 B;  1FCK A;  4I3Y A;  3T93 B;  3DP4 A;  4GWS A;  4ZEC A;  3OOA A;  1AWB A;  4PAK A;  3T9V A;  3B6Q A;  2EM8 A;  4IO3 A;  2EMB A;  4OER A;  3IJO B;  5EYH A;  1PDA A;  4UA8 A;  4BS9 A;  1HSE A;  2UVG A;  4GLI A;  2WKY A;  5AE3 A;  3P1X A;  1XNR E;  2R9J A;  2HPG A;  2F8B A;  2V3T A;  3MVY A;  2EM3 A;  1FJG E;  2FNC A;  4X1B A;  1AIV A;  1B69 A;  4GFR A;  5LTC A;  1WVJ A;  2V93 A;  1T4N A;  3FJM A;  5A6K A;  1A1J A;  3O29 A;  4J8Z A;  2P0S A;  3LLH A;  3K01 A;  1XS5 A;  1X49 A;  4JI8 E;  5BUU A;  3IOW A;  1NH7 A;  3FV2 A;  5EQ9 A;  4BDN A;  3CI8 A;  3TCG A;  3I3V A;  3IB0 A;  3S4U A;  1BIY A;  4MEV A;  1LB8 A;  5ET8 A;  1FTJ A;  3KJ7 A;  4BHC A;  1TF3 A;  3PD9 A;  4YIC A;  2AL4 A;  2QVR A;  5KZT A;  5IZZ A;  4R2C A;  1A1F A;  4JVC A;  2OWZ A;  4GRK A;  1N33 E;  3PGF A;  4EQ7 A;  1PBP A;  2DYX A;  4U1O A;  2A25 A;  4ZEI A;  2NUE A;  4IO6 A;  3UN6 A;  3A3U A;  3DJW A;  1MG1 A;  1GZ6 A;  2EQ3 A;  2I0C A;  3S9M C;  1N3W A;  1IQ7 A;  4GVO A;  2M4I A;  5CMM A;  4AB6 A;  4MIJ A;  4G68 C;  4LF6 E;  2XWV A;  4U23 A;  2VD2 A;  1MRP A;  1YUJ A;  2DP8 A;  5I2K A;  3TTN A;  1EYJ A;  2OLB A;  1JVX A;  4H5G A;  4BDM A;  2Y84 A;  4IO2 A;  4R2P A;  2D9H A;  3KZY A;  2ADR A;  1J5E E;  2CEX A;  2LTR A;  3AXF A;  4OOG C;  1ATG A;  2XX9 A;  1OVB A;  3FIR A;  3RLF E;  4F1V A;  5AA2 A;  1DQ3 A;  1UHZ A;  1KA1 A;  1LB9 A;  1A1G A;  3FVG A;  1POY 1;  1F9B A;  5L8D A;  1FBC A;  3V8X B;  2UUC E;  2LJU A;  4QFL A;  3FVK A;  3PTY A;  1VFE A;  4WX9 A;  1NH8 A;  2CMO A;  2GPI A;  5EHM A;  1I94 E;  2HJJ A;  1X6F A;  1LAG E;  3QK6 A;  1CNQ A;  2H98 A;  3PPN A;  4P7D A;  1KA0 A;  1LBW A;  3PPP A;  4XF5 A;  1X5W A;  2I9I A;  2VP1 A;  1O7T A;  4HE1 A;  2EM4 A;  4JI1 E;  1NI9 A;  2I4C A;  3QYT A;  1UTH B;  5KL6 A;  3GBB A;  3T22 A;  1MY0 A;  2VHA A;  1YFH A;  4HE2 A;  3KC0 A;  2IA4 A;  5KDT B;  3FAS A;  1MH4 A;  1A7L A;  2NUG A;  1OQG A;  1EZ9 A;  1I69 A;  3AV0 A;  2EOM A;  3C4B A;  1YTV A;  4ELO A;  1B3G A;  2B3B A;  1BKA A;  4X64 E;  1R9L A;  4KI0 E;  4IGT A;  1R6Z A;  2EOI A;  2EOH A;  2RTX A;  1XOC A;  3MZ9 A;  5A5L A;  1HSJ A;  2WYP A;  2YTN A;  2NXO A;  3T1H E;  1JVY A;  1QUL A;  3T9U A;  3MBP A;  2I3W A;  2O7I A;  5JK4 A;  1SVX B;  4RXL A;  1B0L A;  2ODR D;  4B3S E;  5A5X A;  1B3H A;  1A1H A;  1FQD A;  2MDR A;  4E0W A;  3PUX E;  4PGN A;  1BP5 A;  3E13 X;  4KWY A;  4QSD A;  5KL7 A;  2FV4 B;  1MQH A;  1B7H A;  4JVD A;  4WKM A;  2EOX A;  1RC7 A;  2EOE A;  4DUY E;  3PMX A;  4AQY E;  3IB2 A;  2AIX A;  4M2Z A;  4RYA A;  4RJZ A;  2B4L A;  3O66 A;  4JXI A;  3TZA A;  2FA7 A;  1IBK E;  2EM9 A;  5EHS A;  3PMW A;  2DLK A;  1FJ9 A;  3E79 A;  2XXR A;  4QBA A;  3N94 A;  3PUW E;  1LGB C;  1XVX A;  2E1M A;  3VYX A;  3EPJ A;  5IXM B;  3PPQ A;  4AS4 A;  5IZ1 A;  5DVF A;  2ELZ A;  3MAM A;  2JP9 A;  4R2D A;  4RY1 A;  1K9Z A;  2EMH A;  1D3K A;  4YZZ A;  4DR5 E;  3B8B A;  3KSJ A;  2PX1 A;  2HFB A;  4OYV A;  1SI1 A;  2YTG A;  1B7U A;  1UTH A;  1ZBQ A;  4EF2 A;  3OO7 A;  2EN7 A;  3CFX A;  4UAC A;  1IMU A;  4X9T A;  4Q5T A;  4OEN A;  1LFH A;  1F2I G;  2YTE A;  2JPA A;  5ICQ A;  2L5V A;  4BDL A;  2YPN A;  1DI2 A;  4OHN A;  4I8O A;  3FXR A;  1O64 A;  4AB5 A;  4XKN A;  3ZKK A;  2KON A;  2UVH A;  1D4N A;  3ECR A;  4F19 A;  4PFW A;  2DQV A;  4HS7 A;  2P3V A;  3QG5 C;  1LLS A;  4FJP A;  2EOF A;  2XX7 A;  2QPQ A;  1FPK A;  4DR1 E;  2RC7 A;  1FQF A;  3LBS A;  3S9N C;  2ZNU A;  1MXW A;  4LZ7 A;  4NX1 A;  4BDR A;  3H6U A;  3T66 A;  1IXI A;  1DPE A;  4B3T E;  5CBR A;  3D4C A;  3HHG A;  1FBF A;  2EQ0 A;  4YKI A;  2Y5K A;  2EMW A;  3W15 C;  1YYW A;  5FLX C;  3KEI A;  4MMP A;  1DTZ A;  2B4M A;  4F2O A;  4DUZ E;  4OWD A;  2HCA A;  4KQP A;  3SEW A;  4LP2 B;  3KG2 A;  3UGW A;  4RPO A;  2ENH A;  3O2A A;  4U4S A;  1R9Q A;  4YAH X;  3IB1 A;  2XXQ A;  3CFL A;  4XTC Q;  2L2K B;  4KZS A;  5LOM A;  2LTS A;  2B7V A;  3SEX A;  5I5P A;  1Z7N E;  4ZZA A;  2WBT A;  4H45 A;  1MDP 1;  2HHH E;  2FBP A;  4R2Q A;  1NCS A;  1DGC A;  2JYA A;  4M4G A;  3AUZ A;  1GR2 A;  4JI7 E;  4QFK A;  3RQT A;  1IIT A;  2RPC A;  2H9B A;  1N0T A;  1P99 A;  3JZJ A;  1SI0 A;  4F9B B;  2Y7W A;  3K6X A;  5CRY A;  2IHR 1;  1SW1 A;  1A8F A;  5I2N B;  2EPA A;  3PPR A;  4YKK A;  2ZYK A;  3BFT A;  1KZ8 A;  2L92 A;  2L33 A;  4G8H A;  4R8O A;  3BFU A;  1FTA A;  3R7X A;  5I56 B;  2WBS A;  3FXB A;  2I49 A;  4HTG A;  2VE7 C;  4I40 A;  2OCU A;  2QSX A;  4P1E A;  1G2F C;  2F7B A;  5B70 A;  5L9M A;  1MPC A;  2LT7 A;  3VVD A;  5CFF E;  1US5 A;  1FPB A;  1OQH A;  4P0G A;  2L8T A;  3VLU A;  3UK4 A;  3IOU A;  2L3C A;  2YJP A;  2Q9T A;  2HXR A;  3THI A;  2GH9 A;  5HPQ A;  2I6E A;  2V85 A;  4OVP A;  3HO7 A;  4G2Z A;  4DDD A;  2EMC A;  1EH6 A;  1Y9U A;  5DTB A;  3MVZ A;  1XNQ E;  2DE3 A;  2R71 A;  3G3H A;  4F54 A;  2HHM A;  1L5T A;  1Y1M A;  4G8N A;  1TT1 A;  3V83 A;  1NV0 A;  4G8M A;  3GZG A;  3U8Q A;  4EXK A;  3G3I A;  4TUI A;  1YSA C;  1T38 A;  2EPP A;  2N8X A;  3TTL A;  1A1I A;  1ZBT A;  4DR6 E;  4JYA E;  3ONM A;  4R72 A;  4Q0C A;  4MAG A;  5KL3 A;  1H76 A;  1SQY A;  3C6M A;  3ADG A;  1MXX A;  3CSG A;  4F9A B;  1MQI A;  2Q8M A;  1FBH A;  4B3R E;  1G0H A;  1LCT A;  2ZMB A;  4DR4 E;  2FIX A;  4N15 A;  3SET A;  4YMB A;  2D3I A;  2VT5 A;  4ZEK A;  4X1D A;  4F31 B;  2UYE A;  4QRZ A;  4YB7 A;  2V89 A;  4JWO A;  2LBS B;  3RPL B;  1DMB A;  1FPD A;  3TTK A;  2FHY A;  1IZ1 A;  1KYQ A;  3KBZ A;  4YU0 A;  4I8C A;  3C31 A;  2LO3 A;  4PBQ A;  4WYQ B;  2XXK A;  2XXV A;  3T9H B;  2YU8 A;  4PE3 A;  3J7A G;  3MWB A;  2F78 A;  2CZH A;  4O3B A;  5I2N A;  1IXH A;  2F4V E;  2PFY A;  4XKR A;  1FBP A;  2H5Y A;  1JK2 A;  3FVO A;  2I3V A;  2XD3 A;  4OX9 E;  3TPA A;  5IT9 C;  1B2H A;  1HNX E;  3MUQ A;  5I56 A;  2VQE E;  4PAF A;  3M3K A;  2A5S A;  1B7Z A;  2XXI A;  4PDD A;  5KL5 A;  2I13 A;  2VRD A;  4LUB A;  4NWD A;  1N3X A;  3JYR A;  1EYK A;  3A3C A;  4KCD A;  3MPK A;  3T1B A;  2EPR A;  3OXN A;  4TUG A;  2V83 A;  4RPN A;  1FPI A;  4N07 A;  1JEV A;  2RQL A;  2EOO A;  2JOB A;  3EF7 A;  1ZU0 A;  1FQB A;  1WDN A;  3RTF B;  3T0J A;  4P47 A;  2XWO A;  1SD3 A;  4NHB A;  1RDZ A;  4PDH A;  1QKB A;  3FXQ A;  3H6V A;  1KWH A;  3E9X A;  1H43 A;  2EQ1 A;  2HC5 A;  2M1S A;  4IS1 C;  2X26 A;  4BDQ A;  2CZI A;  2V88 A;  1NV4 A;  5IWA E;  3OSQ A;  5EQA A;  2Z8D A;  3FIG A;  1Y3P A;  1ZBM A;  2RF1 A;  4GKJ E;  1ZU1 A;  4Z7E A;  2ENC A;  4DR2 E;  1MQJ A;  4PFI A;  1TFA A;  3LC8 A;  2DE2 A;  2H99 A;  5F7V A;  3QUJ A;  1PEB A;  3RPW A;  1MXV A;  2LJH A;  2YTQ A;  2ZZW A;  3TEP A;  1OLA A;  3FXU A;  3K00 A;  2HZL A;  4BBY A;  4LFC E;  1H3D A;  3MC2 A;  1OLC A;  4FEC A;  4KFQ A;  1TXF A;  4ZED A;  3N6U A;  2NVU B;  3H4Z A;  1SFE A;  2YSO A;  1IMA A;  4NED A;  5FBP A;  3V5A A;  3LR1 A;  3RPL A;  4LF5 E;  2ZZX A;  4TLL B;  4MCO A;  3VXC A;  4LFA E;  5KCJ A;  4OES A;  4F3S A;  2ZNS A;  2O1L A;  1A99 A;  1J1N A;  2PT2 A;  2Q2C A;  4GWW A;  1FPE A;  4GX4 A;  2CZL A;  3FJ7 A;  1B3E A;  5I7I A;  1Q35 A;  2DOJ A;  4L17 A;  2EPL X;  2GLI A;  1AH5 A;  1AOV A;  1M5E A;  2QS1 A;  3ROJ A;  2VGQ A;  4XEQ A;  2KQZ A;  4P8B A;  3VDF A;  4DCY A;  2AYS A;  1Y1Z A;  3M3F A;  3RMP A;  1A8E A;  1FQA A;  1P1W A;  2NWJ A;  1Q9D A;  5H8H B;  5ICT A;  1TFD A;  4I3E A;  1TWY A;  1SW2 A;  5IGA A;  1VR5 A;  3H6T A;  2EMA A;  2PBW A;  3U72 A;  4XIG Q;  1DSN A;  4IGR A;  3OO6 A;  1SW4 A;  4LVQ A;  2DMI A;  1T4O A;  4JI2 E;  5ET6 A;  2MKD A;  3EN3 A;  2PVU A;  1A40 A;  3TFL A;  4G4P A;  2HGH A;  5L9S A;  1O63 A;  3ZS6 A;  5ISU A;  3QIM A;  4NGU A;  3DF6 A;  2EMY A;  5IM2 A;  1D9Q A;  3PMV A;  3L6G A;  3MSW A;  1EKZ A;  5AA4 A;  1NNP A;  3FJG A;  2YZT A;  4GXA A;  2LMZ A;  1QUJ A;  4RHB B;  4KHP E;  3LUZ A;  3IFC A;  2YT4 A;  1DCU A;  4POW A;  1FJ6 A;  2O7U A;  1JW1 A;  5A5X B;  2O1M A;  1N04 A;  5BWJ A;  4TLM B;  4IY5 A;  1ZKB A;  2BJJ X;  4Q8R A;  2ODR C;  2ONS A;  2JOX A;  1GGG A;  2PRT A;  2P1S A;  4H1X A;  1QVS A;  1NV5 A;  1IUD A;  4X8R A;  2G93 A;  3IO4 A;  1B5H A;  3C32 A;  2Q8J A;  2M8C A;  3DLN A;  2ZNT A;  4F18 A;  3IJX B;  4OVT A;  3GLB A;  3LSL A;  5A6B D;  3CVG A;  3T96 B;  2I4B A;  3MHS C;  1UBD C;  3TKD A;  2OBG A;  2WX9 A;  2XHD A;  4ZZE A;  2B9D A;  1BBO A;  2L6M A;  4R9G A;  1LBV A;  4N8G A;  4F3P A;  5H8H A;  4R2B A;  4GQO A;  2B3T B;  1SYH A;  1II5 A;  3MZB A;  3HXL A;  3BIH A;  4H65 A;  4R75 A;  4X62 E;  2ZM6 E;  2EML A;  1QU6 A;  2NUF A;  3ADI A;  2Z22 A;  2EOY A;  1WHQ A;  2MKN A;  4GBW A;  2ZYM A;  4X65 E;  1FPL A;  2V3U A;  2EPZ A;  1DOT A;  1WXR A;  3K02 A;  4U1Z A;  1Z1B A;  2DIX A;  2FTX B;  1RYX A;  3PV0 E;  4O3A A;  5AE1 A;  2K7I A;  5LLQ A;  1G0I A;  3G3K A;  3G3F A;  2QRY A;  1OVT A;  3KOT A;  3E3K A;  2B3F A;  3KN3 A;  4GWX A;  4AQ4 A;  2E72 A;  2HAV A;  2YWQ A;  1XHY A;  3FUZ A;  4ZE9 A;  1FRP A;  1NV6 A;  1B4H A;  3Q25 A;  3MP6 A;  4GD5 A;  3M8U A;  1A1K A;  2EPM X;  3U65 A;  4K3F A;  2XWK A;  4PFB A;  4IJD A;  4PF8 A;  3BGH A;  4O8M A;  2EL4 A;  3VVF A;  3G3J A;  1A54 A;  3QMF A;  1M5B A;  1Z7M E;  1N32 E;  4ZEF A;  1RDY A;  4WFT A;  1FPF A;  2Q89 A;  4DMI A;  3B6T A;  4EQB A;  4P3L A;  1N7X A;  4ESW A;  2H36 X;  5I3S A;  1B3F A;  4JBZ A;  4R2F A;  1FTK A;  4MNP A;  4F3B A;  2WCC 3;  3KGC A;  4LTY A;  2CTD A;  1UTB B;  2ZYO A;  1FSA A;  4MBP A;  2LVH A;  1LEV A;  2F34 A;  1ZTY A;  4BC9 A;  3BF2 A;  2GHB A;  4OFO A;  4PP0 A;  3G3G A;  4LF7 E;  3ZKL A;  1BTJ A;  2O69 A;  2OX3 A;  2R6G E;  2JWO A;  1LLM C;  1PC3 A;  1MQD A;  3HV1 A;  4IO5 A;  5CMB A; 
#chains in the Genus database with same CATH homology
 3KJT A;  5IAI A;  2RCA A;  4ND9 A;  4WEP A;  1SDX A;  1LBC A;  4GL0 A;  1GV8 A;  2DS9 A;  4PET A;  3C9H A;  3SKP A;  3IK6 B;  3DEL B;  2I58 A;  2PT1 A;  5B7D A;  3OO9 A;  1B32 A;  3WAE A;  1FW0 A;  2H25 A;  5AA2 D;  1QJM A;  1B1H A;  3KN8 A;  4N13 A;  1S7Y A;  3V89 B;  4DXC A;  1XT8 A;  4R73 A;  4IO4 A;  3VXB A;  1VFD A;  1XVY A;  3HCQ A;  4OEV A;  4EQ9 A;  2I0B A;  1EZP A;  4POX A;  2HZK A;  2V25 A;  5JTY A;  3IX1 A;  1I6A A;  3DP8 A;  3RNN A;  1H44 A;  2PYY A;  3MQ9 A;  2LAO A;  3K4U A;  4JSO A;  3O6I A;  1Y20 A;  3O6H A;  1H45 A;  1I6Q A;  1UTB A;  2DVZ A;  3TOD A;  1FTM A;  2YLN A;  2XXP A;  5DEX B;  4LQ5 A;  1JNF A;  4FED A;  5TU0 A;  4DLD A;  3BBR A;  1EH3 A;  1WOD A;  4JB7 A;  5F1Q A;  1ELJ A;  4R6H A;  2RC9 A;  4ELQ A;  2O6A A;  2PMS A;  1EZO A;  1N7W A;  3U1O A;  5H8Q B;  5K2Y A;  4TOZ A;  3TAJ A;  4ECF A;  4PQJ A;  2UVJ A;  1B5I A;  1UIU A;  1OMP A;  1LBB A;  3HN0 A;  1RKM A;  4QFN A;  3K6W A;  3H06 B;  2DVC A;  2Y7K A;  3UA8 A;  2KLF A;  4KD5 A;  2DXR A;  2OK2 A;  2Y7R A;  3GXA A;  3KBR A;  1B5J A;  4OFJ A;  4MLQ A;  5I57 B;  1LFI A;  2RKM A;  1D9V A;  2P2A A;  3H7M A;  3TEL A;  4LAT A;  1Y4T A;  3BKI B;  1CB6 A;  3LSX A;  3IL1 B;  1LAH E;  4I1D A;  5FHO A;  3P7I A;  1URG A;  3TCH A;  2ONR A;  3IO6 A;  5I59 B;  2ONK E;  3OEM A;  3H3G A;  2NOO A;  2QS3 A;  1UIV A;  2W7Y A;  3GBA A;  1P1O A;  1PBQ A;  1MXU A;  3RGY A;  3TQL A;  3D4G A;  2F35 A;  5DEX A;  3PUV E;  3CG3 A;  3K1N A;  4FIM A;  2A5T B;  4NF4 A;  3RUM A;  3Q27 A;  1JEU A;  1QW0 A;  4C1T A;  5KCJ B;  4NE4 A;  3JV9 A;  4YKP A;  5H8Q A;  2ALU A;  1QKA A;  4ESX A;  4Z0I A;  4OEU A;  2GRV A;  3K6U A;  4OMB A;  2HEU A;  2F6P A;  4LQ2 A;  1B3L A;  3A09 A;  4GIZ A;  4R6K A;  2OWT A;  5AA1 A;  2IEE A;  3KOS A;  3K0V A;  3EPE A;  2Z23 A;  2F36 A;  2Z8F A;  4OVJ A;  3CG1 A;  1JQF A;  2ZYN A;  1Y3N A;  2XXU A;  2OZZ A;  3MVX A;  5I57 A;  3RT8 A;  1DPP A;  3N26 A;  3OSR A;  3EHT A;  2B65 A;  2UVI A;  3TTR A;  4ZDM A;  4F2Q A;  3W9W A;  3C36 A;  4G68 B;  1NKX A;  4R6Y A;  4P0I A;  2GFE A;  3OO8 A;  3USD A;  1S9T A;  2DWH A;  1B4Z A;  5I59 A;  5AA4 B;  5J1D A;  2VD3 A;  3IR1 A;  3SEV A;  3CSB A;  2E1S A;  3QUF A;  3PUY E;  3K1M A;  1B9J A;  1JW5 A;  3TCF A;  1HSL A;  2A5T A;  4KYD A;  3EHU A;  1YAE A;  2O84 X;  1IXG A;  5H8F B;  4FAJ A;  1B6H A;  3H6W A;  4JWY A;  2UXA A;  4U4X A;  1B52 A;  1T0K A;  4H5F A;  2QMW A;  2O68 A;  1YPN A;  4R74 A;  3ILU B;  3MJN A;  2OWS A;  1LAF E;  1VSO A;  1Y3Q A;  3FD3 A;  4DIG A;  3U94 A;  4I62 A;  5DYH A;  1NNK A;  4EUO A;  1SW5 A;  3C33 A;  3MZ1 A;  2REJ A;  2DWJ A;  1USY H;  5TPA B;  4R9F A;  3OD7 A;  3TDJ A;  1FQC A;  4QFP A;  5ELV A;  1NL5 A;  4RA1 A;  1NNF A;  4G68 A;  4I9D A;  4FE8 A;  2F8D A;  4KCC A;  1FQE A;  5CMK A;  3O28 A;  4MLV A;  4QHQ A;  3T9X B;  1MDQ A;  3TQW A;  3LSF B;  4ZEB A;  3E4R A;  1QUI A;  4PFY A;  5JEI A;  3IOV A;  3TUS A;  4YB5 A;  1ANF A;  3MPL A;  4KYS A;  3Q28 A;  4RK9 A;  3HPI A;  2DXY A;  5H8F A;  2DSF A;  3C4M A;  2ZXT A;  4N6P A;  4HCY A;  3HHF A;  1Y4C A;  4F1U A;  1ZMG A;  4QSE A;  5I58 A;  1P1U A;  3R6U A;  4YKJ A;  4KPT A;  4OTE A;  3R26 A;  1P1N A;  2X7Q A;  3VV5 A;  5L9O A;  4DE8 A;  2ESN A;  3IOT A;  2QL3 A;  2ABH A;  1URD A;  3ILT B;  2Z8E A;  1I6B A;  4ISU A;  3UP9 A;  2I48 A;  4H0W A;  2XXT A;  5TPA A;  4BDO A;  4JWX A;  1MPD A;  1IIW A;  1MM7 A;  1MS7 A;  4NTL A;  3S9L C;  2Y7P A;  5DT6 A;  4GF8 A;  3O9P A;  3SES A;  1AL3 A;  4WED A;  4XKQ A;  2RIN A;  3K6V A;  3OEL A;  1AMF A;  3W9V A;  1PB8 A;  4LZ8 A;  5IKB A;  4QFO A;  3CRB A;  1N76 A;  1MY2 A;  3MP8 A;  1MXY A;  3FVN A;  1N84 A;  4LZ5 A;  2D21 A;  1Q1K A;  2GHA A;  3SDF A;  3QAX A;  1NNT A;  4C1U A;  5JTY B;  4E0X A;  1ZIU A;  2RC8 A;  1D9Y A;  3DP6 A;  4MH5 A;  4U22 A;  5H8S A;  2Q2A A;  3PUZ E;  4F22 A;  3B7D A;  3DM0 A;  4F3G A;  5CM6 A;  3OEN A;  1LST A;  2QJE A;  3MW0 A;  2XXW A;  1FTO A;  5M2V A;  3CIJ A;  3VE1 B;  4H6D A;  4NWC A;  1NFT A;  3PPO A;  3EHS A;  3B6W A;  4KHZ E;  1URS A;  4IB2 A;  2QS2 A;  4LON B;  1PB7 A;  4X48 A;  4OFL A;  4OZ9 A;  4HCW A;  5HM4 B;  4Q30 B;  1OIB A;  1R1N A;  4WXJ A;  1M5C A;  4GWO A;  1CE2 A;  4QF9 A;  3SER A;  4NF6 B;  4TQU Q;  4DXB A;  5KDT A;  4MF3 A;  2QS4 A;  2V3Q A;  3KZG A;  2XD2 A;  1B1X A;  3RTW B;  2V84 A;  5K2X A;  3FV1 A;  1IEJ A;  3UOR A;  2F97 A;  1MXZ A;  4PFU A;  3SEU A;  1UQW A;  1GTK A;  2XXX A;  4FEB A;  4OQO A;  4FOR A;  1NMU A;  4EXL A;  4ZE8 A;  5FTI A;  3IOR A;  3PU5 A;  1JW4 A;  5CBS A;  1LCF A;  3VVE A;  1JET A;  1XC1 A;  3VLV A;  4NF8 B;  3OMB A;  1MM6 A;  2THI A;  1MY3 A;  5TP9 B;  3C35 A;  3HST A;  4IY6 A;  1ZLQ A;  4NF4 B;  3FGS A;  4OET A;  3LUY A;  2X7P A;  4P11 A;  4ELR A;  2QMX A;  3PD8 A;  4YB6 A;  5AA3 A;  2DWA A;  4KYE A;  3H03 A;  4PE5 B;  3IAZ A;  1GVC A;  2HQ0 A;  3TTM A;  3MVW A;  3LSW A;  4NF6 A;  2AL5 A;  4JSD A;  4GL8 A;  3Q29 A;  4QSC A;  1SBP A;  4EDP A;  4XXU A;  2REG A;  4M1V A;  4FAT A;  4RK2 A;  1QUK A;  3U92 A;  4F1Y A;  3K2D A;  3U93 A;  1B46 A;  2UYF A;  1FTL A;  2F6G A;  5EYF A;  2OJT A;  3QXM A;  1BLF A;  4GXS B;  1S50 A;  4DZ1 A;  3KN7 A;  3CFZ A;  3VFJ A;  5FHN A;  3O97 A;  3OEK A;  1VE4 A;  2DE4 A;  4ELP A;  4GOT A;  1LFG A;  3M3L A;  1M5F A;  3C34 A;  1USY E;  5CC2 A;  5CMC A;  1YCJ A;  1B05 A;  2E0S A;  4NF8 A;  1MY4 A;  5TP9 A;  4H8J A;  4PFT A;  1MY1 A;  2F7A A;  2DWI A;  3FAT A;  2NUV A;  3MP1 A;  4MFI A;  2XXH A;  4ONY A;  3F11 A;  5CI5 A;  1MH3 A;  4F39 A;  1DTG A;  3K1P A;  4NF5 B;  4HW8 A;  5HBC A;  3S9E A;  5H8N B;  2HXW A;  3ODB A;  3WAF A;  1LAX A;  5FTH A;  3G7W A;  3O6G A;  1MQG A;  2XX8 A;  5ITP A;  3CR9 A;  1M5D A;  2Q88 A;  1P1Q A;  4H8I A;  3ZSF A;  1EU8 A;  2H4I A;  4DCX A;  5AE4 A;  3N6T A;  4XKP A;  4LA9 A;  3UIF A;  3EQ1 A;  4BLA A;  3KFM A;  2ANJ A;  2RCB A;  2D5W A;  4F29 A;  1ZJL A;  3KSX A;  1B40 A;  4G77 A;  3TYH A;  4KR5 A;  5ITO A;  2XXY A;  1US4 A;  4EF1 A;  3S2V A;  3RY3 A;  5I84 A;  1B0H A;  4THI A;  4U21 A;  4NMY A;  3VLW A;  1MPB A;  4C0R A;  3I5O A;  1PB9 A;  1B51 A;  4ZS9 A;  3RN8 A;  2Y7I A;  5DVJ A;  1A55 A;  1IXC A;  4RNS A;  3L6H A;  5FHM A;  3N5L A;  3QSL A;  3RT6 B;  2G29 A;  2F5X A;  2HAU A;  1RYO A;  4OXV A;  3SEY A;  1B58 A;  2F7C A;  4H67 A;  4U2R A;  4JDF A;  3FZV A;  5I2K B;  1SYI A;  5DVI A;  1POT A;  2FYI A;  2O51 A;  4IO7 A;  4NF5 A;  5I58 B;  3I6V A;  3TMG A;  5H8N A;  4O3C A;  2VOZ A;  4YMA A;  3Q26 A;  4DXU A;  5AA2 B;  1FCK A;  3T93 B;  3DP4 A;  4ZEC A;  3OOA A;  3T9V A;  3B6Q A;  4IO3 A;  4OER A;  3IJO B;  1PDA A;  4UA8 A;  1HSE A;  2UVG A;  4GLI A;  2WKY A;  2R9J A;  2V3T A;  3MVY A;  2FNC A;  4X1B A;  1AIV A;  4GFR A;  1WVJ A;  2V93 A;  3FJM A;  3O29 A;  2P0S A;  3K01 A;  1XS5 A;  5BUU A;  3IOW A;  1NH7 A;  3FV2 A;  4BDN A;  3CI8 A;  3TCG A;  3I3V A;  3IB0 A;  3S4U A;  1BIY A;  1LB8 A;  1FTJ A;  3KJ7 A;  3PD9 A;  4YIC A;  2AL4 A;  5KZT A;  4GRK A;  3PGF A;  4EQ7 A;  1PBP A;  2DYX A;  4U1O A;  3UN6 A;  4ZEI A;  4IO6 A;  3A3U A;  1MG1 A;  2I0C A;  3S9M C;  1N3W A;  1IQ7 A;  4GVO A;  5CMM A;  4AB6 A;  4G68 C;  4U23 A;  2VD2 A;  1MRP A;  2DP8 A;  5I2K A;  3TTN A;  2OLB A;  1JVX A;  4H5G A;  4BDM A;  2Y84 A;  4IO2 A;  3AXF A;  2XX9 A;  1ATG A;  3RLF E;  1OVB A;  3FIR A;  4F1V A;  5AA2 A;  1LB9 A;  3FVG A;  1POY 1;  1F9B A;  5L8D A;  3V8X B;  4QFL A;  3FVK A;  1VFE A;  1NH8 A;  2CMO A;  5EHM A;  1LAG E;  3QK6 A;  2H98 A;  3PPN A;  3PPP A;  2VP1 A;  1O7T A;  2I4C A;  3QYT A;  1UTH B;  3GBB A;  3T22 A;  1MY0 A;  2VHA A;  2IA4 A;  5KDT B;  3FAS A;  1MH4 A;  1A7L A;  1OQG A;  1EZ9 A;  1I69 A;  1YTV A;  4ELO A;  1B3G A;  2B3B A;  1BKA A;  1R9L A;  4KI0 E;  4IGT A;  1R6Z A;  1XOC A;  3MZ9 A;  1HSJ A;  2NXO A;  1JVY A;  1QUL A;  3T9U A;  3MBP A;  2I3W A;  2O7I A;  5JK4 A;  1SVX B;  4RXL A;  1B0L A;  5A5X A;  1B3H A;  1FQD A;  4E0W A;  3PUX E;  1BP5 A;  3E13 X;  4QSD A;  1MQH A;  1B7H A;  4WKM A;  3PMX A;  3IB2 A;  2AIX A;  4RYA A;  4RJZ A;  3O66 A;  4JXI A;  3TZA A;  2FA7 A;  5EHS A;  3PMW A;  2XXR A;  3N94 A;  3PUW E;  1LGB C;  1XVX A;  3PPQ A;  5DVF A;  3MAM A;  4RY1 A;  1D3K A;  4YZZ A;  3KSJ A;  2PX1 A;  2HFB A;  4OYV A;  1SI1 A;  1B7U A;  1UTH A;  4EF2 A;  3OO7 A;  3CFX A;  4UAC A;  4X9T A;  4Q5T A;  4OEN A;  1LFH A;  5ICQ A;  4BDL A;  2YPN A;  4OHN A;  3FXR A;  1O64 A;  4AB5 A;  4XKN A;  3ZKK A;  2UVH A;  1D4N A;  3ECR A;  4F19 A;  4PFW A;  2DQV A;  4HS7 A;  1LLS A;  4FJP A;  2XX7 A;  2QPQ A;  2RC7 A;  1FQF A;  3LBS A;  3S9N C;  2ZNU A;  1MXW A;  4LZ7 A;  4BDR A;  3H6U A;  3T66 A;  1IXI A;  1DPE A;  5CBR A;  3D4C A;  3HHG A;  4YKI A;  3W15 C;  3KEI A;  1DTZ A;  4F2O A;  4OWD A;  2HCA A;  4KQP A;  3SEW A;  4LP2 B;  3KG2 A;  3UGW A;  4RPO A;  3O2A A;  4U4S A;  1R9Q A;  4YAH X;  3IB1 A;  2XXQ A;  3CFL A;  4XTC Q;  5LOM A;  3SEX A;  1Z7N E;  4ZZA A;  1MDP 1;  4M4G A;  1GR2 A;  4QFK A;  3RQT A;  1IIT A;  2H9B A;  1N0T A;  1P99 A;  3JZJ A;  1SI0 A;  2Y7W A;  3K6X A;  5CRY A;  1SW1 A;  1A8F A;  5I2N B;  4YKK A;  3PPR A;  2ZYK A;  3BFT A;  4G8H A;  3BFU A;  3R7X A;  5I56 B;  2I49 A;  4HTG A;  2OCU A;  2QSX A;  2F7B A;  5B70 A;  5L9M A;  1MPC A;  3VVD A;  1US5 A;  1OQH A;  4P0G A;  3VLU A;  3UK4 A;  3IOU A;  2YJP A;  2Q9T A;  3THI A;  2GH9 A;  5HPQ A;  2I6E A;  3HO7 A;  4G2Z A;  4DDD A;  1Y9U A;  5DTB A;  3MVZ A;  2DE3 A;  2R71 A;  3G3H A;  1L5T A;  1Y1M A;  4G8N A;  1TT1 A;  3V83 A;  4G8M A;  3GZG A;  3U8Q A;  4EXK A;  3G3I A;  3TTL A;  3ONM A;  4R72 A;  4Q0C A;  1H76 A;  1SQY A;  1MXX A;  3CSG A;  1MQI A;  1LCT A;  2ZMB A;  3SET A;  4YMB A;  2D3I A;  4ZEK A;  4X1D A;  4F31 B;  2UYE A;  4QRZ A;  4YB7 A;  4JWO A;  1DMB A;  3TTK A;  1IZ1 A;  4YU0 A;  4I8C A;  3C31 A;  3T9H B;  2XXV A;  3MWB A;  2F78 A;  4O3B A;  5I2N A;  1IXH A;  4XKR A;  2H5Y A;  3FVO A;  2I3V A;  2XD3 A;  3TPA A;  1B2H A;  3MUQ A;  5I56 A;  3M3K A;  2A5S A;  1B7Z A;  2XXI A;  4LUB A;  4NWD A;  1N3X A;  3JYR A;  3A3C A;  4KCD A;  3MPK A;  3OXN A;  4RPN A;  4N07 A;  1JEV A;  3EF7 A;  1ZU0 A;  1FQB A;  1WDN A;  3RTF B;  1SD3 A;  1QKB A;  3FXQ A;  3H6V A;  1KWH A;  3E9X A;  1H43 A;  2X26 A;  4BDQ A;  3OSQ A;  2Z8D A;  1Y3P A;  1ZBM A;  2RF1 A;  4Z7E A;  1MQJ A;  1TFA A;  3LC8 A;  2DE2 A;  2H99 A;  5F7V A;  3QUJ A;  1PEB A;  3RPW A;  1MXV A;  3TEP A;  1OLA A;  3FXU A;  3K00 A;  2HZL A;  1H3D A;  3MC2 A;  1OLC A;  4FEC A;  4KFQ A;  1TXF A;  4ZED A;  3N6U A;  2NVU B;  3H4Z A;  4NED A;  3V5A A;  3LR1 A;  4TLL B;  3VXC A;  5KCJ A;  4OES A;  4F3S A;  2ZNS A;  2O1L A;  1A99 A;  1J1N A;  2PT2 A;  2Q2C A;  2CZL A;  3FJ7 A;  1B3E A;  1Q35 A;  2DOJ A;  4L17 A;  1AH5 A;  1AOV A;  1M5E A;  2QS1 A;  2VGQ A;  3VDF A;  4DCY A;  2AYS A;  1Y1Z A;  3M3F A;  1A8E A;  1FQA A;  1P1W A;  2NWJ A;  5H8H B;  5ICT A;  1TFD A;  1TWY A;  1SW2 A;  1VR5 A;  3H6T A;  2PBW A;  3U72 A;  4XIG Q;  1DSN A;  4IGR A;  3OO6 A;  1SW4 A;  4LVQ A;  3EN3 A;  2PVU A;  1A40 A;  3TFL A;  4G4P A;  5L9S A;  1O63 A;  3ZS6 A;  5ISU A;  3QIM A;  3PMV A;  3L6G A;  5AA4 A;  1NNP A;  3FJG A;  4GXA A;  1QUJ A;  4POW A;  2O7U A;  1JW1 A;  5A5X B;  2O1M A;  1N04 A;  5BWJ A;  4TLM B;  4IY5 A;  1ZKB A;  2BJJ X;  4Q8R A;  2ONS A;  1GGG A;  2P1S A;  4H1X A;  1QVS A;  1IUD A;  2G93 A;  3IO4 A;  1B5H A;  3C32 A;  2Q8J A;  2M8C A;  3DLN A;  2ZNT A;  4F18 A;  3IJX B;  3GLB A;  3LSL A;  3CVG A;  3T96 B;  2I4B A;  3TKD A;  2OBG A;  2XHD A;  4ZZE A;  4R9G A;  4F3P A;  5H8H A;  4R2B A;  4GQO A;  1SYH A;  1II5 A;  3MZB A;  4H65 A;  4R75 A;  2Z22 A;  2ZYM A;  2V3U A;  1DOT A;  3K02 A;  4U1Z A;  1RYX A;  3PV0 E;  4O3A A;  3G3K A;  3G3F A;  2QRY A;  1OVT A;  3KOT A;  3E3K A;  2B3F A;  3KN3 A;  4AQ4 A;  2HAV A;  1XHY A;  3FUZ A;  4ZE9 A;  1B4H A;  3Q25 A;  3MP6 A;  4GD5 A;  3M8U A;  4K3F A;  3VVF A;  3G3J A;  1A54 A;  1M5B A;  1Z7M E;  4ZEF A;  2Q89 A;  3B6T A;  4EQB A;  1N7X A;  4ESW A;  1B3F A;  4JBZ A;  4R2F A;  1FTK A;  4F3B A;  3KGC A;  1UTB B;  2ZYO A;  4MBP A;  2F34 A;  1ZTY A;  2GHB A;  4OFO A;  4PP0 A;  3G3G A;  3ZKL A;  1BTJ A;  2O69 A;  2R6G E;  1PC3 A;  1MQD A;  3HV1 A;  4IO5 A;  5CMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...