4MLQA

Crystal structure of bacillus megaterium porphobilinogen deaminase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
310
structure length
289
Chain Sequence
b'SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKLLIDRVKEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Porphobilinogen deaminase
publication title Structural evidence for the partially oxidized dipyrromethene and dipyrromethanone forms of the cofactor of porphobilinogen deaminase: structures of the Bacillus megaterium enzyme at near-atomic resolution.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transferase
total genus 95
structure length 289
sequence length 310
ec nomenclature ec 2.5.1.61: Hydroxymethylbilane synthase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01379 Porphobil_deam Porphobilinogen deaminase, dipyromethane cofactor binding domain
A PF03900 Porphobil_deamC Porphobilinogen deaminase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.40 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Porphobilinogen deaminase, C-terminal domain 4mlqA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4mlqA02
4THIA 3OSQA 1MXXA 4BDRA 3TPAA 2R6GE 4RJZA 3C33A 1WDNA 4ELRA 4F3BA 1SQYA 3GBBA 4N6PA 2I3VA 5H8SA 4TLMB 2FA7A 4XKQA 4L17A 1QULA 4O3AA 2ZNTA 2HAVA 3C31A 4EQBA 3IJOB 4U2RA 3CVGA 3TCHA 5HM4B 1QKAA 4R74A 3V83A 4RK2A 4QRZA 3RUMA 3PMVA 3RT8A 2XXRA 2ABHA 4F31B 1FTOA 5H8QB 1MQIA 3TYHA 4H1XA 1OLAA 4EQ9A 4R6HA 4OFJA 1PC3A 1XVYA 1EU8A 2F5XA 4AB5A 3QXMA 1N0TA 1BKAA 2GFEA 1S9TA 3BFTA 4ZEFA 1LBCA 2P0SA 4YKKA 4BDQA 5A5XA 4ZEDA 3OMBA 2XX7A 4DXBA 3N26A 2H4IA 1XVXA 3K1NA 4NF5A 1HSEA 4F1VA 2UVJA 1I6QA 2NUVA 4F1UA 2ONSA 1II5A 4H8IA 1FQAA 4JWYA 2Y7WA 5FHMA 4G68A 1O64A 5KZTA 4F22A 2E1SA 4OWDA 3TTLA 4R2BA 4C0RA 3IJXB 1WVJA 4U4XA 2QS4A 1O63A 1MM6A 1H3DA 2V3TA 1N84A 3PV0E 1M5FA 3TEPA 4RPNA 1IXIA 3VVEA 3KJ7A 3RY3A 3SETA 4ONYA 2LAOA 1B3EA 5DYHA 5F7VA 3OO6A 4TOZA 2VGQA 4OTEA 1H45A 2Y7PA 1L5TA 2AYSA 1B58A 2ZYNA 4LA9A 1B0LA 1DTGA 4NF8B 1PB7A 3KGCA 1LFIA 4R75A 1B4ZA 4Q30B 1P1UA 3G3GA 1Z7ME 4GOTA 1XOCA 3K1MA 4R9GA 4H8JA 1N76A 2RF1A 4LQ5A 1NH7A 3UK4A 1MY1A 4IO3A 1R6ZA 4OZ9A 5BWJA 2ANJA 1LB8A 1Y9UA 3DP4A 2D3IA 4IGRA 2Q8JA 4YMAA 5H8NB 3IB0A 3MP8A 3SEWA 1ZTYA 2F97A 4QFKA 4G2ZA 4KI0E 4M1VA 2THIA 1N3WA 3CG3A 5CM6A 5DEXA 5AA1A 1SYIA 2Q89A 2RINA 3DM0A 4XXUA 1MDQA 2B65A 1BTJA 3HV1A 2PT1A 3H6UA 3H06B 2NWJA 3LUYA 1RKMA 4Z7EA 2CZLA 2RCBA 2HEUA 5AA2D 3H03A 3SEXA 3SEVA 3T22A 1IXCA 2Y7IA 5KDTA 3OO8A 1MY2A 1VSOA 3FXRA 1Y3NA 2O51A 5TP9A 1YCJA 1B7UA 5DTBA 1MY4A 1B3GA 4IGTA 4R6KA 3I6VA 2QJEA 2I58A 3MW0A 3MAMA 4NF6A 2I4BA 3IOVA 5H8HB 1MS7A 5I58B 4I1DA 3FJGA 3ZSFA 2UXAA 2B3FA 4DCYA 3ILTB 2REJA 3VE1B 1B2HA 1MXVA 4U23A 3FVOA 2QMXA 3TTMA 4DXCA 2V3UA 1NNFA 4MLVA 1B46A 3LSWA 1MDP1 3HPIA 1DTZA 2PMSA 3OEMA 1UIUA 4Q8RA 3S2VA 4RPOA 5JTYA 3TDJA 2AIXA 1QKBA 2H5YA 4OERA 4N07A 2I0CA 1F9BA 1Y4CA 1B05A 1P1OA 1UQWA 2DOJA 3MUQA 3Q26A 2IA4A 1WODA 3TCGA 2O69A 5AA4B 5KCJA 4JXIA 4F3SA 1R9QA 4XKNA 4LATA 1A8FA 2XXHA 5L8DA 1P1WA 4DIGA 4EXKA 3A3UA 3MPKA 4FECA 3JYRA 1NNTA 4HCWA 1VR5A 4PE5B 3S9LC 1MXUA 3TTRA 1SD3A 1MQJA 3L6HA 4I9DA 1OVTA 4GF8A 1MPCA 3QK6A 3TCFA 5ITPA 3GXAA 1EZOA 3V8XB 5CBRA 1LAXA 1PEBA 4H0WA 4ZZEA 2F35A 4BDOA 3KFMA 3KN3A 2QL3A 4ND9A 5I2NA 1D3KA 4PQJA 1YTVA 3PUZE 4F1YA 1UTHB 3OO9A 2I0BA 5H8FB 1S50A 2PBWA 2DSFA 3QUFA 4XTCQ 3FVGA 1R1NA 3W15C 1FCKA 2BJJX 2DS9A 4QSCA 5F1QA 4WKMA 3OD7A 1LAHE 1NKXA 2H99A 4OETA 1Y1ZA 4O3BA 2D5WA 5AA2A 3IX1A 1Y1MA 3SESA 1N7XA 5DVFA 2V93A 4LZ8A 3VLUA 3V5AA 2VOZA 2R71A 2I6EA 3PUYE 1PBQA 1POTA 1NNPA 3Q27A 3EN3A 4IO4A 3ODBA 5CMBA 2AL5A 4PFWA 4F19A 4F3GA 1MH3A 3IAZA 3MVYA 3T93B 2XXUA 4KCCA 5CMMA 1B5HA 1NH8A 1QUIA 2H25A 1O7TA 4ELPA 4KQPA 4G8NA 3PPOA 2OZZA 1P1QA 5ITOA 4R73A 3H6WA 2A5SA 1GGGA 3TFLA 3O9PA 4XKRA 4NWDA 3R6UA 3P7IA 3KN8A 4H6DA 4K3FA 5L9MA 3KN7A 2W7YA 3E4RA 5CMKA 4BDNA 4PFTA 4LZ5A 1MH4A 1H44A 5I2KB 5CMCA 5FHOA 5DT6A 4P11A 4LP2B 2V84A 3FXUA 4EQ7A 1N3XA 4OFOA 4U4SA 3SEUA 2B3BA 4JSOA 3TAJA 4GL0A 4F2QA 1NL5A 4KYEA 4WXJA 5I59A 3IL1B 4WEDA 1USYE 4KCDA 1TT1A 5TPAA 2ALUA 3O6HA 1JW5A 1M5BA 3RTFB 3SEYA 4JWOA 4RXLA 3OOAA 4X48A 2D21A 2F7AA 4EXLA 3IOWA 4BLAA 1USYH 3R7XA 4FIMA 1A40A 4OHNA 1MQHA 3MBPA 5K2YA 2KLFA 3M3KA 4GFRA 4EF2A 3OSRA 3FVNA 4ZEKA 1M5DA 2RCAA 2P1SA 3N5LA 1B9JA 1JNFA 3CSBA 1N7WA 3PPNA 1JEUA 2DVZA 1POY1 3FVKA 1PB8A 2DXRA 2REGA 1FQBA 1FTKA 3UP9A 4GXSB 4PP0A 1LAGE 1UTBB 4KYDA 3IOTA 2UVHA 3KZGA 4GLIA 2UVGA 1EZPA 3IB2A 4ZEIA 3HCQA 1FQCA 1BIYA 3UORA 3PUXE 5I57B 5B70A 3O66A 3Q29A 2DWAA 3UIFA 3K1PA 4YZZA 1MY0A 3IOUA 2OBGA 4ISUA 1Q1KA 4KYSA 4PFYA 1YPNA 3MC2A 4FORA 4RNSA 3K02A 3U92A 2Z8EA 1P99A 2GHBA 1RYXA 1A99A 4JB7A 2DVCA 4IO5A 2GRVA 3K6XA 4F18A 4H5GA 2DWJA 3K2DA 3FJ7A 5FTHA 4FJPA 3F11A 4YICA 3LR1A 3MZ9A 2FYIA 1H76A 1IITA 1B52A 4EDPA 4Q5TA 4ZEBA 2YJPA 3MVZA 4YMBA 2F6PA 3RN8A 4LUBA 3UN6A 5IAIA 2Z22A 4G68C 4TLLB 4JSDA 1QW0A 5BUUA 4IO2A 1FQFA 1MRPA 3RTWB 1GTKA 1MXYA 2VHAA 4UACA 3FUZA 3H7MA 3WAFA 4HTGA 1DPEA 3FJMA 4GD5A 5AA4A 5M2VA 1VFEA 3ZS6A 2VD3A 4YAHX 3PU5A 3K4UA 3H6TA 2I4CA 4ZS9A 1JEVA 3MZ1A 2O1LA 4LONB 4GVOA 1OVBA 2H98A 4MLQA 3MVXA 3FXQA 1VE4A 2GH9A 2OJTA 2F78A 3B7DA 3D4GA 1IXHA 1DMBA 3JV9A 3KSXA 2ZYKA 2PX1A 2A5TA 3M3FA 3G3KA 4ZDMA 1UTHA 1B3LA 1B51A 4NF5B 5ISUA 1B40A 1FTJA 3C4MA 3FGSA 3C32A 1B1HA 5K2XA 3I3VA 5TU0A 3N6TA 4OFLA 2DE2A 1GR2A 1FQDA 2ZXTA 3FATA 2Q9TA 1MQDA 3KSJA 1ANFA 3TTNA 2O1MA 3CG1A 3C34A 3M3LA 3PGFA 2OLBA 1AOVA 3TQLA 3FV2A 4ZE9A 2XD3A 3CFXA 1QUKA 2QPQA 3KJTA 4KR5A 2DYXA 2FNCA 3G3HA 1ZMGA 3L6GA 4BDLA 2H9BA 2XXTA 1DSNA 3E3KA 2HZLA 4R72A 4C1UA 2Z23A 1SVXB 3EPEA 2Y7RA 5HBCA 1ELJA 2XXXA 4R9FA 2XD2A 1OQHA 3MWBA 3S4UA 2XXPA 3KG2A 1LGBC 1N04A 3JZJA 2O84X 1MXZA 3B6WA 4ZE8A 3OXNA 4X1BA 5I2KA 2F34A 1B5IA 4GL8A 2ZYOA 4E0XA 1HSJA 3V89B 1MY3A 4P0IA 1SW4A 1URSA 1H43A 3LC8A 5DEXB 3RT6B 2XXVA 4QFPA 1B3HA 3B6QA 3UA8A 3U93A 3U72A 4N13A 4QFOA 2Z8DA 3W9WA 4OEVA 3MQ9A 1JW1A 1LFGA 4OVJA 3LSFB 3A09A 1EH3A 3CI8A 1AMFA 3TKDA 3HHGA 2RC8A 1BLFA 3KEIA 4JBZA 5DVJA 1D4NA 4DDDA 5KDTB 4KD5A 4HW8A 1IIWA 1D9VA 3VXCA 1XS5A 1FQEA 4POXA 5TP9B 1PBPA 3O29A 5CI5A 4DCXA 4U21A 2QS2A 2GHAA 1A8EA 1B1XA 4Q0CA 2E0SA 5H8QA 4JDFA 1YAEA 3TQWA 4JWXA 3K01A 4X9TA 4U1ZA 1US5A 1MQGA 3EF7A 4IO7A 3RNNA 3RQTA 4PETA 2XXYA 4O3CA 5L9SA 2VP1A 3G3JA 3T9XB 4GIZA 2XXWA 2Y7KA 3HSTA 3PMWA 4F29A 1SI1A 3QUJA 3DP6A 1IQ7A 3FZVA 4OMBA 1Y3QA 3K0VA 2QS1A 3MVWA 4FAJA 4IO6A 4H67A 3PD9A 1JVYA 3B6TA 3K6VA 3EHUA 2AL4A 4DLDA 1Q35A 1B0HA 3GZGA 3CSGA 1URGA 3I5OA 5JTYB 2DE4A 2IEEA 4R6YA 1FTMA 4OENA 2O7IA 5KCJB 3IR1A 3T9UA 1NMUA 2V3QA 2PVUA 3C9HA 3PUWE 2YPNA 5AE4A 3MPLA 2UYEA 1EZ9A 1LAFE 4GQOA 4QFLA 4QSEA 3LSLA 3MP1A 1QJMA 3KOSA 4NF8A 5CRYA 1B6HA 3QAXA 3OENA 4HS7A 5ELVA 5I84A 2F7CA 1US4A 3KOTA 1IUDA 1B7ZA 2F36A 4GXAA 3MZBA 3ONMA 4U1OA 3WAEA 1Y20A 5I2NB 4NF4B 3USDA 3ILUB 3E13X 4E0WA 1Y4TA 3G7WA 1DPPA 1ZJLA 4G77A 2HXWA 3TODA 3T96B 3QIMA 5H8NA 4YKIA 3IO6A 1CE2A 4QFNA 3G3FA 2QRYA 1LSTA 1ZBMA 4ZECA 2F6GA 4NE4A 1AIVA 3EHSA 2G93A 1MPDA 5AA2B 1LCFA 1DOTA 3ECRA 5EYFA 2Q2CA 3E9XA 3THIA 4AB6A 1SBPA 4EUOA 3Q25A 1SW2A 4WEPA 3QSLA 4OQOA 4IY6A 5JEIA 3OEKA 1B32A 4GRKA 5I56B 1FW0A 3M8UA 4LVQA 3CRBA 4FEBA 3PUVE 3LSXA 2PT2A 5FTIA 5CC2A 1NNKA 1IXGA 1SW1A 2ONKE 1IEJA 3BFUA 2DWIA 3TUSA 5H8HA 1MPBA 4IB2A 4EF1A 4IY5A 4G8MA 1S7YA 5I58A 1LFHA 3VVFA 4ESXA 1A54A 3PMXA 4ELOA 1PDAA 3K00A 1I69A 2CMOA 4QF9A 3U8QA 1URDA 1XT8A 3H3GA 3EQ1A 4F3PA 3W9VA 4MFIA 2Z8FA 1GV8A 2X7QA 3O28A 2NVUB 4POWA 3H4ZA 4ECFA 3VV5A 4M4GA 3TMGA 1RYOA 2DWHA 4RK9A 4ESWA 2Q88A 5I59B 5HPQA 3RPWA 4LQ2A 2F8DA 1OMPA 5TPAB 1AH5A 1MG1A 2Q2AA 3PD8A 2I3WA 4YB7A 2I49A 1M5CA 2OK2A 2ZNSA 3Q28A 4FE8A 4XIGQ 2HQ0A 4X1DA 3K6WA 3GLBA 2QSXA 3O6IA 1LLSA 3DLNA 3HN0A 1LB9A 4NWCA 4DZ1A 4C1TA 1LCTA 3O97A 4RA1A 4DXUA 1Z7NE 3CFLA 1ZIUA 5EHSA 5IKBA 2HFBA 3R26A 1Y3PA 3MJNA 5JK4A 1I6AA 4HCYA 4P0GA 4ELQA 3D4CA 2X26A 3FV1A 3SDFA 5A5XB 2ZYMA 3IB1A 1QVSA 1B7HA 1BP5A 5ICTA 3OO7A 3K6UA 5J1DA 1GVCA 5H8FA 2O7UA 3CIJA 2R9JA 3AXFA 4I62A 3PPPA 4MBPA 3U94A 4QSDA 5B7DA 2DXYA 4G68B 4OYVA 1OLCA 4U22A 5ICQA 3A3CA 3VXBA 3IO4A 2DE3A 1LBBA 2UYFA 5DVIA 1P1NA 3SKPA 3VLVA 3O6GA 1ZLQA 2OCUA 1TXFA 4NMYA 4ZZAA 4G4PA 4OEUA 4YB6A 4I8CA 2HCAA 2OWTA 1B5JA 2QMWA 2QS3A 2DQVA 1TFAA 2XHDA 3OELA 3PPRA 4GWOA 3HO7A 2OWSA 2XX9A 1ZKBA 1HSLA 1MXWA 4MF3A 4H5FA 2RKMA 1A7LA 3HHFA 5FHNA 4R2FA 2UVIA 3TZAA 4RY1A 3T9HB 4YU0A 3BBRA 1SW5A 1ZU0A 4FEDA 3N6UA 1I6BA 3FD3A 2G29A 3QYTA 3CFZA 1FTLA 3T66A 5EHMA 3KBRA 1J1NA 4UA8A 3H6VA 3C36A 2VD2A 3O2AA 4QHQA 2M8CA 2DP8A 1JETA 3DP8A 1A55A 4OESA 4OXVA 4KFQA 2NXOA 3VFJA 1SI0A 2NOOA 4LZ7A 1XHYA 1NFTA 3BKIB 3CR9A 4KHZE 4YKPA 3FASA 1OIBA 1KWHA 3ZKKA 4TQUQ 3IORA 1PB9A 1TWYA 1CB6A 2ONRA 3VDFA 3S9MC 1VFDA 4PFUA 3RLFE 1SDXA 3G3IA 1OQGA 4NF4A 1MM7A 4YKJA 2F7BA 2HZKA 4XKPA 4Z0IA 2A5TB 2HAUA 1JQFA 5AA3A 1JW4A 1QUJA 4YB5A 4NEDA 1D9YA 2XXIA 1JVXA 1IZ1A 4NF6B 4KPTA 3DELB 1B4HA 3S9EA 3RGYA 4RYAA 4F39A 3T9VA 1R9LA 5CBSA 3U1OA 2XX8A 2ZMBA 3FIRA 1B3FA 3UGWA 2RC7A 2I48A 1UTBA 2ESNA 3PPQA 4F2OA 1SYHA 2O68A 3IK6B 1T0KA 4NTLA 4MH5A 3SERA 3VLWA 5I57A 4DE8A 2WKYA 2O6AA 4FATA 5I56A 2XXQA 3GBAA 2ZNUA 2Y84A 5LOMA 2PYYA 3S9NC 5L9OA 4BDMA 3LBSA 3VVDA 4H65A 2P2AA 3TTKA 3N94A 1TFDA 3ZKLA 1XC1A 1M5EA 3EHTA 3C35A 2V25A 2RC9A 3MP6A 4G8HA 1UIVA 1ATGA 4AQ4A 2X7PA 3TELA 1AL3A 2YLNA
chains in the Genus database with same CATH superfamily
1SPIA 4THIA 3OSQA 1KYQA 1MXXA 4PTKA 4BDRA 5AE2A 3TPAA 1PKPA 2WBDA 2R6GE 4RJZA 3KC0A 3C33A 2EPAA 4LF5E 3C6KA 1WDNA 4MNCA 4ELRA 3OMLA 4F3BA 2EL5A 1SQYA 3GBBA 1IQSA 4N6PA 2I3VA 4N8YA 5H8SA 4TLMB 4QXDA 2FA7A 1G0IA 2RQLA 4PF8A 4XKQA 4L17A 1UHZA 1QULA 4O3AA 2ZNTA 2HAVA 3C31A 4M2ZA 4EQBA 3L00A 3IJOB 4U2RA 3CVGA 3TCHA 5HM4B 5A69A 1QKAA 4R74A 1ZR9A 3V83A 1FPGA 4RK2A 4QRZA 2CZKA 3RUMA 2EN2A 1NV4A 3PMVA 1SR9A 5EYGA 3RT8A 2YRMA 2XXRA 4WXCA 2ABHA 2DMIA 4BCAA 1FTOA 4F31B 1YYOA 5H8QB 4P78A 1MQIA 2LTSA 3TYHA 4H1XA 2EMBA 2M7QA 1OLAA 1EYJA 4EQ9A 4R6HA 4OFJA 2EM8A 1PC3A 1XVYA 1EU8A 2F5XA 2UU9E 2JYAA 2XWIA 1DBZA 4AB5A 3QXMA 1N0TA 1BKAA 2GFEA 1S9TA 4R2DA 3BFTA 2EN6A 2LTRA 2FV4B 4ZEFA 3HTXA 1LBCA 2P0SA 4GX4A 4YKKA 4NHRA 1I94E 4BDQA 4NAPA 2L6MA 1FRPA 5A5XA 4ZEDA 3OMBA 3VYYA 2YZTA 2XX7A 4DXBA 4DR7E 3N26A 2H4IA 2EM6A 4MNIA 4XF5A 3IWCA 5IGAA 1DCUA 1FPJA 1XVXA 4JYAE 3K1NA 4DV1E 4X9JA 2MDGA 1KJKA 1HSEA 4NF5A 4F1VA 4JI5E 4N17A 2UVJA 1I6QA 2NUVA 2FIXA 4F1UA 1TF6A 2ONSA 1II5A 1F2IG 4H8IA 1FQAA 4JWYA 1XI6A 2Y7WA 5FHMA 4GWXA 4G68A 1O64A 1IMCA 2PRTA 4N8GA 5KZTA 4F22A 2E1SA 4OWDA 3TTLA 1G0HA 4R2BA 4C0RA 3IJXB 1WVJA 4U4XA 2LJUA 2QS4A 1O63A 3B50A 1FBPA 1FJGE 1MM6A 5KL5A 1H3DA 2V3TA 1N84A 5T3JA 3PV0E 2LUQA 1XNRE 1M5FA 3TEPA 2EOOA 4RPNA 4WSPA 1IXIA 2VRDA 2A25A 3VVEA 3KJ7A 1N34E 2DDKA 3RY3A 3SETA 1UN6B 4ONYA 2LAOA 1B3EA 1FPEA 3KZZA 5DYHA 5F7VA 1FPFA 3OO6A 4TOZA 4N6KA 2VGQA 4OTEA 1H45A 2EPKX 2Y7PA 1L5TA 2AYSA 3MSTA 1B58A 5EQ9A 2ZYNA 4LA9A 2V87A 1B0LA 1DTGA 4NF8B 2B4MA 2XXKA 4WYQB 2EM5A 2EPLX 1PB7A 3KGCA 1LFIA 4R75A 4DR4E 4PBHA 1B4ZA 4Q30B 2JXPA 1P1UA 3G3GA 1Z7ME 4GOTA 2NUEA 1XOCA 3K1MA 4R9GA 4H8JA 1N76A 2RF1A 4LQ5A 4F9CB 1NH7A 3UK4A 4X62E 1MY1A 4IO3A 3IFCA 2YTDA 1R6ZA 4OZ9A 4O24A 5BWJA 2ANJA 1LB8A 2DSYA 1Y9UA 3DP4A 4X04A 2D3IA 4IGRA 2Q8JA 4YMAA 2UXBE 4PAFA 3SZPA 5H8NB 4PCDA 2EPMX 3IB0A 3MP8A 1HNZE 2ZZVA 3BIDA 3SEWA 1ZTYA 2F97A 4QFKA 4G2ZA 4KI0E 4M1VA 2THIA 1N3WA 2K4VA 3CG3A 5CM6A 2JVAA 5DEXA 5AA1A 1SYIA 2Q89A 2RINA 5IWAE 3DM0A 4XXUA 4HE2A 3VHTB 1MDQA 2B65A 1BTJA 4P7DA 3HV1A 4MAGA 2PT1A 3H6UA 3H06B 2NWJA 3LUYA 1RKMA 4Z7EA 2CZLA 2RCBA 4OVPA 4JVDA 2HEUA 2LJHA 3H09A 5AA2D 3H03A 5IZZA 3SEXA 3SEVA 3IFAA 4I8OA 3T22A 2HGHA 4GKKE 1IXCA 2LMZA 2Y7IA 3EPKA 5KDTA 3OO8A 4DI4B 1MY2A 1VSOA 5A6BD 1DK4A 1X6HA 3FXRA 2EN4A 1Y3NA 2O51A 1EYKA 5TP9A 1YCJA 1B7UA 5DTBA 4DUZE 1B3GA 1MY4A 4IGTA 4R6KA 3I6VA 2QJEA 2EPZA 2I58A 3MW0A 3ADGA 1YUIA 1KA1A 2KHXA 2NA2A 1IBLE 4GWSA 3MAMA 4R2PA 1YFHA 4NF6A 2I4BA 3IOVA 4DKKA 5H8HB 1MS7A 2V8QB 2FVZA 2CZHA 5I58B 4I1DA 3FJGA 3ZSFA 2UXAA 3HQ1A 2B3FA 2GHFA 3HPZA 4DCYA 4OVTA 2DIXA 2BBGA 3ILTB 2ELZA 2REJA 3VE1B 2UXCE 1B2HA 5KL3A 1MXVA 2M1SA 4U23A 3FVOA 2QMXA 2EOZA 3TTMA 2EPXA 4DXCA 1MGTA 2EMIA 2EORA 2V3UA 1NNFA 4MLVA 4DV2E 1B46A 2MC5A 4BHCA 2EOJA 3LSWA 1MDP1 2RS6A 3HPIA 2LCEA 1DTZA 3J7AG 2PMSA 3OEMA 1UIUA 4OVQA 2EMCA 1YZ9A 4Q8RA 4LF4E 3S2VA 3EKIA 4RPOA 5JTYA 3TDJA 1A1KA 2AIXA 4MEVA 3B8BA 2F3BA 2HC5A 1QKBA 2H5YA 4OERA 4N07A 2I0CA 2NUFA 1NUYA 5CFFE 2MKZA 2JOXA 2UUBE 1F9BA 1Y4CA 2L2KB 1B05A 1P1OA 1UQWA 2DOJA 3JTZA 5A6KA 3MUQA 2F4VE 3Q26A 5F24A 2IA4A 1WODA 2XWKA 2O69A 3TCGA 5AA4B 5KCJA 4JXIA 2EJ4A 4F3SA 1R9QA 4XKNA 4LATA 1A8FA 2EN8A 2XXHA 1WJPA 4M0VA 2MKDA 2E5LE 5L8DA 2LE2A 2B7VA 2DLKA 1P1WA 4DIGA 4EXKA 2ENAA 5KL6A 1YZ0A 3ADIA 3A3UA 3MPKA 4P9KA 2LUPB 4FECA 3JYRA 1NNTA 1IMUA 4HCWA 1N33E 1VR5A 4PE5B 3S9LC 1MXUA 3TTRA 1SD3A 1MQJA 1OVTA 3L6HA 4I9DA 4GF8A 1MPCA 3QK6A 3TCFA 4BBYA 2EOEA 1NV3A 5ITPA 4I40A 2EN1A 3GXAA 5I5PA 4LU9A 2QVUA 1EZOA 1CNQA 3BIGA 3V8XB 4MX6A 5CBRA 1LAXA 1PEBA 3BIHA 4H0WA 4P47A 2F35A 4ZZEA 4BDOA 3KFMA 3KN3A 2QL3A 4ND9A 5I2NA 2EZ6A 1D3KA 4PQJA 1T38A 1YTVA 3PUZE 5ET8A 4F1YA 3FIGA 1UTHB 3OO9A 2I0BA 4NHBA 5H8FB 1S50A 2PBWA 4XEQA 2JOBA 2DSFA 3QUFA 2L8TA 4XTCQ 1A1LA 3FVGA 1R1NA 3W15C 2ZZXA 1FCKA 2N8XA 2BJJX 2DS9A 4QSCA 5F1QA 4WKMA 3OD7A 1LAHE 1NKXA 2H99A 1FBHA 4OETA 1Y1ZA 3GYYA 4O3BA 2D5WA 5AA2A 3IX1A 1Y1MA 3C4TA 3SESA 4LN5A 1N7XA 5DVFA 2V93A 4LZ8A 1NUZA 3VLUA 3V5AA 2VOZA 5A6BA 2I6EA 2R71A 3PUYE 1PBQA 1POTA 2WX9A 3T0JA 1NNPA 3Q27A 3EN3A 4IO4A 2LBSB 3ODBA 2ZZWA 5CMBA 2AL5A 4PFWA 1LBWA 4F19A 4JI3E 1N36E 4F3GA 1MH3A 3IAZA 3MVYA 3T93B 4HE0A 2XXUA 4KCCA 5CMMA 1B5HA 1NH8A 1QUIA 2H25A 1O7TA 4ELPA 3C6MA 4NQ8A 3MHHC 4KQPA 1X3CA 4G8NA 3PPOA 2OZZA 1P1QA 5ITOA 4R73A 1GZ6A 3H6WA 2A5SA 1GGGA 3TFLA 3O9PA 4XKRA 2EMWA 4NWDA 2YTEA 3R6UA 3P7IA 3KN8A 4H6DA 4K3FA 5L9MA 3HPSA 3KN7A 2W7YA 2VT5A 3E4RA 5CMKA 4JI2E 3P1XA 4BDNA 2GLIA 4PFTA 4LZ5A 1MH4A 1H44A 4KWYA 5I2KB 5CMCA 2ODRC 4N15A 5FHOA 3ADLA 4F2JC 5DT6A 5ADZA 4P11A 2ZM6E 2PCRA 3KZYA 4LP2B 2V84A 1KA0A 3FXUA 4EQ7A 2YU8A 1YYKA 1NV1A 1N3XA 1A1IA 2DRPA 4OFOA 4U4SA 3SEUA 2B3BA 4JSOA 3TAJA 4GL0A 3ZOQB 4F2QA 1NL5A 3QG5C 4KYEA 1WRJA 4WXJA 5I59A 4BC9A 1Q9DA 3IL1B 1HNXE 4WEDA 4LF7E 1NUXA 2WCC3 1USYE 4KCDA 1TT1A 5TPAA 2QVVA 4P1EA 2ALUA 3O6HA 1FPLA 4B3RE 4PBQA 2V88A 2OX3A 2H36X 1JW5A 1M5BA 5IZ3B 3RTFB 1DGCA 3SEYA 4JWOA 4RXLA 3OOAA 4X48A 2D21A 4DV6E 4MJOA 2F7AA 4FBPA 1O0WA 3IOWA 4EXLA 4BLAA 1USYH 3R7XA 4FIMA 2FTXB 1A40A 4OHNA 1MQHA 3MBPA 5K2YA 4AS5A 4DV3E 4B3SE 2KLFA 3M3KA 4O4KA 4GFRA 4EF2A 3OSRA 3RMPA 3FVNA 4ZEKA 1M5DA 2RCAA 2P1SA 3N5LA 1B9JA 1JNFA 3CSBA 3ISPA 1N7WA 3PPNA 5KL4A 1JEUA 2DVZA 5A6AA 1POY1 1T4NA 3FVKA 1PB8A 2DXRA 2REGA 1FQBA 1YSAC 1FTKA 3UP9A 4JVIA 2E1MA 4GXSB 4PP0A 1FBGA 1FJ6A 1LAGE 1UTBB 4MIJA 4KYDA 3IOTA 2UVHA 3J81C 3KZGA 4GLIA 2UVGA 2EMAA 1IMBA 1EZPA 3IB2A 4IJDA 2XWVA 4ZEIA 1FTAA 4O43A 1FQCA 1BIYA 3HCQA 3PUXE 3UORA 4OVRA 2OWZA 5I57B 5B70A 3DF6A 3O66A 3E78A 4ZYEA 3Q29A 2DWAA 3UIFA 4YY3E 1J5EE 3K1PA 4YZZA 1MY0A 1TN9A 2KQZA 4X8WA 1EKZA 3IOUA 2OBGA 4ISUA 3LLHA 1Q1KA 4KYSA 4PFYA 4F6NA 1YPNA 1ZBQA 3MC2A 4FORA 4RNSA 3K02A 3U92A 2Z8EA 4QBAA 5IXMB 1P99A 2GHBA 1NCSA 3EPJA 1RYXA 1A99A 4JB7A 2CEYA 4I3EA 2DVCA 4IO5A 2GRVA 3THNA 3K6XA 4GX6A 5AE1A 4F18A 4H5GA 2DWJA 2WYPA 3K2DA 4JV5E 2UUCE 1RDZA 2JR1A 3FJ7A 5FTHA 4FJPA 3F11A 1IMAA 4N4UA 5AE3A 4YICA 1RDYA 3LR1A 3MZ9A 2EL4A 2FYIA 1H76A 1IITA 1B52A 4EDPA 4Q5TA 3KBZA 1N32E 2YRHA 4ZEBA 1LEVA 2YJPA 3MVZA 5TSEA 4YMBA 2F6PA 3RN8A 4LUBA 4JVCA 3UN6A 5IAIA 4R03A 2Z22A 2CTDA 2YTOA 1WHNA 3J80C 4G68C 3BBGA 4TLLB 4PAIA 4N81A 2QVRA 4NXME 4JSDA 1JP4A 1QW0A 5BUUA 4R2EA 4IO2A 1NV6A 1FQFA 1MRPA 4O94A 3RTWB 3NOHA 1QU6A 1GTKA 1MXYA 2VHAA 4NGUA 1PJTA 4UACA 3FUZA 1PJQA 2L2MA 3HXLA 3H7MA 4PGPA 4ZYHA 3WAFA 4HTGA 4UABA 2EQ0A 1DPEA 2YSPA 3M99B 2B3TB 2Y5LA 3FJMA 4GD5A 5AA4A 4NX1A 5M2VA 2ENCA 2EOYA 1VFEA 1NUWA 5DW8A 3ZS6A 2VD3A 1INPA 4YAHX 4LF9E 3PU5A 3T1BA 3K4UA 3H6TA 2I4CA 4ZS9A 2YTJA 1JEVA 5KL7A 3MZ1A 2O1LA 5EQAA 4LONB 4GVOA 1OVBA 2H98A 2EOMA 2JPAA 4MLQA 2LO3A 3FXQA 3MVXA 4IS1C 1VE4A 4DUYE 2GH9A 2YTGA 2F78A 2OJTA 2YTQA 3B7DA 1RMDA 3J7Yp 2EE8A 3D4GA 2FIEA 1IXHA 2WBTA 1DMBA 3JV9A 4X65E 3KSXA 1FPKA 2ZYKA 4DR6E 2EM0A 1LBXA 2MC6A 3THOB 2PX1A 2A5TA 3M3FA 2EOIA 3G3KA 2FGGA 4ZDMA 4MCOA 1UTHA 4X64E 2Q74A 1B3LA 2RTXA 4NXNE 1B51A 4L8NA 2VQEE 4NF5B 2KR0A 5ISUA 5DNYA 3RPLA 1B40A 1FTJA 1FBCA 4F6MA 1FBFA 2EWLA 4OA4A 3C4MA 4ZYGA 2VE7C 4O7MA 3FXBA 3FGSA 3AV0A 3C32A 1B1HA 5K2XA 3I3VA 5TU0A 3N6TA 1BK4A 4OFLA 2DE2A 1X47A 2YU5A 1GR2A 1FQDA 2FBPA 2ZXTA 3FATA 2V89A 2Q9TA 1IQOA 4DV7E 1MQDA 3KSJA 1ANFA 2CSHA 4LFAE 3TTNA 2O1MA 3CG1A 2HHHE 3C34A 3M3LA 3PGFA 2OLBA 1AOVA 3TQLA 1FBDA 3FV2A 4ZE9A 2XD3A 2DB2A 3CFXA 1QUKA 1FPIA 2E72A 2QPQA 3KJTA 4KR5A 2DYXA 2FNCA 3G3HA 1ZMGA 3L6GA 4BDLA 1XMQE 2EMZA 5IT9C 5ET6A 2H9BA 2XXTA 4PAKA 1DSNA 1LLMC 1NEIA 1DI2A 2HZLA 3E3KA 4R72A 5IZ1A 4C1UA 2Z23A 1SVXB 3EPEA 5T6JA 2KOUA 2XA5A 2Y7RA 2Q8UA 5HBCA 4B3TE 3CHGA 4R8OA 1ELJA 2XXXA 4R9FA 2G7HA 2EPPA 2XD2A 4N6DA 1OQHA 3MWBA 4H46A 3S4UA 2XXPA 3KG2A 1LGBC 1N04A 3JZJA 2O84X 2LVHA 1MXZA 4DV5E 3B6WA 4ZE8A 3OXNA 4JI0E 4O5GA 4P8BA 4X1BA 5I2KA 2F34A 1B5IA 4GL8A 2ZYOA 4E0XA 1HSJA 3V89B 2WYKA 5LL6R 1MY3A 4LF6E 4P0IA 2JWOA 1SW4A 2EMFA 4O8MA 1URSA 4DR5E 1H43A 3LC8A 4ZYDA 5DEXB 3RT6B 2XXVA 4QFPA 3KWRA 2PFYA 4Q35B 1B3HA 3B6QA 1BB8A 2L5VA 3UA8A 3U93A 3U72A 4N13A 1PJSA 3PTYA 3KC1A 4QFOA 2Z8DA 2LV2A 3W9WA 4NF0A 4OEVA 3MQ9A 1JW1A 4M30A 1LFGA 2EMHA 4OVJA 3LSFB 3F6GA 3A09A 1EH3A 1QGXA 3CI8A 1AMFA 4IR8A 3TKDA 1A1FA 3HHGA 2YT4A 2RC8A 1BLFA 3KEIA 2EOXA 4JBZA 5DVJA 1D4NA 4DDDA 5KDTB 2I13A 4KD5A 4HW8A 1IIWA 2EPUA 1D9VA 3VXCA 5ET7A 1XS5A 1FQEA 2V83A 4MMPA 4POXA 2WEFA 5TP9B 1PBPA 5FLXC 3UK3C 3O29A 5CI5A 1AWBA 4DCXA 4U21A 2QS2A 2GHAA 2LT7A 1A8EA 1B1XA 4Q0CA 2E0SA 1QNTA 5H8QA 3MYUA 4G61A 4JDFA 1YAEA 3TQWA 4JWXA 3K01A 4X9TA 3LMLA 4U1ZA 4YHHE 1US5A 1MQGA 3EF7A 4IO7A 3RNNA 4R2SA 3RQTA 4PETA 3A29A 2XXYA 2EMGA 4O3CA 5L9SA 2VP1A 3G3JA 1LBYA 3T9XB 4PF6A 4GIZA 2XXWA 4HE1A 2Y7KA 3HSTA 3PMWA 4F29A 1SI1A 2YTIA 3QUJA 3DP6A 1UBDC 1IQ7A 3FZVA 2EMKA 4OMBA 1Y3QA 3K0VA 2QS1A 5F3WA 3MVWA 4FAJA 4IO6A 4H67A 4DV0E 3PD9A 1JVYA 4GEQB 4PFRA 3B6TA 3MHSC 1J26A 4X66E 4PDDA 3K6VA 3EHUA 2AL4A 4DLDA 1HR0E 3JU0A 2CEXA 1Q35A 1B0HA 5BR8E 3GZGA 3CSGA 4R2QA 3C4BA 1URGA 1STUA 3I5OA 2RPCA 5JTYB 3DJWA 1T39A 1RQ0A 2DE4A 1X49A 2IEEA 4R6YA 3EPHA 5AC4A 2L2NA 1FTMA 2CZIA 2GQ1A 2V4CA 4OENA 1G2DC 2O7IA 2EQ3A 5KCJB 3IR1A 3T9UA 4RHBB 4P3LA 1NMUA 2EOQA 2V3QA 2PVUA 2MDRA 3C9HA 3BF2A 2WZOA 3PUWE 2YPNA 2BB8A 2DLQA 5AE4A 3MPLA 5LTCA 2UYEA 1EZ9A 1LAFE 5EYHA 4GQOA 4QFLA 4QSEA 3LSLA 4KZSA 3MP1A 1QJMA 3KOSA 4NF8A 5CRYA 1B6HA 3QAXA 3OENA 3IWDA 4HS7A 2Q8MA 2YRKA 3QMFA 1IMDA 5ELVA 5I84A 2EM9A 2MKNA 2F7CA 3MSWA 3K6QA 4OOGC 1US4A 3KOTA 1IUDA 4K0KE 2P3VA 2V86A 1B7ZA 2F36A 4GXAA 1XMOE 1DQ3A 3MZBA 3ONMA 4U1OA 3WAEA 2P3NA 1Y20A 1GQEA 2EOFA 1BBOA 5I2NB 4NF4B 2DMYA 3USDA 3ILUB 3E13X 1VDWA 1X6FA 1Y4TA 3G7WA 4E0WA 1DPPA 1ZJLA 4G77A 2HXWA 4PFBA 3TODA 4X8RA 3T96B 3QIMA 5H8NA 4YKIA 3IO6A 1CE2A 4QFNA 4JI1E 3G3FA 2QRYA 2N3HA 1LSTA 1ZBMA 2F6GA 4ZECA 4FK5C 4NE4A 1AIVA 3EHSA 2G93A 1SFEA 1MPDA 5AA2B 1LCFA 2ADRA 3ECRA 1DOTA 5EYFA 4B3ME 1YUJA 2Q2CA 3E9XA 3THIA 2R76A 2YSOA 1ZBTA 4AB6A 1SBPA 4EUOA 3Q25A 1SW2A 4OX9E 2B9DA 4WEPA 3QSLA 4OQOA 4IY6A 5JEIA 2QFLA 3OEKA 1B32A 4PFIA 4GRKA 5I56B 2EM4A 4BS9A 5IM2A 1FW0A 3M8UA 2GPIA 2VPNA 3IWBA 4LVQA 3CRBA 4FEBA 2EQ1A 3PUVE 3LSXA 2PT2A 2M9AA 5FTIA 5CC2A 1NNKA 1IXGA 1SW1A 2ONKE 3ROJA 4WXDA 3FBPA 4PDHA 2N3GA 1P47A 1IEJA 3BFUA 5A2QC 2DWIA 3TUSA 5H8HA 1MPBA 4IB2A 4EF1A 4IY5A 4G8MA 1S7YA 1RDXA 5I58A 2I9IA 1LFHA 4AS4A 3VVFA 2XWOA 4ESXA 2NUGA 2YTNA 1L4SA 1A54A 3PMXA 4DV4E 4ELOA 1PDAA 3K00A 3D1RA 1UILA 1I69A 2CMOA 4QF9A 3U8QA 1URDA 1XT8A 4N91A 4LFCE 3H3GA 3EQ1A 4F3PA 2RSIA 2LRSA 3W9VA 2EM7A 1NI9A 4MFIA 2Z8FA 1GV8A 2X7QA 1N3GA 3O28A 5EQ7A 2NVUB 4POWA 3H4ZA 2YTFA 1RC7A 3VV5A 4ECFA 4M4GA 3LUZA 3TMGA 2B7TA 1RYOA 2CT1A 5LMUE 2DWHA 4RK9A 4ESWA 2Q88A 5I59B 5HPQA 3RPWA 4F9AB 4LQ2A 2F8DA 1OMPA 5TPAB 1AH5A 1MG1A 4DI3D 2M4IA 5AASA 2YTPA 2BJIA 1EH8A 1B69A 2EOSA 2Q2AA 3PD8A 1FJ9A 1A1GA 2I3WA 4YB7A 2KONA 2I49A 1M5CA 2OK2A 4Q28A 2ZNSA 2EPCA 3Q28A 4NZVA 2FHYA 4FE8A 4XIGQ 2WBSA 4PE3A 2HQ0A 1NV2A 4X1DA 3K6WA 3GLBA 4PGNA 2WBBA 4RH8A 2QSXA 3O6IA 2EP3A 1LLSA 2L92A 3DLNA 3HN0A 1IBKE 1LB9A 4KHPE 4NWCA 1MEYC 4GX3A 4DZ1A 4C1TA 2EMXA 1LCTA 4WX9A 3O97A 2HPGA 4RA1A 2VQFE 1EH7A 4BHBA 2UXDE 2L3CA 4DXUA 1Z7NE 3CFLA 1YXIA 1ZIUA 5EHSA 5IKBA 2HFBA 3R26A 2D9HA 1NV0A 1BBGA 1Y3PA 3MJNA 1XNQE 5JK4A 1Z1BA 1I6AA 4HCYA 2DGCA 4BC7A 2ELYA 4P0GA 4ELQA 5A6JA 3D4CA 2X26A 1IMFA 5IV8B 3FV1A 1X5WA 1X48A 3SDFA 5A5XB 4GBWA 1FSAA 4LTYA 2ZYMA 3IB1A 2CPNA 1QVSA 1B7HA 1BP5A 2EPOA 5ICTA 1AAYA 3OO7A 3K6UA 5J1DA 1GVCA 5H8FA 2JP9A 2O7UA 3CIJA 2R9JA 3AXFA 4I62A 3PPPA 5EQ8A 4MBPA 3U94A 3F6HA 3T1YE 4JI6E 1A1HA 4QSDA 2ODRD 4P1LA 5B7DA 2DXYA 4G68B 1JK1A 4OYVA 1OLCA 4U22A 5ICQA 1HNWE 3A3CA 4I3YA 4GZNC 3VXBA 3IO4A 2DE3A 1LBBA 3RYDA 4R2RA 2UYFA 5DVIA 2EPNA 1P1NA 3SKPA 3EPLA 1IMEA 2F8BA 3VLVA 3O6GA 1ZLQA 4N4RB 2OCUA 1TF3A 4JI8E 1TXFA 4NMYA 4ZZAA 4DR3E 4G4PA 2Y5KA 2YWQA 4OEUA 1YYZA 4YB6A 4I8CA 5KL2A 2HCAA 2OWTA 5AC5A 1B5JA 2QMWA 2QS3A 4NN3A 1D9QA 2DQVA 1TFAA 2WBUA 1T4OA 3HFUA 2XHDA 5I7IA 2EN3A 1LBVA 4GBVA 3OELA 2NABA 3PPRA 4PC9A 4GWOA 1X6EA 3HO7A 1LBZA 2OWSA 2XX9A 4F54A 1EH6A 4MNPA 1ZKBA 4DR1E 1HSLA 1MXWA 4MF3A 4H5FA 5A5LA 2RKMA 4HXVA 2B4LA 1K9ZA 1G2FC 2RS7A 3VK6A 4OANA 1A7LA 3HHFA 1WXRA 5FHNA 4R2FA 4TUGA 4LF8E 2UVIA 3TZAA 4RY1A 3T9HB 5LMNE 4WSGA 4YU0A 2PFZA 1IBME 3BBRA 1SW5A 2UUAE 2HHMA 1ZU0A 4FEDA 2VF1A 4L5NC 3N6UA 1I6BA 1FPDA 3FD3A 2G29A 1A1JA 4P56A 3QYTA 4GWUA 3CFZA 5J16A 1FTLA 3T66A 4XFEA 5EHMA 3KBRA 3LV0A 4NG7A 4BMJA 1J1NA 4UA8A 3H6VA 4GWWA 3C36A 2VD2A 3O2AA 4QHQA 4R2CA 5FBPA 4GWYA 2EPRA 2M8CA 2DP8A 1JETA 3DP8A 2J7JA 4MHFA 1A55A 4OESA 4OXVA 4KFQA 4M9VC 2NXOA 4HEIA 3VFJA 1SI0A 2NOOA 4DMIA 1KZ8A 4LZ7A 4AQYE 1XHYA 1YYWA 2RSMA 1NFTA 3BKIB 3CR9A 4KHZE 4YKPA 3FASA 1OIBA 4JI4E 1KWHA 3ZKKA 4TQUQ 3IORA 1PB9A 5IZ3A 1TWYA 5LDZA 1CB6A 1FPBA 2HXRA 2ONRA 3VDFA 3S9MC 1VFDA 4PFUA 3RLFE 1SDXA 3G3IA 2HJJA 1OQGA 3VYXA 4NF4A 4J8ZA 1MM7A 1NV5A 1FKAE 4YKJA 2F7BA 2HZKA 4XKPA 4Z0IA 2A5TB 1T4LB 2HAUA 4R2AA 1JQFA 5LLQA 2R1FA 5AA3A 1EYIA 1JW4A 3RPLB 1QUJA 4YB5A 4NEDA 1D9YA 5I3SA 2XXIA 1JVXA 2EN7A 2V85A 1IZ1A 4NF6B 4TUIA 3E79A 1ZAAC 4KPTA 3DELB 1B4HA 4GWZA 3S9EA 3RGYA 2L33A 4JI7E 4RYAA 4F39A 3T9VA 1R9LA 3OTOE 5CBSA 3U1OA 4KXPA 3ADJA 2K7IA 2XX8A 4DR2E 2ZMBA 3FIRA 1B3FA 3UGWA 2RC7A 2I48A 1UTBA 2ESNA 3PPQA 2JY9A 4F2OA 1SYHA 2O68A 2L3JA 4WFTA 3IK6B 1T0KA 1K9YA 5ET5A 2EL6A 1FBEA 2VPOA 4NTLA 4H45A 4MH5A 4LFBE 3SERA 3VLWA 5I57A 4DE8A 2WKYA 2O6AA 4FATA 3T1HE 1NV7A 5I56A 2XXQA 4O7IA 3GBAA 2ZNUA 2Y84A 5LOMA 2PYYA 3S9NC 5L9OA 2ENHA 4BDMA 3LBSA 3VVDA 2EMYA 4H65A 3BGHA 3TQMA 2P2AA 2JJKA 2EOHA 3JAMC 4OVSA 3TTKA 3N94A 4GKJE 4WPYA 1JK2A 1TFDA 3ZKLA 1XC1A 2R8TA 1ZU1A 3AUZA 1M5EA 3EHTA 3C35A 2V25A 2F3DA 4F9BB 2RC9A 2EM2A 3MP6A 1WHQA 4G8HA 1UIVA 5ESYA 3U65A 2IHR1 1ATGA 2EMLA 2EM3A 4AQ4A 2X7PA 3TELA 1AL3A 2YLNA
chains in the Genus database with same CATH topology
4THIA 3OSQA 1MXXA 4BDRA 3TPAA 2R6GE 4RJZA 3C33A 1WDNA 4ELRA 4F3BA 1SQYA 3GBBA 4N6PA 2I3VA 5H8SA 4TLMB 2FA7A 4XKQA 4L17A 1QULA 4O3AA 2ZNTA 2HAVA 3C31A 4EQBA 3IJOB 4U2RA 3CVGA 3TCHA 5HM4B 1QKAA 4R74A 3V83A 4RK2A 4QRZA 3RUMA 3PMVA 3RT8A 2XXRA 2ABHA 4F31B 1FTOA 5H8QB 1MQIA 3TYHA 4H1XA 1OLAA 4EQ9A 4R6HA 4OFJA 1PC3A 1XVYA 1EU8A 2F5XA 4AB5A 3QXMA 1N0TA 1BKAA 2GFEA 1S9TA 3BFTA 4ZEFA 1LBCA 2P0SA 4YKKA 4BDQA 5A5XA 4ZEDA 3OMBA 2XX7A 4DXBA 3N26A 2H4IA 1XVXA 3K1NA 4NF5A 1HSEA 4F1VA 2UVJA 1I6QA 2NUVA 4F1UA 2ONSA 1II5A 4H8IA 1FQAA 4JWYA 2Y7WA 5FHMA 4G68A 1O64A 5KZTA 4F22A 2E1SA 4OWDA 3TTLA 4R2BA 4C0RA 3IJXB 1WVJA 4U4XA 2QS4A 1O63A 1MM6A 1H3DA 2V3TA 1N84A 3PV0E 1M5FA 3TEPA 4RPNA 1IXIA 3VVEA 3KJ7A 3RY3A 3SETA 4ONYA 2LAOA 1B3EA 5DYHA 5F7VA 3OO6A 4TOZA 2VGQA 4OTEA 1H45A 2Y7PA 1L5TA 2AYSA 1B58A 2ZYNA 4LA9A 1B0LA 1DTGA 4NF8B 1PB7A 3KGCA 1LFIA 4R75A 1B4ZA 4Q30B 1P1UA 3G3GA 1Z7ME 4GOTA 1XOCA 3K1MA 4R9GA 4H8JA 1N76A 2RF1A 4LQ5A 1NH7A 3UK4A 1MY1A 4IO3A 1R6ZA 4OZ9A 5BWJA 2ANJA 1LB8A 1Y9UA 3DP4A 2D3IA 4IGRA 2Q8JA 4YMAA 5H8NB 3IB0A 3MP8A 3SEWA 1ZTYA 2F97A 4QFKA 4G2ZA 4KI0E 4M1VA 2THIA 1N3WA 3CG3A 5CM6A 5DEXA 5AA1A 1SYIA 2Q89A 2RINA 3DM0A 4XXUA 1MDQA 2B65A 1BTJA 3HV1A 2PT1A 3H6UA 3H06B 2NWJA 3LUYA 1RKMA 4Z7EA 2CZLA 2RCBA 2HEUA 5AA2D 3H03A 3SEXA 3SEVA 3T22A 1IXCA 2Y7IA 5KDTA 3OO8A 1MY2A 1VSOA 3FXRA 1Y3NA 2O51A 5TP9A 1YCJA 1B7UA 5DTBA 1MY4A 1B3GA 4IGTA 4R6KA 3I6VA 2QJEA 2I58A 3MW0A 3MAMA 4NF6A 2I4BA 3IOVA 5H8HB 1MS7A 5I58B 4I1DA 3FJGA 3ZSFA 2UXAA 2B3FA 4DCYA 3ILTB 2REJA 3VE1B 1B2HA 1MXVA 4U23A 3FVOA 2QMXA 3TTMA 4DXCA 2V3UA 1NNFA 4MLVA 1B46A 3LSWA 1MDP1 3HPIA 1DTZA 2PMSA 3OEMA 1UIUA 4Q8RA 3S2VA 4RPOA 5JTYA 3TDJA 2AIXA 1QKBA 2H5YA 4OERA 4N07A 2I0CA 1F9BA 1Y4CA 1B05A 1P1OA 1UQWA 2DOJA 3MUQA 3Q26A 2IA4A 1WODA 3TCGA 2O69A 5AA4B 5KCJA 4JXIA 4F3SA 1R9QA 4XKNA 4LATA 1A8FA 2XXHA 5L8DA 1P1WA 4DIGA 4EXKA 3A3UA 3MPKA 4FECA 3JYRA 1NNTA 4HCWA 1VR5A 4PE5B 3S9LC 1MXUA 3TTRA 1SD3A 1MQJA 3L6HA 4I9DA 1OVTA 4GF8A 1MPCA 3QK6A 3TCFA 5ITPA 3GXAA 1EZOA 3V8XB 5CBRA 1LAXA 1PEBA 4H0WA 4ZZEA 2F35A 4BDOA 3KFMA 3KN3A 2QL3A 4ND9A 5I2NA 1D3KA 4PQJA 1YTVA 3PUZE 4F1YA 1UTHB 3OO9A 2I0BA 5H8FB 1S50A 2PBWA 2DSFA 3QUFA 4XTCQ 3FVGA 1R1NA 3W15C 1FCKA 2BJJX 2DS9A 4QSCA 5F1QA 4WKMA 3OD7A 1LAHE 1NKXA 2H99A 4OETA 1Y1ZA 4O3BA 2D5WA 5AA2A 3IX1A 1Y1MA 3SESA 1N7XA 5DVFA 2V93A 4LZ8A 3VLUA 3V5AA 2VOZA 2R71A 2I6EA 3PUYE 1PBQA 1POTA 1NNPA 3Q27A 3EN3A 4IO4A 3ODBA 5CMBA 2AL5A 4PFWA 4F19A 4F3GA 1MH3A 3IAZA 3MVYA 3T93B 2XXUA 4KCCA 5CMMA 1B5HA 1NH8A 1QUIA 2H25A 1O7TA 4ELPA 4KQPA 4G8NA 3PPOA 2OZZA 1P1QA 5ITOA 4R73A 3H6WA 2A5SA 1GGGA 3TFLA 3O9PA 4XKRA 4NWDA 3R6UA 3P7IA 3KN8A 4H6DA 4K3FA 5L9MA 3KN7A 2W7YA 3E4RA 5CMKA 4BDNA 4PFTA 4LZ5A 1MH4A 1H44A 5I2KB 5CMCA 5FHOA 5DT6A 4P11A 4LP2B 2V84A 3FXUA 4EQ7A 1N3XA 4OFOA 4U4SA 3SEUA 2B3BA 4JSOA 3TAJA 4GL0A 4F2QA 1NL5A 4KYEA 4WXJA 5I59A 3IL1B 4WEDA 1USYE 4KCDA 1TT1A 5TPAA 2ALUA 3O6HA 1JW5A 1M5BA 3RTFB 3SEYA 4JWOA 4RXLA 3OOAA 4X48A 2D21A 2F7AA 4EXLA 3IOWA 4BLAA 1USYH 3R7XA 4FIMA 1A40A 4OHNA 1MQHA 3MBPA 5K2YA 2KLFA 3M3KA 4GFRA 4EF2A 3OSRA 3FVNA 4ZEKA 1M5DA 2RCAA 2P1SA 3N5LA 1B9JA 1JNFA 3CSBA 1N7WA 3PPNA 1JEUA 2DVZA 1POY1 3FVKA 1PB8A 2DXRA 2REGA 1FQBA 1FTKA 3UP9A 4GXSB 4PP0A 1LAGE 1UTBB 4KYDA 3IOTA 2UVHA 3KZGA 4GLIA 2UVGA 1EZPA 3IB2A 4ZEIA 3HCQA 1FQCA 1BIYA 3UORA 3PUXE 5I57B 5B70A 3O66A 3Q29A 2DWAA 3UIFA 3K1PA 4YZZA 1MY0A 3IOUA 2OBGA 4ISUA 1Q1KA 4KYSA 4PFYA 1YPNA 3MC2A 4FORA 4RNSA 3K02A 3U92A 2Z8EA 1P99A 2GHBA 1RYXA 1A99A 4JB7A 2DVCA 4IO5A 2GRVA 3K6XA 4F18A 4H5GA 2DWJA 3K2DA 3FJ7A 5FTHA 4FJPA 3F11A 4YICA 3LR1A 3MZ9A 2FYIA 1H76A 1IITA 1B52A 4EDPA 4Q5TA 4ZEBA 2YJPA 3MVZA 4YMBA 2F6PA 3RN8A 4LUBA 3UN6A 5IAIA 2Z22A 4G68C 4TLLB 4JSDA 1QW0A 5BUUA 4IO2A 1FQFA 1MRPA 3RTWB 1GTKA 1MXYA 2VHAA 4UACA 3FUZA 3H7MA 3WAFA 4HTGA 1DPEA 3FJMA 4GD5A 5AA4A 5M2VA 1VFEA 3ZS6A 2VD3A 4YAHX 3PU5A 3K4UA 3H6TA 2I4CA 4ZS9A 1JEVA 3MZ1A 2O1LA 4LONB 4GVOA 1OVBA 2H98A 4MLQA 3MVXA 3FXQA 1VE4A 2GH9A 2OJTA 2F78A 3B7DA 3D4GA 1IXHA 1DMBA 3JV9A 3KSXA 2ZYKA 2PX1A 2A5TA 3M3FA 3G3KA 4ZDMA 1UTHA 1B3LA 1B51A 4NF5B 5ISUA 1B40A 1FTJA 3C4MA 3FGSA 3C32A 1B1HA 5K2XA 3I3VA 5TU0A 3N6TA 4OFLA 2DE2A 1GR2A 1FQDA 2ZXTA 3FATA 2Q9TA 1MQDA 3KSJA 1ANFA 3TTNA 2O1MA 3CG1A 3C34A 3M3LA 3PGFA 2OLBA 1AOVA 3TQLA 3FV2A 4ZE9A 2XD3A 3CFXA 1QUKA 2QPQA 3KJTA 4KR5A 2DYXA 2FNCA 3G3HA 1ZMGA 3L6GA 4BDLA 2H9BA 2XXTA 1DSNA 3E3KA 2HZLA 4R72A 4C1UA 2Z23A 1SVXB 3EPEA 2Y7RA 5HBCA 1ELJA 2XXXA 4R9FA 2XD2A 1OQHA 3MWBA 3S4UA 2XXPA 3KG2A 1LGBC 1N04A 3JZJA 2O84X 1MXZA 3B6WA 4ZE8A 3OXNA 4X1BA 5I2KA 2F34A 1B5IA 4GL8A 2ZYOA 4E0XA 1HSJA 3V89B 1MY3A 4P0IA 1SW4A 1URSA 1H43A 3LC8A 5DEXB 3RT6B 2XXVA 4QFPA 1B3HA 3B6QA 3UA8A 3U93A 3U72A 4N13A 4QFOA 2Z8DA 3W9WA 4OEVA 3MQ9A 1JW1A 1LFGA 4OVJA 3LSFB 3A09A 1EH3A 3CI8A 1AMFA 3TKDA 3HHGA 2RC8A 1BLFA 3KEIA 4JBZA 5DVJA 1D4NA 4DDDA 5KDTB 4KD5A 4HW8A 1IIWA 1D9VA 3VXCA 1XS5A 1FQEA 4POXA 5TP9B 1PBPA 3O29A 5CI5A 4DCXA 4U21A 2QS2A 2GHAA 1A8EA 1B1XA 4Q0CA 2E0SA 5H8QA 4JDFA 1YAEA 3TQWA 4JWXA 3K01A 4X9TA 4U1ZA 1US5A 1MQGA 3EF7A 4IO7A 3RNNA 3RQTA 4PETA 2XXYA 4O3CA 5L9SA 2VP1A 3G3JA 3T9XB 4GIZA 2XXWA 2Y7KA 3HSTA 3PMWA 4F29A 1SI1A 3QUJA 3DP6A 1IQ7A 3FZVA 4OMBA 1Y3QA 3K0VA 2QS1A 3MVWA 4FAJA 4IO6A 4H67A 3PD9A 1JVYA 3B6TA 3K6VA 3EHUA 2AL4A 4DLDA 1Q35A 1B0HA 3GZGA 3CSGA 1URGA 3I5OA 5JTYB 2DE4A 2IEEA 4R6YA 1FTMA 4OENA 2O7IA 5KCJB 3IR1A 3T9UA 1NMUA 2V3QA 2PVUA 3C9HA 3PUWE 2YPNA 5AE4A 3MPLA 2UYEA 1EZ9A 1LAFE 4GQOA 4QFLA 4QSEA 3LSLA 3MP1A 1QJMA 3KOSA 4NF8A 5CRYA 1B6HA 3QAXA 3OENA 4HS7A 5ELVA 5I84A 2F7CA 1US4A 3KOTA 1IUDA 1B7ZA 2F36A 4GXAA 3MZBA 3ONMA 4U1OA 3WAEA 1Y20A 5I2NB 4NF4B 3USDA 3ILUB 3E13X 4E0WA 1Y4TA 3G7WA 1DPPA 1ZJLA 4G77A 2HXWA 3TODA 3T96B 3QIMA 5H8NA 4YKIA 3IO6A 1CE2A 4QFNA 3G3FA 2QRYA 1LSTA 1ZBMA 4ZECA 2F6GA 4NE4A 1AIVA 3EHSA 2G93A 1MPDA 5AA2B 1LCFA 1DOTA 3ECRA 5EYFA 2Q2CA 3E9XA 3THIA 4AB6A 1SBPA 4EUOA 3Q25A 1SW2A 4WEPA 3QSLA 4OQOA 4IY6A 5JEIA 3OEKA 1B32A 4GRKA 5I56B 1FW0A 3M8UA 4LVQA 3CRBA 4FEBA 3PUVE 3LSXA 2PT2A 5FTIA 5CC2A 1NNKA 1IXGA 1SW1A 2ONKE 1IEJA 3BFUA 2DWIA 3TUSA 5H8HA 1MPBA 4IB2A 4EF1A 4IY5A 4G8MA 1S7YA 5I58A 1LFHA 3VVFA 4ESXA 1A54A 3PMXA 4ELOA 1PDAA 3K00A 1I69A 2CMOA 4QF9A 3U8QA 1URDA 1XT8A 3H3GA 3EQ1A 4F3PA 3W9VA 4MFIA 2Z8FA 1GV8A 2X7QA 3O28A 2NVUB 4POWA 3H4ZA 4ECFA 3VV5A 4M4GA 3TMGA 1RYOA 2DWHA 4RK9A 4ESWA 2Q88A 5I59B 5HPQA 3RPWA 4LQ2A 2F8DA 1OMPA 5TPAB 1AH5A 1MG1A 2Q2AA 3PD8A 2I3WA 4YB7A 2I49A 1M5CA 2OK2A 2ZNSA 3Q28A 4FE8A 4XIGQ 2HQ0A 4X1DA 3K6WA 3GLBA 2QSXA 3O6IA 1LLSA 3DLNA 3HN0A 1LB9A 4NWCA 4DZ1A 4C1TA 1LCTA 3O97A 4RA1A 4DXUA 1Z7NE 3CFLA 1ZIUA 5EHSA 5IKBA 2HFBA 3R26A 1Y3PA 3MJNA 5JK4A 1I6AA 4HCYA 4P0GA 4ELQA 3D4CA 2X26A 3FV1A 3SDFA 5A5XB 2ZYMA 3IB1A 1QVSA 1B7HA 1BP5A 5ICTA 3OO7A 3K6UA 5J1DA 1GVCA 5H8FA 2O7UA 3CIJA 2R9JA 3AXFA 4I62A 3PPPA 4MBPA 3U94A 4QSDA 5B7DA 2DXYA 4G68B 4OYVA 1OLCA 4U22A 5ICQA 3A3CA 3VXBA 3IO4A 2DE3A 1LBBA 2UYFA 5DVIA 1P1NA 3SKPA 3VLVA 3O6GA 1ZLQA 2OCUA 1TXFA 4NMYA 4ZZAA 4G4PA 4OEUA 4YB6A 4I8CA 2HCAA 2OWTA 1B5JA 2QMWA 2QS3A 2DQVA 1TFAA 2XHDA 3OELA 3PPRA 4GWOA 3HO7A 2OWSA 2XX9A 1ZKBA 1HSLA 1MXWA 4MF3A 4H5FA 2RKMA 1A7LA 3HHFA 5FHNA 4R2FA 2UVIA 3TZAA 4RY1A 3T9HB 4YU0A 3BBRA 1SW5A 1ZU0A 4FEDA 3N6UA 1I6BA 3FD3A 2G29A 3QYTA 3CFZA 1FTLA 3T66A 5EHMA 3KBRA 1J1NA 4UA8A 3H6VA 3C36A 2VD2A 3O2AA 4QHQA 2M8CA 2DP8A 1JETA 3DP8A 1A55A 4OESA 4OXVA 4KFQA 2NXOA 3VFJA 1SI0A 2NOOA 4LZ7A 1XHYA 1NFTA 3BKIB 3CR9A 4KHZE 4YKPA 3FASA 1OIBA 1KWHA 3ZKKA 4TQUQ 3IORA 1PB9A 1TWYA 1CB6A 2ONRA 3VDFA 3S9MC 1VFDA 4PFUA 3RLFE 1SDXA 3G3IA 1OQGA 4NF4A 1MM7A 4YKJA 2F7BA 2HZKA 4XKPA 4Z0IA 2A5TB 2HAUA 1JQFA 5AA3A 1JW4A 1QUJA 4YB5A 4NEDA 1D9YA 2XXIA 1JVXA 1IZ1A 4NF6B 4KPTA 3DELB 1B4HA 3S9EA 3RGYA 4RYAA 4F39A 3T9VA 1R9LA 5CBSA 3U1OA 2XX8A 2ZMBA 3FIRA 1B3FA 3UGWA 2RC7A 2I48A 1UTBA 2ESNA 3PPQA 4F2OA 1SYHA 2O68A 3IK6B 1T0KA 4NTLA 4MH5A 3SERA 3VLWA 5I57A 4DE8A 2WKYA 2O6AA 4FATA 5I56A 2XXQA 3GBAA 2ZNUA 2Y84A 5LOMA 2PYYA 3S9NC 5L9OA 4BDMA 3LBSA 3VVDA 4H65A 2P2AA 3TTKA 3N94A 1TFDA 3ZKLA 1XC1A 1M5EA 3EHTA 3C35A 2V25A 2RC9A 3MP6A 4G8HA 1UIVA 1ATGA 4AQ4A 2X7PA 3TELA 1AL3A 2YLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4THI A;  3OSQ A;  1MXX A;  4BDR A;  3TPA A;  2R6G E;  4RJZ A;  3C33 A;  1WDN A;  4ELR A;  4F3B A;  1SQY A;  3GBB A;  4N6P A;  2I3V A;  5H8S A;  4TLM B;  2FA7 A;  4XKQ A;  4L17 A;  1QUL A;  4O3A A;  2ZNT A;  2HAV A;  3C31 A;  4EQB A;  3IJO B;  4U2R A;  3CVG A;  3TCH A;  5HM4 B;  1QKA A;  4R74 A;  3V83 A;  4RK2 A;  4QRZ A;  3RUM A;  3PMV A;  3RT8 A;  2XXR A;  2ABH A;  4F31 B;  1FTO A;  5H8Q B;  1MQI A;  3TYH A;  4H1X A;  1OLA A;  4EQ9 A;  4R6H A;  4OFJ A;  1PC3 A;  1XVY A;  1EU8 A;  2F5X A;  4AB5 A;  3QXM A;  1N0T A;  1BKA A;  2GFE A;  1S9T A;  3BFT A;  4ZEF A;  1LBC A;  2P0S A;  4YKK A;  4BDQ A;  5A5X A;  4ZED A;  3OMB A;  2XX7 A;  4DXB A;  3N26 A;  2H4I A;  1XVX A;  3K1N A;  4NF5 A;  1HSE A;  4F1V A;  2UVJ A;  1I6Q A;  2NUV A;  4F1U A;  2ONS A;  1II5 A;  4H8I A;  1FQA A;  4JWY A;  2Y7W A;  5FHM A;  4G68 A;  1O64 A;  5KZT A;  4F22 A;  2E1S A;  4OWD A;  3TTL A;  4R2B A;  4C0R A;  3IJX B;  1WVJ A;  4U4X A;  2QS4 A;  1O63 A;  1MM6 A;  1H3D A;  2V3T A;  1N84 A;  3PV0 E;  1M5F A;  3TEP A;  4RPN A;  1IXI A;  3VVE A;  3KJ7 A;  3RY3 A;  3SET A;  4ONY A;  2LAO A;  1B3E A;  5DYH A;  5F7V A;  3OO6 A;  4TOZ A;  2VGQ A;  4OTE A;  1H45 A;  2Y7P A;  1L5T A;  2AYS A;  1B58 A;  2ZYN A;  4LA9 A;  1B0L A;  1DTG A;  4NF8 B;  1PB7 A;  3KGC A;  1LFI A;  4R75 A;  1B4Z A;  4Q30 B;  1P1U A;  3G3G A;  1Z7M E;  4GOT A;  1XOC A;  3K1M A;  4R9G A;  4H8J A;  1N76 A;  2RF1 A;  4LQ5 A;  1NH7 A;  3UK4 A;  1MY1 A;  4IO3 A;  1R6Z A;  4OZ9 A;  5BWJ A;  2ANJ A;  1LB8 A;  1Y9U A;  3DP4 A;  2D3I A;  4IGR A;  2Q8J A;  4YMA A;  5H8N B;  3IB0 A;  3MP8 A;  3SEW A;  1ZTY A;  2F97 A;  4QFK A;  4G2Z A;  4KI0 E;  4M1V A;  2THI A;  1N3W A;  3CG3 A;  5CM6 A;  5DEX A;  5AA1 A;  1SYI A;  2Q89 A;  2RIN A;  3DM0 A;  4XXU A;  1MDQ A;  2B65 A;  1BTJ A;  3HV1 A;  2PT1 A;  3H6U A;  3H06 B;  2NWJ A;  3LUY A;  1RKM A;  4Z7E A;  2CZL A;  2RCB A;  2HEU A;  5AA2 D;  3H03 A;  3SEX A;  3SEV A;  3T22 A;  1IXC A;  2Y7I A;  5KDT A;  3OO8 A;  1MY2 A;  1VSO A;  3FXR A;  1Y3N A;  2O51 A;  5TP9 A;  1YCJ A;  1B7U A;  5DTB A;  1MY4 A;  1B3G A;  4IGT A;  4R6K A;  3I6V A;  2QJE A;  2I58 A;  3MW0 A;  3MAM A;  4NF6 A;  2I4B A;  3IOV A;  5H8H B;  1MS7 A;  5I58 B;  4I1D A;  3FJG A;  3ZSF A;  2UXA A;  2B3F A;  4DCY A;  3ILT B;  2REJ A;  3VE1 B;  1B2H A;  1MXV A;  4U23 A;  3FVO A;  2QMX A;  3TTM A;  4DXC A;  2V3U A;  1NNF A;  4MLV A;  1B46 A;  3LSW A;  1MDP 1;  3HPI A;  1DTZ A;  2PMS A;  3OEM A;  1UIU A;  4Q8R A;  3S2V A;  4RPO A;  5JTY A;  3TDJ A;  2AIX A;  1QKB A;  2H5Y A;  4OER A;  4N07 A;  2I0C A;  1F9B A;  1Y4C A;  1B05 A;  1P1O A;  1UQW A;  2DOJ A;  3MUQ A;  3Q26 A;  2IA4 A;  1WOD A;  3TCG A;  2O69 A;  5AA4 B;  5KCJ A;  4JXI A;  4F3S A;  1R9Q A;  4XKN A;  4LAT A;  1A8F A;  2XXH A;  5L8D A;  1P1W A;  4DIG A;  4EXK A;  3A3U A;  3MPK A;  4FEC A;  3JYR A;  1NNT A;  4HCW A;  1VR5 A;  4PE5 B;  3S9L C;  1MXU A;  3TTR A;  1SD3 A;  1MQJ A;  3L6H A;  4I9D A;  1OVT A;  4GF8 A;  1MPC A;  3QK6 A;  3TCF A;  5ITP A;  3GXA A;  1EZO A;  3V8X B;  5CBR A;  1LAX A;  1PEB A;  4H0W A;  4ZZE A;  2F35 A;  4BDO A;  3KFM A;  3KN3 A;  2QL3 A;  4ND9 A;  5I2N A;  1D3K A;  4PQJ A;  1YTV A;  3PUZ E;  4F1Y A;  1UTH B;  3OO9 A;  2I0B A;  5H8F B;  1S50 A;  2PBW A;  2DSF A;  3QUF A;  4XTC Q;  3FVG A;  1R1N A;  3W15 C;  1FCK A;  2BJJ X;  2DS9 A;  4QSC A;  5F1Q A;  4WKM A;  3OD7 A;  1LAH E;  1NKX A;  2H99 A;  4OET A;  1Y1Z A;  4O3B A;  2D5W A;  5AA2 A;  3IX1 A;  1Y1M A;  3SES A;  1N7X A;  5DVF A;  2V93 A;  4LZ8 A;  3VLU A;  3V5A A;  2VOZ A;  2R71 A;  2I6E A;  3PUY E;  1PBQ A;  1POT A;  1NNP A;  3Q27 A;  3EN3 A;  4IO4 A;  3ODB A;  5CMB A;  2AL5 A;  4PFW A;  4F19 A;  4F3G A;  1MH3 A;  3IAZ A;  3MVY A;  3T93 B;  2XXU A;  4KCC A;  5CMM A;  1B5H A;  1NH8 A;  1QUI A;  2H25 A;  1O7T A;  4ELP A;  4KQP A;  4G8N A;  3PPO A;  2OZZ A;  1P1Q A;  5ITO A;  4R73 A;  3H6W A;  2A5S A;  1GGG A;  3TFL A;  3O9P A;  4XKR A;  4NWD A;  3R6U A;  3P7I A;  3KN8 A;  4H6D A;  4K3F A;  5L9M A;  3KN7 A;  2W7Y A;  3E4R A;  5CMK A;  4BDN A;  4PFT A;  4LZ5 A;  1MH4 A;  1H44 A;  5I2K B;  5CMC A;  5FHO A;  5DT6 A;  4P11 A;  4LP2 B;  2V84 A;  3FXU A;  4EQ7 A;  1N3X A;  4OFO A;  4U4S A;  3SEU A;  2B3B A;  4JSO A;  3TAJ A;  4GL0 A;  4F2Q A;  1NL5 A;  4KYE A;  4WXJ A;  5I59 A;  3IL1 B;  4WED A;  1USY E;  4KCD A;  1TT1 A;  5TPA A;  2ALU A;  3O6H A;  1JW5 A;  1M5B A;  3RTF B;  3SEY A;  4JWO A;  4RXL A;  3OOA A;  4X48 A;  2D21 A;  2F7A A;  4EXL A;  3IOW A;  4BLA A;  1USY H;  3R7X A;  4FIM A;  1A40 A;  4OHN A;  1MQH A;  3MBP A;  5K2Y A;  2KLF A;  3M3K A;  4GFR A;  4EF2 A;  3OSR A;  3FVN A;  4ZEK A;  1M5D A;  2RCA A;  2P1S A;  3N5L A;  1B9J A;  1JNF A;  3CSB A;  1N7W A;  3PPN A;  1JEU A;  2DVZ A;  1POY 1;  3FVK A;  1PB8 A;  2DXR A;  2REG A;  1FQB A;  1FTK A;  3UP9 A;  4GXS B;  4PP0 A;  1LAG E;  1UTB B;  4KYD A;  3IOT A;  2UVH A;  3KZG A;  4GLI A;  2UVG A;  1EZP A;  3IB2 A;  4ZEI A;  3HCQ A;  1FQC A;  1BIY A;  3UOR A;  3PUX E;  5I57 B;  5B70 A;  3O66 A;  3Q29 A;  2DWA A;  3UIF A;  3K1P A;  4YZZ A;  1MY0 A;  3IOU A;  2OBG A;  4ISU A;  1Q1K A;  4KYS A;  4PFY A;  1YPN A;  3MC2 A;  4FOR A;  4RNS A;  3K02 A;  3U92 A;  2Z8E A;  1P99 A;  2GHB A;  1RYX A;  1A99 A;  4JB7 A;  2DVC A;  4IO5 A;  2GRV A;  3K6X A;  4F18 A;  4H5G A;  2DWJ A;  3K2D A;  3FJ7 A;  5FTH A;  4FJP A;  3F11 A;  4YIC A;  3LR1 A;  3MZ9 A;  2FYI A;  1H76 A;  1IIT A;  1B52 A;  4EDP A;  4Q5T A;  4ZEB A;  2YJP A;  3MVZ A;  4YMB A;  2F6P A;  3RN8 A;  4LUB A;  3UN6 A;  5IAI A;  2Z22 A;  4G68 C;  4TLL B;  4JSD A;  1QW0 A;  5BUU A;  4IO2 A;  1FQF A;  1MRP A;  3RTW B;  1GTK A;  1MXY A;  2VHA A;  4UAC A;  3FUZ A;  3H7M A;  3WAF A;  4HTG A;  1DPE A;  3FJM A;  4GD5 A;  5AA4 A;  5M2V A;  1VFE A;  3ZS6 A;  2VD3 A;  4YAH X;  3PU5 A;  3K4U A;  3H6T A;  2I4C A;  4ZS9 A;  1JEV A;  3MZ1 A;  2O1L A;  4LON B;  4GVO A;  1OVB A;  2H98 A;  4MLQ A;  3MVX A;  3FXQ A;  1VE4 A;  2GH9 A;  2OJT A;  2F78 A;  3B7D A;  3D4G A;  1IXH A;  1DMB A;  3JV9 A;  3KSX A;  2ZYK A;  2PX1 A;  2A5T A;  3M3F A;  3G3K A;  4ZDM A;  1UTH A;  1B3L A;  1B51 A;  4NF5 B;  5ISU A;  1B40 A;  1FTJ A;  3C4M A;  3FGS A;  3C32 A;  1B1H A;  5K2X A;  3I3V A;  5TU0 A;  3N6T A;  4OFL A;  2DE2 A;  1GR2 A;  1FQD A;  2ZXT A;  3FAT A;  2Q9T A;  1MQD A;  3KSJ A;  1ANF A;  3TTN A;  2O1M A;  3CG1 A;  3C34 A;  3M3L A;  3PGF A;  2OLB A;  1AOV A;  3TQL A;  3FV2 A;  4ZE9 A;  2XD3 A;  3CFX A;  1QUK A;  2QPQ A;  3KJT A;  4KR5 A;  2DYX A;  2FNC A;  3G3H A;  1ZMG A;  3L6G A;  4BDL A;  2H9B A;  2XXT A;  1DSN A;  3E3K A;  2HZL A;  4R72 A;  4C1U A;  2Z23 A;  1SVX B;  3EPE A;  2Y7R A;  5HBC A;  1ELJ A;  2XXX A;  4R9F A;  2XD2 A;  1OQH A;  3MWB A;  3S4U A;  2XXP A;  3KG2 A;  1LGB C;  1N04 A;  3JZJ A;  2O84 X;  1MXZ A;  3B6W A;  4ZE8 A;  3OXN A;  4X1B A;  5I2K A;  2F34 A;  1B5I A;  4GL8 A;  2ZYO A;  4E0X A;  1HSJ A;  3V89 B;  1MY3 A;  4P0I A;  1SW4 A;  1URS A;  1H43 A;  3LC8 A;  5DEX B;  3RT6 B;  2XXV A;  4QFP A;  1B3H A;  3B6Q A;  3UA8 A;  3U93 A;  3U72 A;  4N13 A;  4QFO A;  2Z8D A;  3W9W A;  4OEV A;  3MQ9 A;  1JW1 A;  1LFG A;  4OVJ A;  3LSF B;  3A09 A;  1EH3 A;  3CI8 A;  1AMF A;  3TKD A;  3HHG A;  2RC8 A;  1BLF A;  3KEI A;  4JBZ A;  5DVJ A;  1D4N A;  4DDD A;  5KDT B;  4KD5 A;  4HW8 A;  1IIW A;  1D9V A;  3VXC A;  1XS5 A;  1FQE A;  4POX A;  5TP9 B;  1PBP A;  3O29 A;  5CI5 A;  4DCX A;  4U21 A;  2QS2 A;  2GHA A;  1A8E A;  1B1X A;  4Q0C A;  2E0S A;  5H8Q A;  4JDF A;  1YAE A;  3TQW A;  4JWX A;  3K01 A;  4X9T A;  4U1Z A;  1US5 A;  1MQG A;  3EF7 A;  4IO7 A;  3RNN A;  3RQT A;  4PET A;  2XXY A;  4O3C A;  5L9S A;  2VP1 A;  3G3J A;  3T9X B;  4GIZ A;  2XXW A;  2Y7K A;  3HST A;  3PMW A;  4F29 A;  1SI1 A;  3QUJ A;  3DP6 A;  1IQ7 A;  3FZV A;  4OMB A;  1Y3Q A;  3K0V A;  2QS1 A;  3MVW A;  4FAJ A;  4IO6 A;  4H67 A;  3PD9 A;  1JVY A;  3B6T A;  3K6V A;  3EHU A;  2AL4 A;  4DLD A;  1Q35 A;  1B0H A;  3GZG A;  3CSG A;  1URG A;  3I5O A;  5JTY B;  2DE4 A;  2IEE A;  4R6Y A;  1FTM A;  4OEN A;  2O7I A;  5KCJ B;  3IR1 A;  3T9U A;  1NMU A;  2V3Q A;  2PVU A;  3C9H A;  3PUW E;  2YPN A;  5AE4 A;  3MPL A;  2UYE A;  1EZ9 A;  1LAF E;  4GQO A;  4QFL A;  4QSE A;  3LSL A;  3MP1 A;  1QJM A;  3KOS A;  4NF8 A;  5CRY A;  1B6H A;  3QAX A;  3OEN A;  4HS7 A;  5ELV A;  5I84 A;  2F7C A;  1US4 A;  3KOT A;  1IUD A;  1B7Z A;  2F36 A;  4GXA A;  3MZB A;  3ONM A;  4U1O A;  3WAE A;  1Y20 A;  5I2N B;  4NF4 B;  3USD A;  3ILU B;  3E13 X;  4E0W A;  1Y4T A;  3G7W A;  1DPP A;  1ZJL A;  4G77 A;  2HXW A;  3TOD A;  3T96 B;  3QIM A;  5H8N A;  4YKI A;  3IO6 A;  1CE2 A;  4QFN A;  3G3F A;  2QRY A;  1LST A;  1ZBM A;  4ZEC A;  2F6G A;  4NE4 A;  1AIV A;  3EHS A;  2G93 A;  1MPD A;  5AA2 B;  1LCF A;  1DOT A;  3ECR A;  5EYF A;  2Q2C A;  3E9X A;  3THI A;  4AB6 A;  1SBP A;  4EUO A;  3Q25 A;  1SW2 A;  4WEP A;  3QSL A;  4OQO A;  4IY6 A;  5JEI A;  3OEK A;  1B32 A;  4GRK A;  5I56 B;  1FW0 A;  3M8U A;  4LVQ A;  3CRB A;  4FEB A;  3PUV E;  3LSX A;  2PT2 A;  5FTI A;  5CC2 A;  1NNK A;  1IXG A;  1SW1 A;  2ONK E;  1IEJ A;  3BFU A;  2DWI A;  3TUS A;  5H8H A;  1MPB A;  4IB2 A;  4EF1 A;  4IY5 A;  4G8M A;  1S7Y A;  5I58 A;  1LFH A;  3VVF A;  4ESX A;  1A54 A;  3PMX A;  4ELO A;  1PDA A;  3K00 A;  1I69 A;  2CMO A;  4QF9 A;  3U8Q A;  1URD A;  1XT8 A;  3H3G A;  3EQ1 A;  4F3P A;  3W9V A;  4MFI A;  2Z8F A;  1GV8 A;  2X7Q A;  3O28 A;  2NVU B;  4POW A;  3H4Z A;  4ECF A;  3VV5 A;  4M4G A;  3TMG A;  1RYO A;  2DWH A;  4RK9 A;  4ESW A;  2Q88 A;  5I59 B;  5HPQ A;  3RPW A;  4LQ2 A;  2F8D A;  1OMP A;  5TPA B;  1AH5 A;  1MG1 A;  2Q2A A;  3PD8 A;  2I3W A;  4YB7 A;  2I49 A;  1M5C A;  2OK2 A;  2ZNS A;  3Q28 A;  4FE8 A;  4XIG Q;  2HQ0 A;  4X1D A;  3K6W A;  3GLB A;  2QSX A;  3O6I A;  1LLS A;  3DLN A;  3HN0 A;  1LB9 A;  4NWC A;  4DZ1 A;  4C1T A;  1LCT A;  3O97 A;  4RA1 A;  4DXU A;  1Z7N E;  3CFL A;  1ZIU A;  5EHS A;  5IKB A;  2HFB A;  3R26 A;  1Y3P A;  3MJN A;  5JK4 A;  1I6A A;  4HCY A;  4P0G A;  4ELQ A;  3D4C A;  2X26 A;  3FV1 A;  3SDF A;  5A5X B;  2ZYM A;  3IB1 A;  1QVS A;  1B7H A;  1BP5 A;  5ICT A;  3OO7 A;  3K6U A;  5J1D A;  1GVC A;  5H8F A;  2O7U A;  3CIJ A;  2R9J A;  3AXF A;  4I62 A;  3PPP A;  4MBP A;  3U94 A;  4QSD A;  5B7D A;  2DXY A;  4G68 B;  4OYV A;  1OLC A;  4U22 A;  5ICQ A;  3A3C A;  3VXB A;  3IO4 A;  2DE3 A;  1LBB A;  2UYF A;  5DVI A;  1P1N A;  3SKP A;  3VLV A;  3O6G A;  1ZLQ A;  2OCU A;  1TXF A;  4NMY A;  4ZZA A;  4G4P A;  4OEU A;  4YB6 A;  4I8C A;  2HCA A;  2OWT A;  1B5J A;  2QMW A;  2QS3 A;  2DQV A;  1TFA A;  2XHD A;  3OEL A;  3PPR A;  4GWO A;  3HO7 A;  2OWS A;  2XX9 A;  1ZKB A;  1HSL A;  1MXW A;  4MF3 A;  4H5F A;  2RKM A;  1A7L A;  3HHF A;  5FHN A;  4R2F A;  2UVI A;  3TZA A;  4RY1 A;  3T9H B;  4YU0 A;  3BBR A;  1SW5 A;  1ZU0 A;  4FED A;  3N6U A;  1I6B A;  3FD3 A;  2G29 A;  3QYT A;  3CFZ A;  1FTL A;  3T66 A;  5EHM A;  3KBR A;  1J1N A;  4UA8 A;  3H6V A;  3C36 A;  2VD2 A;  3O2A A;  4QHQ A;  2M8C A;  2DP8 A;  1JET A;  3DP8 A;  1A55 A;  4OES A;  4OXV A;  4KFQ A;  2NXO A;  3VFJ A;  1SI0 A;  2NOO A;  4LZ7 A;  1XHY A;  1NFT A;  3BKI B;  3CR9 A;  4KHZ E;  4YKP A;  3FAS A;  1OIB A;  1KWH A;  3ZKK A;  4TQU Q;  3IOR A;  1PB9 A;  1TWY A;  1CB6 A;  2ONR A;  3VDF A;  3S9M C;  1VFD A;  4PFU A;  3RLF E;  1SDX A;  3G3I A;  1OQG A;  4NF4 A;  1MM7 A;  4YKJ A;  2F7B A;  2HZK A;  4XKP A;  4Z0I A;  2A5T B;  2HAU A;  1JQF A;  5AA3 A;  1JW4 A;  1QUJ A;  4YB5 A;  4NED A;  1D9Y A;  2XXI A;  1JVX A;  1IZ1 A;  4NF6 B;  4KPT A;  3DEL B;  1B4H A;  3S9E A;  3RGY A;  4RYA A;  4F39 A;  3T9V A;  1R9L A;  5CBS A;  3U1O A;  2XX8 A;  2ZMB A;  3FIR A;  1B3F A;  3UGW A;  2RC7 A;  2I48 A;  1UTB A;  2ESN A;  3PPQ A;  4F2O A;  1SYH A;  2O68 A;  3IK6 B;  1T0K A;  4NTL A;  4MH5 A;  3SER A;  3VLW A;  5I57 A;  4DE8 A;  2WKY A;  2O6A A;  4FAT A;  5I56 A;  2XXQ A;  3GBA A;  2ZNU A;  2Y84 A;  5LOM A;  2PYY A;  3S9N C;  5L9O A;  4BDM A;  3LBS A;  3VVD A;  4H65 A;  2P2A A;  3TTK A;  3N94 A;  1TFD A;  3ZKL A;  1XC1 A;  1M5E A;  3EHT A;  3C35 A;  2V25 A;  2RC9 A;  3MP6 A;  4G8H A;  1UIV A;  1ATG A;  4AQ4 A;  2X7P A;  3TEL A;  1AL3 A;  2YLN A; 
#chains in the Genus database with same CATH topology
 1SPI A;  4THI A;  3OSQ A;  1KYQ A;  1MXX A;  4PTK A;  4BDR A;  5AE2 A;  3TPA A;  1PKP A;  2WBD A;  2R6G E;  4RJZ A;  3KC0 A;  3C33 A;  2EPA A;  4LF5 E;  3C6K A;  1WDN A;  4MNC A;  4ELR A;  3OML A;  4F3B A;  2EL5 A;  1SQY A;  3GBB A;  1IQS A;  4N6P A;  2I3V A;  4N8Y A;  5H8S A;  4TLM B;  4QXD A;  2FA7 A;  1G0I A;  2RQL A;  4PF8 A;  4XKQ A;  4L17 A;  1UHZ A;  1QUL A;  4O3A A;  2ZNT A;  2HAV A;  3C31 A;  4M2Z A;  4EQB A;  3L00 A;  3IJO B;  4U2R A;  3CVG A;  3TCH A;  5HM4 B;  5A69 A;  1QKA A;  4R74 A;  1ZR9 A;  3V83 A;  1FPG A;  4RK2 A;  4QRZ A;  2CZK A;  3RUM A;  2EN2 A;  1NV4 A;  3PMV A;  1SR9 A;  5EYG A;  3RT8 A;  2YRM A;  2XXR A;  4WXC A;  2ABH A;  2DMI A;  4BCA A;  1FTO A;  4F31 B;  1YYO A;  5H8Q B;  4P78 A;  1MQI A;  2LTS A;  3TYH A;  4H1X A;  2EMB A;  2M7Q A;  1OLA A;  1EYJ A;  4EQ9 A;  4R6H A;  4OFJ A;  2EM8 A;  1PC3 A;  1XVY A;  1EU8 A;  2F5X A;  2UU9 E;  2JYA A;  2XWI A;  1DBZ A;  4AB5 A;  3QXM A;  1N0T A;  1BKA A;  2GFE A;  1S9T A;  4R2D A;  3BFT A;  2EN6 A;  2LTR A;  2FV4 B;  4ZEF A;  3HTX A;  1LBC A;  2P0S A;  4GX4 A;  4YKK A;  4NHR A;  1I94 E;  4BDQ A;  4NAP A;  2L6M A;  1FRP A;  5A5X A;  4ZED A;  3OMB A;  3VYY A;  2YZT A;  2XX7 A;  4DXB A;  4DR7 E;  3N26 A;  2H4I A;  2EM6 A;  4MNI A;  4XF5 A;  3IWC A;  5IGA A;  1DCU A;  1FPJ A;  1XVX A;  4JYA E;  3K1N A;  4DV1 E;  4X9J A;  2MDG A;  1KJK A;  1HSE A;  4NF5 A;  4F1V A;  4JI5 E;  4N17 A;  2UVJ A;  1I6Q A;  2NUV A;  2FIX A;  4F1U A;  1TF6 A;  2ONS A;  1II5 A;  1F2I G;  4H8I A;  1FQA A;  4JWY A;  1XI6 A;  2Y7W A;  5FHM A;  4GWX A;  4G68 A;  1O64 A;  1IMC A;  2PRT A;  4N8G A;  5KZT A;  4F22 A;  2E1S A;  4OWD A;  3TTL A;  1G0H A;  4R2B A;  4C0R A;  3IJX B;  1WVJ A;  4U4X A;  2LJU A;  2QS4 A;  1O63 A;  3B50 A;  1FBP A;  1FJG E;  1MM6 A;  5KL5 A;  1H3D A;  2V3T A;  1N84 A;  5T3J A;  3PV0 E;  2LUQ A;  1XNR E;  1M5F A;  3TEP A;  2EOO A;  4RPN A;  4WSP A;  1IXI A;  2VRD A;  2A25 A;  3VVE A;  3KJ7 A;  1N34 E;  2DDK A;  3RY3 A;  3SET A;  1UN6 B;  4ONY A;  2LAO A;  1B3E A;  1FPE A;  3KZZ A;  5DYH A;  5F7V A;  1FPF A;  3OO6 A;  4TOZ A;  4N6K A;  2VGQ A;  4OTE A;  1H45 A;  2EPK X;  2Y7P A;  1L5T A;  2AYS A;  3MST A;  1B58 A;  5EQ9 A;  2ZYN A;  4LA9 A;  2V87 A;  1B0L A;  1DTG A;  4NF8 B;  2B4M A;  2XXK A;  4WYQ B;  2EM5 A;  2EPL X;  1PB7 A;  3KGC A;  1LFI A;  4R75 A;  4DR4 E;  4PBH A;  1B4Z A;  4Q30 B;  2JXP A;  1P1U A;  3G3G A;  1Z7M E;  4GOT A;  2NUE A;  1XOC A;  3K1M A;  4R9G A;  4H8J A;  1N76 A;  2RF1 A;  4LQ5 A;  4F9C B;  1NH7 A;  3UK4 A;  4X62 E;  1MY1 A;  4IO3 A;  3IFC A;  2YTD A;  1R6Z A;  4OZ9 A;  4O24 A;  5BWJ A;  2ANJ A;  1LB8 A;  2DSY A;  1Y9U A;  3DP4 A;  4X04 A;  2D3I A;  4IGR A;  2Q8J A;  4YMA A;  2UXB E;  4PAF A;  3SZP A;  5H8N B;  4PCD A;  2EPM X;  3IB0 A;  3MP8 A;  1HNZ E;  2ZZV A;  3BID A;  3SEW A;  1ZTY A;  2F97 A;  4QFK A;  4G2Z A;  4KI0 E;  4M1V A;  2THI A;  1N3W A;  2K4V A;  3CG3 A;  5CM6 A;  2JVA A;  5DEX A;  5AA1 A;  1SYI A;  2Q89 A;  2RIN A;  5IWA E;  3DM0 A;  4XXU A;  4HE2 A;  3VHT B;  1MDQ A;  2B65 A;  1BTJ A;  4P7D A;  3HV1 A;  4MAG A;  2PT1 A;  3H6U A;  3H06 B;  2NWJ A;  3LUY A;  1RKM A;  4Z7E A;  2CZL A;  2RCB A;  4OVP A;  4JVD A;  2HEU A;  2LJH A;  3H09 A;  5AA2 D;  3H03 A;  5IZZ A;  3SEX A;  3SEV A;  3IFA A;  4I8O A;  3T22 A;  2HGH A;  4GKK E;  1IXC A;  2LMZ A;  2Y7I A;  3EPK A;  5KDT A;  3OO8 A;  4DI4 B;  1MY2 A;  1VSO A;  5A6B D;  1DK4 A;  1X6H A;  3FXR A;  2EN4 A;  1Y3N A;  2O51 A;  1EYK A;  5TP9 A;  1YCJ A;  1B7U A;  5DTB A;  4DUZ E;  1B3G A;  1MY4 A;  4IGT A;  4R6K A;  3I6V A;  2QJE A;  2EPZ A;  2I58 A;  3MW0 A;  3ADG A;  1YUI A;  1KA1 A;  2KHX A;  2NA2 A;  1IBL E;  4GWS A;  3MAM A;  4R2P A;  1YFH A;  4NF6 A;  2I4B A;  3IOV A;  4DKK A;  5H8H B;  1MS7 A;  2V8Q B;  2FVZ A;  2CZH A;  5I58 B;  4I1D A;  3FJG A;  3ZSF A;  2UXA A;  3HQ1 A;  2B3F A;  2GHF A;  3HPZ A;  4DCY A;  4OVT A;  2DIX A;  2BBG A;  3ILT B;  2ELZ A;  2REJ A;  3VE1 B;  2UXC E;  1B2H A;  5KL3 A;  1MXV A;  2M1S A;  4U23 A;  3FVO A;  2QMX A;  2EOZ A;  3TTM A;  2EPX A;  4DXC A;  1MGT A;  2EMI A;  2EOR A;  2V3U A;  1NNF A;  4MLV A;  4DV2 E;  1B46 A;  2MC5 A;  4BHC A;  2EOJ A;  3LSW A;  1MDP 1;  2RS6 A;  3HPI A;  2LCE A;  1DTZ A;  3J7A G;  2PMS A;  3OEM A;  1UIU A;  4OVQ A;  2EMC A;  1YZ9 A;  4Q8R A;  4LF4 E;  3S2V A;  3EKI A;  4RPO A;  5JTY A;  3TDJ A;  1A1K A;  2AIX A;  4MEV A;  3B8B A;  2F3B A;  2HC5 A;  1QKB A;  2H5Y A;  4OER A;  4N07 A;  2I0C A;  2NUF A;  1NUY A;  5CFF E;  2MKZ A;  2JOX A;  2UUB E;  1F9B A;  1Y4C A;  2L2K B;  1B05 A;  1P1O A;  1UQW A;  2DOJ A;  3JTZ A;  5A6K A;  3MUQ A;  2F4V E;  3Q26 A;  5F24 A;  2IA4 A;  1WOD A;  2XWK A;  2O69 A;  3TCG A;  5AA4 B;  5KCJ A;  4JXI A;  2EJ4 A;  4F3S A;  1R9Q A;  4XKN A;  4LAT A;  1A8F A;  2EN8 A;  2XXH A;  1WJP A;  4M0V A;  2MKD A;  2E5L E;  5L8D A;  2LE2 A;  2B7V A;  2DLK A;  1P1W A;  4DIG A;  4EXK A;  2ENA A;  5KL6 A;  1YZ0 A;  3ADI A;  3A3U A;  3MPK A;  4P9K A;  2LUP B;  4FEC A;  3JYR A;  1NNT A;  1IMU A;  4HCW A;  1N33 E;  1VR5 A;  4PE5 B;  3S9L C;  1MXU A;  3TTR A;  1SD3 A;  1MQJ A;  1OVT A;  3L6H A;  4I9D A;  4GF8 A;  1MPC A;  3QK6 A;  3TCF A;  4BBY A;  2EOE A;  1NV3 A;  5ITP A;  4I40 A;  2EN1 A;  3GXA A;  5I5P A;  4LU9 A;  2QVU A;  1EZO A;  1CNQ A;  3BIG A;  3V8X B;  4MX6 A;  5CBR A;  1LAX A;  1PEB A;  3BIH A;  4H0W A;  4P47 A;  2F35 A;  4ZZE A;  4BDO A;  3KFM A;  3KN3 A;  2QL3 A;  4ND9 A;  5I2N A;  2EZ6 A;  1D3K A;  4PQJ A;  1T38 A;  1YTV A;  3PUZ E;  5ET8 A;  4F1Y A;  3FIG A;  1UTH B;  3OO9 A;  2I0B A;  4NHB A;  5H8F B;  1S50 A;  2PBW A;  4XEQ A;  2JOB A;  2DSF A;  3QUF A;  2L8T A;  4XTC Q;  1A1L A;  3FVG A;  1R1N A;  3W15 C;  2ZZX A;  1FCK A;  2N8X A;  2BJJ X;  2DS9 A;  4QSC A;  5F1Q A;  4WKM A;  3OD7 A;  1LAH E;  1NKX A;  2H99 A;  1FBH A;  4OET A;  1Y1Z A;  3GYY A;  4O3B A;  2D5W A;  5AA2 A;  3IX1 A;  1Y1M A;  3C4T A;  3SES A;  4LN5 A;  1N7X A;  5DVF A;  2V93 A;  4LZ8 A;  1NUZ A;  3VLU A;  3V5A A;  2VOZ A;  5A6B A;  2I6E A;  2R71 A;  3PUY E;  1PBQ A;  1POT A;  2WX9 A;  3T0J A;  1NNP A;  3Q27 A;  3EN3 A;  4IO4 A;  2LBS B;  3ODB A;  2ZZW A;  5CMB A;  2AL5 A;  4PFW A;  1LBW A;  4F19 A;  4JI3 E;  1N36 E;  4F3G A;  1MH3 A;  3IAZ A;  3MVY A;  3T93 B;  4HE0 A;  2XXU A;  4KCC A;  5CMM A;  1B5H A;  1NH8 A;  1QUI A;  2H25 A;  1O7T A;  4ELP A;  3C6M A;  4NQ8 A;  3MHH C;  4KQP A;  1X3C A;  4G8N A;  3PPO A;  2OZZ A;  1P1Q A;  5ITO A;  4R73 A;  1GZ6 A;  3H6W A;  2A5S A;  1GGG A;  3TFL A;  3O9P A;  4XKR A;  2EMW A;  4NWD A;  2YTE A;  3R6U A;  3P7I A;  3KN8 A;  4H6D A;  4K3F A;  5L9M A;  3HPS A;  3KN7 A;  2W7Y A;  2VT5 A;  3E4R A;  5CMK A;  4JI2 E;  3P1X A;  4BDN A;  2GLI A;  4PFT A;  4LZ5 A;  1MH4 A;  1H44 A;  4KWY A;  5I2K B;  5CMC A;  2ODR C;  4N15 A;  5FHO A;  3ADL A;  4F2J C;  5DT6 A;  5ADZ A;  4P11 A;  2ZM6 E;  2PCR A;  3KZY A;  4LP2 B;  2V84 A;  1KA0 A;  3FXU A;  4EQ7 A;  2YU8 A;  1YYK A;  1NV1 A;  1N3X A;  1A1I A;  2DRP A;  4OFO A;  4U4S A;  3SEU A;  2B3B A;  4JSO A;  3TAJ A;  4GL0 A;  3ZOQ B;  4F2Q A;  1NL5 A;  3QG5 C;  4KYE A;  1WRJ A;  4WXJ A;  5I59 A;  4BC9 A;  1Q9D A;  3IL1 B;  1HNX E;  4WED A;  4LF7 E;  1NUX A;  2WCC 3;  1USY E;  4KCD A;  1TT1 A;  5TPA A;  2QVV A;  4P1E A;  2ALU A;  3O6H A;  1FPL A;  4B3R E;  4PBQ A;  2V88 A;  2OX3 A;  2H36 X;  1JW5 A;  1M5B A;  5IZ3 B;  3RTF B;  1DGC A;  3SEY A;  4JWO A;  4RXL A;  3OOA A;  4X48 A;  2D21 A;  4DV6 E;  4MJO A;  2F7A A;  4FBP A;  1O0W A;  3IOW A;  4EXL A;  4BLA A;  1USY H;  3R7X A;  4FIM A;  2FTX B;  1A40 A;  4OHN A;  1MQH A;  3MBP A;  5K2Y A;  4AS5 A;  4DV3 E;  4B3S E;  2KLF A;  3M3K A;  4O4K A;  4GFR A;  4EF2 A;  3OSR A;  3RMP A;  3FVN A;  4ZEK A;  1M5D A;  2RCA A;  2P1S A;  3N5L A;  1B9J A;  1JNF A;  3CSB A;  3ISP A;  1N7W A;  3PPN A;  5KL4 A;  1JEU A;  2DVZ A;  5A6A A;  1POY 1;  1T4N A;  3FVK A;  1PB8 A;  2DXR A;  2REG A;  1FQB A;  1YSA C;  1FTK A;  3UP9 A;  4JVI A;  2E1M A;  4GXS B;  4PP0 A;  1FBG A;  1FJ6 A;  1LAG E;  1UTB B;  4MIJ A;  4KYD A;  3IOT A;  2UVH A;  3J81 C;  3KZG A;  4GLI A;  2UVG A;  2EMA A;  1IMB A;  1EZP A;  3IB2 A;  4IJD A;  2XWV A;  4ZEI A;  1FTA A;  4O43 A;  1FQC A;  1BIY A;  3HCQ A;  3PUX E;  3UOR A;  4OVR A;  2OWZ A;  5I57 B;  5B70 A;  3DF6 A;  3O66 A;  3E78 A;  4ZYE A;  3Q29 A;  2DWA A;  3UIF A;  4YY3 E;  1J5E E;  3K1P A;  4YZZ A;  1MY0 A;  1TN9 A;  2KQZ A;  4X8W A;  1EKZ A;  3IOU A;  2OBG A;  4ISU A;  3LLH A;  1Q1K A;  4KYS A;  4PFY A;  4F6N A;  1YPN A;  1ZBQ A;  3MC2 A;  4FOR A;  4RNS A;  3K02 A;  3U92 A;  2Z8E A;  4QBA A;  5IXM B;  1P99 A;  2GHB A;  1NCS A;  3EPJ A;  1RYX A;  1A99 A;  4JB7 A;  2CEY A;  4I3E A;  2DVC A;  4IO5 A;  2GRV A;  3THN A;  3K6X A;  4GX6 A;  5AE1 A;  4F18 A;  4H5G A;  2DWJ A;  2WYP A;  3K2D A;  4JV5 E;  2UUC E;  1RDZ A;  2JR1 A;  3FJ7 A;  5FTH A;  4FJP A;  3F11 A;  1IMA A;  4N4U A;  5AE3 A;  4YIC A;  1RDY A;  3LR1 A;  3MZ9 A;  2EL4 A;  2FYI A;  1H76 A;  1IIT A;  1B52 A;  4EDP A;  4Q5T A;  3KBZ A;  1N32 E;  2YRH A;  4ZEB A;  1LEV A;  2YJP A;  3MVZ A;  5TSE A;  4YMB A;  2F6P A;  3RN8 A;  4LUB A;  4JVC A;  3UN6 A;  5IAI A;  4R03 A;  2Z22 A;  2CTD A;  2YTO A;  1WHN A;  3J80 C;  4G68 C;  3BBG A;  4TLL B;  4PAI A;  4N81 A;  2QVR A;  4NXM E;  4JSD A;  1JP4 A;  1QW0 A;  5BUU A;  4R2E A;  4IO2 A;  1NV6 A;  1FQF A;  1MRP A;  4O94 A;  3RTW B;  3NOH A;  1QU6 A;  1GTK A;  1MXY A;  2VHA A;  4NGU A;  1PJT A;  4UAC A;  3FUZ A;  1PJQ A;  2L2M A;  3HXL A;  3H7M A;  4PGP A;  4ZYH A;  3WAF A;  4HTG A;  4UAB A;  2EQ0 A;  1DPE A;  2YSP A;  3M99 B;  2B3T B;  2Y5L A;  3FJM A;  4GD5 A;  5AA4 A;  4NX1 A;  5M2V A;  2ENC A;  2EOY A;  1VFE A;  1NUW A;  5DW8 A;  3ZS6 A;  2VD3 A;  1INP A;  4YAH X;  4LF9 E;  3PU5 A;  3T1B A;  3K4U A;  3H6T A;  2I4C A;  4ZS9 A;  2YTJ A;  1JEV A;  5KL7 A;  3MZ1 A;  2O1L A;  5EQA A;  4LON B;  4GVO A;  1OVB A;  2H98 A;  2EOM A;  2JPA A;  4MLQ A;  2LO3 A;  3FXQ A;  3MVX A;  4IS1 C;  1VE4 A;  4DUY E;  2GH9 A;  2YTG A;  2F78 A;  2OJT A;  2YTQ A;  3B7D A;  1RMD A;  3J7Y p;  2EE8 A;  3D4G A;  2FIE A;  1IXH A;  2WBT A;  1DMB A;  3JV9 A;  4X65 E;  3KSX A;  1FPK A;  2ZYK A;  4DR6 E;  2EM0 A;  1LBX A;  2MC6 A;  3THO B;  2PX1 A;  2A5T A;  3M3F A;  2EOI A;  3G3K A;  2FGG A;  4ZDM A;  4MCO A;  1UTH A;  4X64 E;  2Q74 A;  1B3L A;  2RTX A;  4NXN E;  1B51 A;  4L8N A;  2VQE E;  4NF5 B;  2KR0 A;  5ISU A;  5DNY A;  3RPL A;  1B40 A;  1FTJ A;  1FBC A;  4F6M A;  1FBF A;  2EWL A;  4OA4 A;  3C4M A;  4ZYG A;  2VE7 C;  4O7M A;  3FXB A;  3FGS A;  3AV0 A;  3C32 A;  1B1H A;  5K2X A;  3I3V A;  5TU0 A;  3N6T A;  1BK4 A;  4OFL A;  2DE2 A;  1X47 A;  2YU5 A;  1GR2 A;  1FQD A;  2FBP A;  2ZXT A;  3FAT A;  2V89 A;  2Q9T A;  1IQO A;  4DV7 E;  1MQD A;  3KSJ A;  1ANF A;  2CSH A;  4LFA E;  3TTN A;  2O1M A;  3CG1 A;  2HHH E;  3C34 A;  3M3L A;  3PGF A;  2OLB A;  1AOV A;  3TQL A;  1FBD A;  3FV2 A;  4ZE9 A;  2XD3 A;  2DB2 A;  3CFX A;  1QUK A;  1FPI A;  2E72 A;  2QPQ A;  3KJT A;  4KR5 A;  2DYX A;  2FNC A;  3G3H A;  1ZMG A;  3L6G A;  4BDL A;  1XMQ E;  2EMZ A;  5IT9 C;  5ET6 A;  2H9B A;  2XXT A;  4PAK A;  1DSN A;  1LLM C;  1NEI A;  1DI2 A;  2HZL A;  3E3K A;  4R72 A;  5IZ1 A;  4C1U A;  2Z23 A;  1SVX B;  3EPE A;  5T6J A;  2KOU A;  2XA5 A;  2Y7R A;  2Q8U A;  5HBC A;  4B3T E;  3CHG A;  4R8O A;  1ELJ A;  2XXX A;  4R9F A;  2G7H A;  2EPP A;  2XD2 A;  4N6D A;  1OQH A;  3MWB A;  4H46 A;  3S4U A;  2XXP A;  3KG2 A;  1LGB C;  1N04 A;  3JZJ A;  2O84 X;  2LVH A;  1MXZ A;  4DV5 E;  3B6W A;  4ZE8 A;  3OXN A;  4JI0 E;  4O5G A;  4P8B A;  4X1B A;  5I2K A;  2F34 A;  1B5I A;  4GL8 A;  2ZYO A;  4E0X A;  1HSJ A;  3V89 B;  2WYK A;  5LL6 R;  1MY3 A;  4LF6 E;  4P0I A;  2JWO A;  1SW4 A;  2EMF A;  4O8M A;  1URS A;  4DR5 E;  1H43 A;  3LC8 A;  4ZYD A;  5DEX B;  3RT6 B;  2XXV A;  4QFP A;  3KWR A;  2PFY A;  4Q35 B;  1B3H A;  3B6Q A;  1BB8 A;  2L5V A;  3UA8 A;  3U93 A;  3U72 A;  4N13 A;  1PJS A;  3PTY A;  3KC1 A;  4QFO A;  2Z8D A;  2LV2 A;  3W9W A;  4NF0 A;  4OEV A;  3MQ9 A;  1JW1 A;  4M30 A;  1LFG A;  2EMH A;  4OVJ A;  3LSF B;  3F6G A;  3A09 A;  1EH3 A;  1QGX A;  3CI8 A;  1AMF A;  4IR8 A;  3TKD A;  1A1F A;  3HHG A;  2YT4 A;  2RC8 A;  1BLF A;  3KEI A;  2EOX A;  4JBZ A;  5DVJ A;  1D4N A;  4DDD A;  5KDT B;  2I13 A;  4KD5 A;  4HW8 A;  1IIW A;  2EPU A;  1D9V A;  3VXC A;  5ET7 A;  1XS5 A;  1FQE A;  2V83 A;  4MMP A;  4POX A;  2WEF A;  5TP9 B;  1PBP A;  5FLX C;  3UK3 C;  3O29 A;  5CI5 A;  1AWB A;  4DCX A;  4U21 A;  2QS2 A;  2GHA A;  2LT7 A;  1A8E A;  1B1X A;  4Q0C A;  2E0S A;  1QNT A;  5H8Q A;  3MYU A;  4G61 A;  4JDF A;  1YAE A;  3TQW A;  4JWX A;  3K01 A;  4X9T A;  3LML A;  4U1Z A;  4YHH E;  1US5 A;  1MQG A;  3EF7 A;  4IO7 A;  3RNN A;  4R2S A;  3RQT A;  4PET A;  3A29 A;  2XXY A;  2EMG A;  4O3C A;  5L9S A;  2VP1 A;  3G3J A;  1LBY A;  3T9X B;  4PF6 A;  4GIZ A;  2XXW A;  4HE1 A;  2Y7K A;  3HST A;  3PMW A;  4F29 A;  1SI1 A;  2YTI A;  3QUJ A;  3DP6 A;  1UBD C;  1IQ7 A;  3FZV A;  2EMK A;  4OMB A;  1Y3Q A;  3K0V A;  2QS1 A;  5F3W A;  3MVW A;  4FAJ A;  4IO6 A;  4H67 A;  4DV0 E;  3PD9 A;  1JVY A;  4GEQ B;  4PFR A;  3B6T A;  3MHS C;  1J26 A;  4X66 E;  4PDD A;  3K6V A;  3EHU A;  2AL4 A;  4DLD A;  1HR0 E;  3JU0 A;  2CEX A;  1Q35 A;  1B0H A;  5BR8 E;  3GZG A;  3CSG A;  4R2Q A;  3C4B A;  1URG A;  1STU A;  3I5O A;  2RPC A;  5JTY B;  3DJW A;  1T39 A;  1RQ0 A;  2DE4 A;  1X49 A;  2IEE A;  4R6Y A;  3EPH A;  5AC4 A;  2L2N A;  1FTM A;  2CZI A;  2GQ1 A;  2V4C A;  4OEN A;  1G2D C;  2O7I A;  2EQ3 A;  5KCJ B;  3IR1 A;  3T9U A;  4RHB B;  4P3L A;  1NMU A;  2EOQ A;  2V3Q A;  2PVU A;  2MDR A;  3C9H A;  3BF2 A;  2WZO A;  3PUW E;  2YPN A;  2BB8 A;  2DLQ A;  5AE4 A;  3MPL A;  5LTC A;  2UYE A;  1EZ9 A;  1LAF E;  5EYH A;  4GQO A;  4QFL A;  4QSE A;  3LSL A;  4KZS A;  3MP1 A;  1QJM A;  3KOS A;  4NF8 A;  5CRY A;  1B6H A;  3QAX A;  3OEN A;  3IWD A;  4HS7 A;  2Q8M A;  2YRK A;  3QMF A;  1IMD A;  5ELV A;  5I84 A;  2EM9 A;  2MKN A;  2F7C A;  3MSW A;  3K6Q A;  4OOG C;  1US4 A;  3KOT A;  1IUD A;  4K0K E;  2P3V A;  2V86 A;  1B7Z A;  2F36 A;  4GXA A;  1XMO E;  1DQ3 A;  3MZB A;  3ONM A;  4U1O A;  3WAE A;  2P3N A;  1Y20 A;  1GQE A;  2EOF A;  1BBO A;  5I2N B;  4NF4 B;  2DMY A;  3USD A;  3ILU B;  3E13 X;  1VDW A;  1X6F A;  1Y4T A;  3G7W A;  4E0W A;  1DPP A;  1ZJL A;  4G77 A;  2HXW A;  4PFB A;  3TOD A;  4X8R A;  3T96 B;  3QIM A;  5H8N A;  4YKI A;  3IO6 A;  1CE2 A;  4QFN A;  4JI1 E;  3G3F A;  2QRY A;  2N3H A;  1LST A;  1ZBM A;  2F6G A;  4ZEC A;  4FK5 C;  4NE4 A;  1AIV A;  3EHS A;  2G93 A;  1SFE A;  1MPD A;  5AA2 B;  1LCF A;  2ADR A;  3ECR A;  1DOT A;  5EYF A;  4B3M E;  1YUJ A;  2Q2C A;  3E9X A;  3THI A;  2R76 A;  2YSO A;  1ZBT A;  4AB6 A;  1SBP A;  4EUO A;  3Q25 A;  1SW2 A;  4OX9 E;  2B9D A;  4WEP A;  3QSL A;  4OQO A;  4IY6 A;  5JEI A;  2QFL A;  3OEK A;  1B32 A;  4PFI A;  4GRK A;  5I56 B;  2EM4 A;  4BS9 A;  5IM2 A;  1FW0 A;  3M8U A;  2GPI A;  2VPN A;  3IWB A;  4LVQ A;  3CRB A;  4FEB A;  2EQ1 A;  3PUV E;  3LSX A;  2PT2 A;  2M9A A;  5FTI A;  5CC2 A;  1NNK A;  1IXG A;  1SW1 A;  2ONK E;  3ROJ A;  4WXD A;  3FBP A;  4PDH A;  2N3G A;  1P47 A;  1IEJ A;  3BFU A;  5A2Q C;  2DWI A;  3TUS A;  5H8H A;  1MPB A;  4IB2 A;  4EF1 A;  4IY5 A;  4G8M A;  1S7Y A;  1RDX A;  5I58 A;  2I9I A;  1LFH A;  4AS4 A;  3VVF A;  2XWO A;  4ESX A;  2NUG A;  2YTN A;  1L4S A;  1A54 A;  3PMX A;  4DV4 E;  4ELO A;  1PDA A;  3K00 A;  3D1R A;  1UIL A;  1I69 A;  2CMO A;  4QF9 A;  3U8Q A;  1URD A;  1XT8 A;  4N91 A;  4LFC E;  3H3G A;  3EQ1 A;  4F3P A;  2RSI A;  2LRS A;  3W9V A;  2EM7 A;  1NI9 A;  4MFI A;  2Z8F A;  1GV8 A;  2X7Q A;  1N3G A;  3O28 A;  5EQ7 A;  2NVU B;  4POW A;  3H4Z A;  2YTF A;  1RC7 A;  3VV5 A;  4ECF A;  4M4G A;  3LUZ A;  3TMG A;  2B7T A;  1RYO A;  2CT1 A;  5LMU E;  2DWH A;  4RK9 A;  4ESW A;  2Q88 A;  5I59 B;  5HPQ A;  3RPW A;  4F9A B;  4LQ2 A;  2F8D A;  1OMP A;  5TPA B;  1AH5 A;  1MG1 A;  4DI3 D;  2M4I A;  5AAS A;  2YTP A;  2BJI A;  1EH8 A;  1B69 A;  2EOS A;  2Q2A A;  3PD8 A;  1FJ9 A;  1A1G A;  2I3W A;  4YB7 A;  2KON A;  2I49 A;  1M5C A;  2OK2 A;  4Q28 A;  2ZNS A;  2EPC A;  3Q28 A;  4NZV A;  2FHY A;  4FE8 A;  4XIG Q;  2WBS A;  4PE3 A;  2HQ0 A;  1NV2 A;  4X1D A;  3K6W A;  3GLB A;  4PGN A;  2WBB A;  4RH8 A;  2QSX A;  3O6I A;  2EP3 A;  1LLS A;  2L92 A;  3DLN A;  3HN0 A;  1IBK E;  1LB9 A;  4KHP E;  4NWC A;  1MEY C;  4GX3 A;  4DZ1 A;  4C1T A;  2EMX A;  1LCT A;  4WX9 A;  3O97 A;  2HPG A;  4RA1 A;  2VQF E;  1EH7 A;  4BHB A;  2UXD E;  2L3C A;  4DXU A;  1Z7N E;  3CFL A;  1YXI A;  1ZIU A;  5EHS A;  5IKB A;  2HFB A;  3R26 A;  2D9H A;  1NV0 A;  1BBG A;  1Y3P A;  3MJN A;  1XNQ E;  5JK4 A;  1Z1B A;  1I6A A;  4HCY A;  2DGC A;  4BC7 A;  2ELY A;  4P0G A;  4ELQ A;  5A6J A;  3D4C A;  2X26 A;  1IMF A;  5IV8 B;  3FV1 A;  1X5W A;  1X48 A;  3SDF A;  5A5X B;  4GBW A;  1FSA A;  4LTY A;  2ZYM A;  3IB1 A;  2CPN A;  1QVS A;  1B7H A;  1BP5 A;  2EPO A;  5ICT A;  1AAY A;  3OO7 A;  3K6U A;  5J1D A;  1GVC A;  5H8F A;  2JP9 A;  2O7U A;  3CIJ A;  2R9J A;  3AXF A;  4I62 A;  3PPP A;  5EQ8 A;  4MBP A;  3U94 A;  3F6H A;  3T1Y E;  4JI6 E;  1A1H A;  4QSD A;  2ODR D;  4P1L A;  5B7D A;  2DXY A;  4G68 B;  1JK1 A;  4OYV A;  1OLC A;  4U22 A;  5ICQ A;  1HNW E;  3A3C A;  4I3Y A;  4GZN C;  3VXB A;  3IO4 A;  2DE3 A;  1LBB A;  3RYD A;  4R2R A;  2UYF A;  5DVI A;  2EPN A;  1P1N A;  3SKP A;  3EPL A;  1IME A;  2F8B A;  3VLV A;  3O6G A;  1ZLQ A;  4N4R B;  2OCU A;  1TF3 A;  4JI8 E;  1TXF A;  4NMY A;  4ZZA A;  4DR3 E;  4G4P A;  2Y5K A;  2YWQ A;  4OEU A;  1YYZ A;  4YB6 A;  4I8C A;  5KL2 A;  2HCA A;  2OWT A;  5AC5 A;  1B5J A;  2QMW A;  2QS3 A;  4NN3 A;  1D9Q A;  2DQV A;  1TFA A;  2WBU A;  1T4O A;  3HFU A;  2XHD A;  5I7I A;  2EN3 A;  1LBV A;  4GBV A;  3OEL A;  2NAB A;  3PPR A;  4PC9 A;  4GWO A;  1X6E A;  3HO7 A;  1LBZ A;  2OWS A;  2XX9 A;  4F54 A;  1EH6 A;  4MNP A;  1ZKB A;  4DR1 E;  1HSL A;  1MXW A;  4MF3 A;  4H5F A;  5A5L A;  2RKM A;  4HXV A;  2B4L A;  1K9Z A;  1G2F C;  2RS7 A;  3VK6 A;  4OAN A;  1A7L A;  3HHF A;  1WXR A;  5FHN A;  4R2F A;  4TUG A;  4LF8 E;  2UVI A;  3TZA A;  4RY1 A;  3T9H B;  5LMN E;  4WSG A;  4YU0 A;  2PFZ A;  1IBM E;  3BBR A;  1SW5 A;  2UUA E;  2HHM A;  1ZU0 A;  4FED A;  2VF1 A;  4L5N C;  3N6U A;  1I6B A;  1FPD A;  3FD3 A;  2G29 A;  1A1J A;  4P56 A;  3QYT A;  4GWU A;  3CFZ A;  5J16 A;  1FTL A;  3T66 A;  4XFE A;  5EHM A;  3KBR A;  3LV0 A;  4NG7 A;  4BMJ A;  1J1N A;  4UA8 A;  3H6V A;  4GWW A;  3C36 A;  2VD2 A;  3O2A A;  4QHQ A;  4R2C A;  5FBP A;  4GWY A;  2EPR A;  2M8C A;  2DP8 A;  1JET A;  3DP8 A;  2J7J A;  4MHF A;  1A55 A;  4OES A;  4OXV A;  4KFQ A;  4M9V C;  2NXO A;  4HEI A;  3VFJ A;  1SI0 A;  2NOO A;  4DMI A;  1KZ8 A;  4LZ7 A;  4AQY E;  1XHY A;  1YYW A;  2RSM A;  1NFT A;  3BKI B;  3CR9 A;  4KHZ E;  4YKP A;  3FAS A;  1OIB A;  4JI4 E;  1KWH A;  3ZKK A;  4TQU Q;  3IOR A;  1PB9 A;  5IZ3 A;  1TWY A;  5LDZ A;  1CB6 A;  1FPB A;  2HXR A;  2ONR A;  3VDF A;  3S9M C;  1VFD A;  4PFU A;  3RLF E;  1SDX A;  3G3I A;  2HJJ A;  1OQG A;  3VYX A;  4NF4 A;  4J8Z A;  1MM7 A;  1NV5 A;  1FKA E;  4YKJ A;  2F7B A;  2HZK A;  4XKP A;  4Z0I A;  2A5T B;  1T4L B;  2HAU A;  4R2A A;  1JQF A;  5LLQ A;  2R1F A;  5AA3 A;  1EYI A;  1JW4 A;  3RPL B;  1QUJ A;  4YB5 A;  4NED A;  1D9Y A;  5I3S A;  2XXI A;  1JVX A;  2EN7 A;  2V85 A;  1IZ1 A;  4NF6 B;  4TUI A;  3E79 A;  1ZAA C;  4KPT A;  3DEL B;  1B4H A;  4GWZ A;  3S9E A;  3RGY A;  2L33 A;  4JI7 E;  4RYA A;  4F39 A;  3T9V A;  1R9L A;  3OTO E;  5CBS A;  3U1O A;  4KXP A;  3ADJ A;  2K7I A;  2XX8 A;  4DR2 E;  2ZMB A;  3FIR A;  1B3F A;  3UGW A;  2RC7 A;  2I48 A;  1UTB A;  2ESN A;  3PPQ A;  2JY9 A;  4F2O A;  1SYH A;  2O68 A;  2L3J A;  4WFT A;  3IK6 B;  1T0K A;  1K9Y A;  5ET5 A;  2EL6 A;  1FBE A;  2VPO A;  4NTL A;  4H45 A;  4MH5 A;  4LFB E;  3SER A;  3VLW A;  5I57 A;  4DE8 A;  2WKY A;  2O6A A;  4FAT A;  3T1H E;  1NV7 A;  5I56 A;  2XXQ A;  4O7I A;  3GBA A;  2ZNU A;  2Y84 A;  5LOM A;  2PYY A;  3S9N C;  5L9O A;  2ENH A;  4BDM A;  3LBS A;  3VVD A;  2EMY A;  4H65 A;  3BGH A;  3TQM A;  2P2A A;  2JJK A;  2EOH A;  3JAM C;  4OVS A;  3TTK A;  3N94 A;  4GKJ E;  4WPY A;  1JK2 A;  1TFD A;  3ZKL A;  1XC1 A;  2R8T A;  1ZU1 A;  3AUZ A;  1M5E A;  3EHT A;  3C35 A;  2V25 A;  2F3D A;  4F9B B;  2RC9 A;  2EM2 A;  3MP6 A;  1WHQ A;  4G8H A;  1UIV A;  5ESY A;  3U65 A;  2IHR 1;  1ATG A;  2EML A;  2EM3 A;  4AQ4 A;  2X7P A;  3TEL A;  1AL3 A;  2YLN A; 
#chains in the Genus database with same CATH homology
 4THI A;  3OSQ A;  1MXX A;  4BDR A;  3TPA A;  2R6G E;  4RJZ A;  3C33 A;  1WDN A;  4ELR A;  4F3B A;  1SQY A;  3GBB A;  4N6P A;  2I3V A;  5H8S A;  4TLM B;  2FA7 A;  4XKQ A;  4L17 A;  1QUL A;  4O3A A;  2ZNT A;  2HAV A;  3C31 A;  4EQB A;  3IJO B;  4U2R A;  3CVG A;  3TCH A;  5HM4 B;  1QKA A;  4R74 A;  3V83 A;  4RK2 A;  4QRZ A;  3RUM A;  3PMV A;  3RT8 A;  2XXR A;  2ABH A;  4F31 B;  1FTO A;  5H8Q B;  1MQI A;  3TYH A;  4H1X A;  1OLA A;  4EQ9 A;  4R6H A;  4OFJ A;  1PC3 A;  1XVY A;  1EU8 A;  2F5X A;  4AB5 A;  3QXM A;  1N0T A;  1BKA A;  2GFE A;  1S9T A;  3BFT A;  4ZEF A;  1LBC A;  2P0S A;  4YKK A;  4BDQ A;  5A5X A;  4ZED A;  3OMB A;  2XX7 A;  4DXB A;  3N26 A;  2H4I A;  1XVX A;  3K1N A;  4NF5 A;  1HSE A;  4F1V A;  2UVJ A;  1I6Q A;  2NUV A;  4F1U A;  2ONS A;  1II5 A;  4H8I A;  1FQA A;  4JWY A;  2Y7W A;  5FHM A;  4G68 A;  1O64 A;  5KZT A;  4F22 A;  2E1S A;  4OWD A;  3TTL A;  4R2B A;  4C0R A;  3IJX B;  1WVJ A;  4U4X A;  2QS4 A;  1O63 A;  1MM6 A;  1H3D A;  2V3T A;  1N84 A;  3PV0 E;  1M5F A;  3TEP A;  4RPN A;  1IXI A;  3VVE A;  3KJ7 A;  3RY3 A;  3SET A;  4ONY A;  2LAO A;  1B3E A;  5DYH A;  5F7V A;  3OO6 A;  4TOZ A;  2VGQ A;  4OTE A;  1H45 A;  2Y7P A;  1L5T A;  2AYS A;  1B58 A;  2ZYN A;  4LA9 A;  1B0L A;  1DTG A;  4NF8 B;  1PB7 A;  3KGC A;  1LFI A;  4R75 A;  1B4Z A;  4Q30 B;  1P1U A;  3G3G A;  1Z7M E;  4GOT A;  1XOC A;  3K1M A;  4R9G A;  4H8J A;  1N76 A;  2RF1 A;  4LQ5 A;  1NH7 A;  3UK4 A;  1MY1 A;  4IO3 A;  1R6Z A;  4OZ9 A;  5BWJ A;  2ANJ A;  1LB8 A;  1Y9U A;  3DP4 A;  2D3I A;  4IGR A;  2Q8J A;  4YMA A;  5H8N B;  3IB0 A;  3MP8 A;  3SEW A;  1ZTY A;  2F97 A;  4QFK A;  4G2Z A;  4KI0 E;  4M1V A;  2THI A;  1N3W A;  3CG3 A;  5CM6 A;  5DEX A;  5AA1 A;  1SYI A;  2Q89 A;  2RIN A;  3DM0 A;  4XXU A;  1MDQ A;  2B65 A;  1BTJ A;  3HV1 A;  2PT1 A;  3H6U A;  3H06 B;  2NWJ A;  3LUY A;  1RKM A;  4Z7E A;  2CZL A;  2RCB A;  2HEU A;  5AA2 D;  3H03 A;  3SEX A;  3SEV A;  3T22 A;  1IXC A;  2Y7I A;  5KDT A;  3OO8 A;  1MY2 A;  1VSO A;  3FXR A;  1Y3N A;  2O51 A;  5TP9 A;  1YCJ A;  1B7U A;  5DTB A;  1MY4 A;  1B3G A;  4IGT A;  4R6K A;  3I6V A;  2QJE A;  2I58 A;  3MW0 A;  3MAM A;  4NF6 A;  2I4B A;  3IOV A;  5H8H B;  1MS7 A;  5I58 B;  4I1D A;  3FJG A;  3ZSF A;  2UXA A;  2B3F A;  4DCY A;  3ILT B;  2REJ A;  3VE1 B;  1B2H A;  1MXV A;  4U23 A;  3FVO A;  2QMX A;  3TTM A;  4DXC A;  2V3U A;  1NNF A;  4MLV A;  1B46 A;  3LSW A;  1MDP 1;  3HPI A;  1DTZ A;  2PMS A;  3OEM A;  1UIU A;  4Q8R A;  3S2V A;  4RPO A;  5JTY A;  3TDJ A;  2AIX A;  1QKB A;  2H5Y A;  4OER A;  4N07 A;  2I0C A;  1F9B A;  1Y4C A;  1B05 A;  1P1O A;  1UQW A;  2DOJ A;  3MUQ A;  3Q26 A;  2IA4 A;  1WOD A;  3TCG A;  2O69 A;  5AA4 B;  5KCJ A;  4JXI A;  4F3S A;  1R9Q A;  4XKN A;  4LAT A;  1A8F A;  2XXH A;  5L8D A;  1P1W A;  4DIG A;  4EXK A;  3A3U A;  3MPK A;  4FEC A;  3JYR A;  1NNT A;  4HCW A;  1VR5 A;  4PE5 B;  3S9L C;  1MXU A;  3TTR A;  1SD3 A;  1MQJ A;  3L6H A;  4I9D A;  1OVT A;  4GF8 A;  1MPC A;  3QK6 A;  3TCF A;  5ITP A;  3GXA A;  1EZO A;  3V8X B;  5CBR A;  1LAX A;  1PEB A;  4H0W A;  4ZZE A;  2F35 A;  4BDO A;  3KFM A;  3KN3 A;  2QL3 A;  4ND9 A;  5I2N A;  1D3K A;  4PQJ A;  1YTV A;  3PUZ E;  4F1Y A;  1UTH B;  3OO9 A;  2I0B A;  5H8F B;  1S50 A;  2PBW A;  2DSF A;  3QUF A;  4XTC Q;  3FVG A;  1R1N A;  3W15 C;  1FCK A;  2BJJ X;  2DS9 A;  4QSC A;  5F1Q A;  4WKM A;  3OD7 A;  1LAH E;  1NKX A;  2H99 A;  4OET A;  1Y1Z A;  4O3B A;  2D5W A;  5AA2 A;  3IX1 A;  1Y1M A;  3SES A;  1N7X A;  5DVF A;  2V93 A;  4LZ8 A;  3VLU A;  3V5A A;  2VOZ A;  2R71 A;  2I6E A;  3PUY E;  1PBQ A;  1POT A;  1NNP A;  3Q27 A;  3EN3 A;  4IO4 A;  3ODB A;  5CMB A;  2AL5 A;  4PFW A;  4F19 A;  4F3G A;  1MH3 A;  3IAZ A;  3MVY A;  3T93 B;  2XXU A;  4KCC A;  5CMM A;  1B5H A;  1NH8 A;  1QUI A;  2H25 A;  1O7T A;  4ELP A;  4KQP A;  4G8N A;  3PPO A;  2OZZ A;  1P1Q A;  5ITO A;  4R73 A;  3H6W A;  2A5S A;  1GGG A;  3TFL A;  3O9P A;  4XKR A;  4NWD A;  3R6U A;  3P7I A;  3KN8 A;  4H6D A;  4K3F A;  5L9M A;  3KN7 A;  2W7Y A;  3E4R A;  5CMK A;  4BDN A;  4PFT A;  4LZ5 A;  1MH4 A;  1H44 A;  5I2K B;  5CMC A;  5FHO A;  5DT6 A;  4P11 A;  4LP2 B;  2V84 A;  3FXU A;  4EQ7 A;  1N3X A;  4OFO A;  4U4S A;  3SEU A;  2B3B A;  4JSO A;  3TAJ A;  4GL0 A;  4F2Q A;  1NL5 A;  4KYE A;  4WXJ A;  5I59 A;  3IL1 B;  4WED A;  1USY E;  4KCD A;  1TT1 A;  5TPA A;  2ALU A;  3O6H A;  1JW5 A;  1M5B A;  3RTF B;  3SEY A;  4JWO A;  4RXL A;  3OOA A;  4X48 A;  2D21 A;  2F7A A;  4EXL A;  3IOW A;  4BLA A;  1USY H;  3R7X A;  4FIM A;  1A40 A;  4OHN A;  1MQH A;  3MBP A;  5K2Y A;  2KLF A;  3M3K A;  4GFR A;  4EF2 A;  3OSR A;  3FVN A;  4ZEK A;  1M5D A;  2RCA A;  2P1S A;  3N5L A;  1B9J A;  1JNF A;  3CSB A;  1N7W A;  3PPN A;  1JEU A;  2DVZ A;  1POY 1;  3FVK A;  1PB8 A;  2DXR A;  2REG A;  1FQB A;  1FTK A;  3UP9 A;  4GXS B;  4PP0 A;  1LAG E;  1UTB B;  4KYD A;  3IOT A;  2UVH A;  3KZG A;  4GLI A;  2UVG A;  1EZP A;  3IB2 A;  4ZEI A;  3HCQ A;  1FQC A;  1BIY A;  3UOR A;  3PUX E;  5I57 B;  5B70 A;  3O66 A;  3Q29 A;  2DWA A;  3UIF A;  3K1P A;  4YZZ A;  1MY0 A;  3IOU A;  2OBG A;  4ISU A;  1Q1K A;  4KYS A;  4PFY A;  1YPN A;  3MC2 A;  4FOR A;  4RNS A;  3K02 A;  3U92 A;  2Z8E A;  1P99 A;  2GHB A;  1RYX A;  1A99 A;  4JB7 A;  2DVC A;  4IO5 A;  2GRV A;  3K6X A;  4F18 A;  4H5G A;  2DWJ A;  3K2D A;  3FJ7 A;  5FTH A;  4FJP A;  3F11 A;  4YIC A;  3LR1 A;  3MZ9 A;  2FYI A;  1H76 A;  1IIT A;  1B52 A;  4EDP A;  4Q5T A;  4ZEB A;  2YJP A;  3MVZ A;  4YMB A;  2F6P A;  3RN8 A;  4LUB A;  3UN6 A;  5IAI A;  2Z22 A;  4G68 C;  4TLL B;  4JSD A;  1QW0 A;  5BUU A;  4IO2 A;  1FQF A;  1MRP A;  3RTW B;  1GTK A;  1MXY A;  2VHA A;  4UAC A;  3FUZ A;  3H7M A;  3WAF A;  4HTG A;  1DPE A;  3FJM A;  4GD5 A;  5AA4 A;  5M2V A;  1VFE A;  3ZS6 A;  2VD3 A;  4YAH X;  3PU5 A;  3K4U A;  3H6T A;  2I4C A;  4ZS9 A;  1JEV A;  3MZ1 A;  2O1L A;  4LON B;  4GVO A;  1OVB A;  2H98 A;  4MLQ A;  3MVX A;  3FXQ A;  1VE4 A;  2GH9 A;  2OJT A;  2F78 A;  3B7D A;  3D4G A;  1IXH A;  1DMB A;  3JV9 A;  3KSX A;  2ZYK A;  2PX1 A;  2A5T A;  3M3F A;  3G3K A;  4ZDM A;  1UTH A;  1B3L A;  1B51 A;  4NF5 B;  5ISU A;  1B40 A;  1FTJ A;  3C4M A;  3FGS A;  3C32 A;  1B1H A;  5K2X A;  3I3V A;  5TU0 A;  3N6T A;  4OFL A;  2DE2 A;  1GR2 A;  1FQD A;  2ZXT A;  3FAT A;  2Q9T A;  1MQD A;  3KSJ A;  1ANF A;  3TTN A;  2O1M A;  3CG1 A;  3C34 A;  3M3L A;  3PGF A;  2OLB A;  1AOV A;  3TQL A;  3FV2 A;  4ZE9 A;  2XD3 A;  3CFX A;  1QUK A;  2QPQ A;  3KJT A;  4KR5 A;  2DYX A;  2FNC A;  3G3H A;  1ZMG A;  3L6G A;  4BDL A;  2H9B A;  2XXT A;  1DSN A;  3E3K A;  2HZL A;  4R72 A;  4C1U A;  2Z23 A;  1SVX B;  3EPE A;  2Y7R A;  5HBC A;  1ELJ A;  2XXX A;  4R9F A;  2XD2 A;  1OQH A;  3MWB A;  3S4U A;  2XXP A;  3KG2 A;  1LGB C;  1N04 A;  3JZJ A;  2O84 X;  1MXZ A;  3B6W A;  4ZE8 A;  3OXN A;  4X1B A;  5I2K A;  2F34 A;  1B5I A;  4GL8 A;  2ZYO A;  4E0X A;  1HSJ A;  3V89 B;  1MY3 A;  4P0I A;  1SW4 A;  1URS A;  1H43 A;  3LC8 A;  5DEX B;  3RT6 B;  2XXV A;  4QFP A;  1B3H A;  3B6Q A;  3UA8 A;  3U93 A;  3U72 A;  4N13 A;  4QFO A;  2Z8D A;  3W9W A;  4OEV A;  3MQ9 A;  1JW1 A;  1LFG A;  4OVJ A;  3LSF B;  3A09 A;  1EH3 A;  3CI8 A;  1AMF A;  3TKD A;  3HHG A;  2RC8 A;  1BLF A;  3KEI A;  4JBZ A;  5DVJ A;  1D4N A;  4DDD A;  5KDT B;  4KD5 A;  4HW8 A;  1IIW A;  1D9V A;  3VXC A;  1XS5 A;  1FQE A;  4POX A;  5TP9 B;  1PBP A;  3O29 A;  5CI5 A;  4DCX A;  4U21 A;  2QS2 A;  2GHA A;  1A8E A;  1B1X A;  4Q0C A;  2E0S A;  5H8Q A;  4JDF A;  1YAE A;  3TQW A;  4JWX A;  3K01 A;  4X9T A;  4U1Z A;  1US5 A;  1MQG A;  3EF7 A;  4IO7 A;  3RNN A;  3RQT A;  4PET A;  2XXY A;  4O3C A;  5L9S A;  2VP1 A;  3G3J A;  3T9X B;  4GIZ A;  2XXW A;  2Y7K A;  3HST A;  3PMW A;  4F29 A;  1SI1 A;  3QUJ A;  3DP6 A;  1IQ7 A;  3FZV A;  4OMB A;  1Y3Q A;  3K0V A;  2QS1 A;  3MVW A;  4FAJ A;  4IO6 A;  4H67 A;  3PD9 A;  1JVY A;  3B6T A;  3K6V A;  3EHU A;  2AL4 A;  4DLD A;  1Q35 A;  1B0H A;  3GZG A;  3CSG A;  1URG A;  3I5O A;  5JTY B;  2DE4 A;  2IEE A;  4R6Y A;  1FTM A;  4OEN A;  2O7I A;  5KCJ B;  3IR1 A;  3T9U A;  1NMU A;  2V3Q A;  2PVU A;  3C9H A;  3PUW E;  2YPN A;  5AE4 A;  3MPL A;  2UYE A;  1EZ9 A;  1LAF E;  4GQO A;  4QFL A;  4QSE A;  3LSL A;  3MP1 A;  1QJM A;  3KOS A;  4NF8 A;  5CRY A;  1B6H A;  3QAX A;  3OEN A;  4HS7 A;  5ELV A;  5I84 A;  2F7C A;  1US4 A;  3KOT A;  1IUD A;  1B7Z A;  2F36 A;  4GXA A;  3MZB A;  3ONM A;  4U1O A;  3WAE A;  1Y20 A;  5I2N B;  4NF4 B;  3USD A;  3ILU B;  3E13 X;  4E0W A;  1Y4T A;  3G7W A;  1DPP A;  1ZJL A;  4G77 A;  2HXW A;  3TOD A;  3T96 B;  3QIM A;  5H8N A;  4YKI A;  3IO6 A;  1CE2 A;  4QFN A;  3G3F A;  2QRY A;  1LST A;  1ZBM A;  4ZEC A;  2F6G A;  4NE4 A;  1AIV A;  3EHS A;  2G93 A;  1MPD A;  5AA2 B;  1LCF A;  1DOT A;  3ECR A;  5EYF A;  2Q2C A;  3E9X A;  3THI A;  4AB6 A;  1SBP A;  4EUO A;  3Q25 A;  1SW2 A;  4WEP A;  3QSL A;  4OQO A;  4IY6 A;  5JEI A;  3OEK A;  1B32 A;  4GRK A;  5I56 B;  1FW0 A;  3M8U A;  4LVQ A;  3CRB A;  4FEB A;  3PUV E;  3LSX A;  2PT2 A;  5FTI A;  5CC2 A;  1NNK A;  1IXG A;  1SW1 A;  2ONK E;  1IEJ A;  3BFU A;  2DWI A;  3TUS A;  5H8H A;  1MPB A;  4IB2 A;  4EF1 A;  4IY5 A;  4G8M A;  1S7Y A;  5I58 A;  1LFH A;  3VVF A;  4ESX A;  1A54 A;  3PMX A;  4ELO A;  1PDA A;  3K00 A;  1I69 A;  2CMO A;  4QF9 A;  3U8Q A;  1URD A;  1XT8 A;  3H3G A;  3EQ1 A;  4F3P A;  3W9V A;  4MFI A;  2Z8F A;  1GV8 A;  2X7Q A;  3O28 A;  2NVU B;  4POW A;  3H4Z A;  4ECF A;  3VV5 A;  4M4G A;  3TMG A;  1RYO A;  2DWH A;  4RK9 A;  4ESW A;  2Q88 A;  5I59 B;  5HPQ A;  3RPW A;  4LQ2 A;  2F8D A;  1OMP A;  5TPA B;  1AH5 A;  1MG1 A;  2Q2A A;  3PD8 A;  2I3W A;  4YB7 A;  2I49 A;  1M5C A;  2OK2 A;  2ZNS A;  3Q28 A;  4FE8 A;  4XIG Q;  2HQ0 A;  4X1D A;  3K6W A;  3GLB A;  2QSX A;  3O6I A;  1LLS A;  3DLN A;  3HN0 A;  1LB9 A;  4NWC A;  4DZ1 A;  4C1T A;  1LCT A;  3O97 A;  4RA1 A;  4DXU A;  1Z7N E;  3CFL A;  1ZIU A;  5EHS A;  5IKB A;  2HFB A;  3R26 A;  1Y3P A;  3MJN A;  5JK4 A;  1I6A A;  4HCY A;  4P0G A;  4ELQ A;  3D4C A;  2X26 A;  3FV1 A;  3SDF A;  5A5X B;  2ZYM A;  3IB1 A;  1QVS A;  1B7H A;  1BP5 A;  5ICT A;  3OO7 A;  3K6U A;  5J1D A;  1GVC A;  5H8F A;  2O7U A;  3CIJ A;  2R9J A;  3AXF A;  4I62 A;  3PPP A;  4MBP A;  3U94 A;  4QSD A;  5B7D A;  2DXY A;  4G68 B;  4OYV A;  1OLC A;  4U22 A;  5ICQ A;  3A3C A;  3VXB A;  3IO4 A;  2DE3 A;  1LBB A;  2UYF A;  5DVI A;  1P1N A;  3SKP A;  3VLV A;  3O6G A;  1ZLQ A;  2OCU A;  1TXF A;  4NMY A;  4ZZA A;  4G4P A;  4OEU A;  4YB6 A;  4I8C A;  2HCA A;  2OWT A;  1B5J A;  2QMW A;  2QS3 A;  2DQV A;  1TFA A;  2XHD A;  3OEL A;  3PPR A;  4GWO A;  3HO7 A;  2OWS A;  2XX9 A;  1ZKB A;  1HSL A;  1MXW A;  4MF3 A;  4H5F A;  2RKM A;  1A7L A;  3HHF A;  5FHN A;  4R2F A;  2UVI A;  3TZA A;  4RY1 A;  3T9H B;  4YU0 A;  3BBR A;  1SW5 A;  1ZU0 A;  4FED A;  3N6U A;  1I6B A;  3FD3 A;  2G29 A;  3QYT A;  3CFZ A;  1FTL A;  3T66 A;  5EHM A;  3KBR A;  1J1N A;  4UA8 A;  3H6V A;  3C36 A;  2VD2 A;  3O2A A;  4QHQ A;  2M8C A;  2DP8 A;  1JET A;  3DP8 A;  1A55 A;  4OES A;  4OXV A;  4KFQ A;  2NXO A;  3VFJ A;  1SI0 A;  2NOO A;  4LZ7 A;  1XHY A;  1NFT A;  3BKI B;  3CR9 A;  4KHZ E;  4YKP A;  3FAS A;  1OIB A;  1KWH A;  3ZKK A;  4TQU Q;  3IOR A;  1PB9 A;  1TWY A;  1CB6 A;  2ONR A;  3VDF A;  3S9M C;  1VFD A;  4PFU A;  3RLF E;  1SDX A;  3G3I A;  1OQG A;  4NF4 A;  1MM7 A;  4YKJ A;  2F7B A;  2HZK A;  4XKP A;  4Z0I A;  2A5T B;  2HAU A;  1JQF A;  5AA3 A;  1JW4 A;  1QUJ A;  4YB5 A;  4NED A;  1D9Y A;  2XXI A;  1JVX A;  1IZ1 A;  4NF6 B;  4KPT A;  3DEL B;  1B4H A;  3S9E A;  3RGY A;  4RYA A;  4F39 A;  3T9V A;  1R9L A;  5CBS A;  3U1O A;  2XX8 A;  2ZMB A;  3FIR A;  1B3F A;  3UGW A;  2RC7 A;  2I48 A;  1UTB A;  2ESN A;  3PPQ A;  4F2O A;  1SYH A;  2O68 A;  3IK6 B;  1T0K A;  4NTL A;  4MH5 A;  3SER A;  3VLW A;  5I57 A;  4DE8 A;  2WKY A;  2O6A A;  4FAT A;  5I56 A;  2XXQ A;  3GBA A;  2ZNU A;  2Y84 A;  5LOM A;  2PYY A;  3S9N C;  5L9O A;  4BDM A;  3LBS A;  3VVD A;  4H65 A;  2P2A A;  3TTK A;  3N94 A;  1TFD A;  3ZKL A;  1XC1 A;  1M5E A;  3EHT A;  3C35 A;  2V25 A;  2RC9 A;  3MP6 A;  4G8H A;  1UIV A;  1ATG A;  4AQ4 A;  2X7P A;  3TEL A;  1AL3 A;  2YLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...