4Q35B

Structure of a membrane protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
GWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords LPS-assembly protein LptD
publication title Structural basis for lipopolysaccharide insertion in the bacterial outer membrane
doi rcsb
source organism Shigella flexneri
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4q35B00
5IXMB 4RHBB 4KWYA 5TSEA 2JXPA 2N8XA 4RH8A 5IV8B 4N4RB 4NHRA 4Q35B 2R76A 3BF2A
chains in the Genus database with same CATH superfamily
2EMKA 2CT1A 3UK3C 3EPJA 1EKZA 4LF9E 4JI8E 1LLMC 2I13A 2B9DA 2FV4B 2EM8A 4L8NA 2EN8A 3C6MA 4LF7E 1GQEA 4JI6E 2DSYA 1EH7A 2B7VA 4WXCA 2EN1A 2YTFA 5DNYA 4OX9E 4B3TE 2LE2A 2WBSA 5KL5A 2ELYA 1QU6A 2VRDA 2WZOA 2E5LE 1EH8A 4GZNC 3HPZA 5FLXC 2B3TB 5KL7A 1HNXE 1B69A 2EOZA 2EPRA 4B3RE 4IJDA 4DV3E 4NXNE 1IBME 1TF3A 4BHCA 1UN6B 2YRHA 2EOYA 3OMLA 3C6KA 4HTGA 2EMWA 1QNTA 2ELZA 5IV8B 2EN4A 1UILA 1ZU1A 2V89A 2EOSA 4MLVA 1GZ6A 2FTXB 2KHXA 2EMAA 3QG5C 1UHZA 3VK6A 4F6NA 3LMLA 1A1HA 2KONA 1HNZE 4IS1C 1YUJA 2MDGA 3C4TA 1XMOE 5CFFE 3KZYA 1ZR9A 1X47A 1XNRE 2DRPA 2RSIA 5A6BD 5TSEA 1WHQA 4M2ZA 2YTNA 4O24A 4JI0E 3DF6A 3ZOQB 2EMGA 1IBKE 3ADGA 2ODRC 3OTOE 4DUZE 1BB8A 2LO3A 4GKKE 4YHHE 4RH8A 1IQOA 1HNWE 3KZZA 4X62E 3F6HA 2YTPA 1YYOA 1X6FA 2DIXA 2L33A 2N3HA 2A25A 2EPOA 3T1HE 2YTQA 4ZYGA 4LU9A 2V87A 5A6BA 4DR3E 2EN6A 2DB2A 1G2DC 5LMUE 1YFHA 1KJKA 2EM2A 2RSMA 5LL6R 1HR0E 4JI4E 2EOQA 2WBUA 2CPNA 3DJWA 2V83A 3VYYA 4OOGC 4TUGA 2RPCA 3BBGA 3HPSA 4KWYA 3ADLA 3EQ1A 2EN3A 1X5WA 3THNA 2EJ4A 4DV7E 3ECRA 2L8TA 4R2CA 4DV4E 5KL2A 1X6HA 2GHFA 2HHHE 3M99B 2UUAE 2F8BA 3BIDA 2EWLA 3L00A 2CSHA 4DR6E 1DQ3A 2E1MA 2LJUA 4L5NC 1IBLE 2EM9A 4WXDA 2CTDA 1PJTA 4DMIA 1N3GA 1AH5A 2EZ6A 2EE8A 1MEYC 4F54A 2VQFE 4HEIA 2ENCA 2BB8A 2DMIA 4YY3E 3J80C 2EOXA 1Z1BA 2M4IA 1WXRA 3BGHA 2EQ3A 2NA2A 2JPAA 2EPLX 4WSGA 4X65E 2VQEE 1X49A 2DMYA 4MLQA 2EQ1A 1JK1A 1RQ0A 2YTIA 2EPXA 1ZBQA 1PJQA 2V85A 2PRTA 1XMQE 1X3CA 2VF1A 5AE2A 1NEIA 3IWCA 4J8ZA 4R2DA 5KL3A 4BHBA 2EM4A 3T1YE 1A1LA 2NUFA 4LF4E 1N32E 3HXLA 2EPPA 2DLKA 2JVAA 2ENAA 4DV1E 1J26A 4DR7E 5AC5A 2L3JA 1J5EE 1I94E 1PJSA 2YTDA 1JK2A 2L92A 1GTKA 4LFBE 1N36E 2V8QB 2ENHA 4JV5E 1RMDA 4R2EA 2M1SA 1FKAE 3LLHA 2EM6A 2DGCA 2EM5A 2JOXA 2EORA 5KL4A 3C4BA 1SFEA 1XNQE 4KZSA 1SR9A 2EM0A 2JWOA 4DUYE 1TF6A 4LFCE 2JXPA 2EMHA 3P1XA 2EPNA 2KOUA 2NUGA 2YPNA 2EPKX 2R1FA 3F6GA 3VYXA 1FJGE 2EL5A 2EL6A 2JYAA 4NHRA 1YUIA 3H09A 4B3ME 4R2AA 4FK5C 1WJPA 4LF6E 1L4SA 4Q35B 4P7DA 4X64E 4X9JA 4GKJE 1NCSA 5A6KA 1WHNA 4ZYHA 2ODRD 4WFTA 1G2FC 2EPZA 2YTJA 3K6QA 5AE3A 2LBSB 4M0VA 1X6EA 2HC5A 2JOBA 4DV5E 2EOOA 2LVHA 2EMFA 2LMZA 2EM7A 2RQLA 2LCEA 1KYQA 2MKDA 2IHR1 1P47A 1UBDC 4ZYEA 4DKKA 5KL6A 3JTZA 2EMBA 2I9IA 2MDRA 2LTRA 4LF8E 4DR4E 4DR2E 2EMIA 4BS9A 2WCC3 2EN7A 2BBGA 3THOB 2LT7A 2L3CA 2D9HA 2VE7C 4KHPE 1F2IG 3EPHA 2LUQA 1BBOA 1YPNA 2L6MA 2EP3A 4LTYA 4DV6E 2YTGA 1A1IA 2F4VE 1T4LB 4JI7E 2EOJA 2LJHA 4BC7A 4JI1E 1N34E 2EM3A 1EH6A 2EL4A 3MSWA 3HTXA 2UUBE 2L2MA 5ADZA 2FGGA 5AE1A 4LFAE 2EQ0A 2J7JA 1A1JA 5A6AA 2LV2A 1WRJA 2GLIA 4GEQB 1X48A 2L2NA 4F9BB 2DLQA 3HQ1A 2EMCA 1T39A 1PDAA 2YSPA 4BC9A 2YTOA 2EOHA 2YU5A 4P78A 2ZM6E 4BBYA 1T38A 2RS6A 4DR5E 4ZYDA 2MC5A 2K4VA 2MC6A 2EPUA 3AV0A 4O4KA 1O0WA 2LRSA 2NUEA 2YRKA 2LUPB 2UXCE 2YZTA 2YSOA 4B3SE 4K0KE 2HGHA 1MGTA 4JI3E 2EOEA 2HJJA 3VHTB 1DGCA 2UUCE 2YU8A 3MHSC 1BBGA 4WPYA 4F9CB 2H36X 2EN2A 1AAYA 1A1GA 1ZAAC 1A1FA 3BF2A 4R2RA 1DI2A 1T4NA 2LTSA 4JYAE 5T6JA 4BMJA 2RS7A 3EPKA 2GPIA 2EPCA 4I8OA 4X8WA 4Q28A 5IT9C 2EMXA 5F3WA 2UXBE 2EMYA 2YTEA 4BCAA 2N8XA 2UU9E 2YWQA 3J7AG 1ZBTA 2B7TA 3EPLA 4F6MA 2EOIA 2E72A 2JY9A 1IMUA 3ADJA 2RTXA 2WBTA 3IWBA 4NZVA 2EMZA 2G7HA 3TQMA 1A1KA 5AASA 2V86A 4M9VC 4DV0E 4R2QA 4N4RB 1RC7A 2EOMA 3FIGA 2R76A 5BR8E 3KWRA 3IWDA 2N3GA 2MKNA 4R2SA 4O43A 4WSPA 5LMNE 1N33E 1YYKA 2V88A 2ADRA 4JI2E 2JR1A 1IQSA 4WYQB 1YSAC 1PKPA 1YYWA 4R2PA 4DV2E 1TN9A 3MHHC 4RHBB 2M7QA 4F2JC 3RMPA 2EPAA 4O5GA 4M30A 2Q8UA 2EOFA 2YRMA 4X66E 3J7Yp 5IWAE 2NABA 2L2KB 3ADIA 2EPMX 4R03A 3AUZA 5A69A 5IXMB 4TUIA 4JI5E 2UXDE 4DR1E 2M9AA 1YZ9A 5AC4A 4NXME 5LLQA 4WX9A 2EMLA 2JP9A 2YT4A 4LF5E 3JU0A 5A6JA 3JAMC 2K7IA 1STUA 4R8OA 4AQYE 5A2QC 1T4OA 4F9AB 3J81C
chains in the Genus database with same CATH topology
5IXMB 4RHBB 4KWYA 5TSEA 2JXPA 2N8XA 4RH8A 5IV8B 4N4RB 4NHRA 4Q35B 2R76A 3BF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IXM B;  4RHB B;  4KWY A;  5TSE A;  2JXP A;  2N8X A;  4RH8 A;  5IV8 B;  4N4R B;  4NHR A;  4Q35 B;  2R76 A;  3BF2 A; 
#chains in the Genus database with same CATH topology
 2EMK A;  2CT1 A;  3UK3 C;  3EPJ A;  1EKZ A;  4LF9 E;  4JI8 E;  1LLM C;  2I13 A;  2B9D A;  2FV4 B;  2EM8 A;  4L8N A;  2EN8 A;  3C6M A;  4LF7 E;  1GQE A;  4JI6 E;  2DSY A;  1EH7 A;  2B7V A;  4WXC A;  2EN1 A;  2YTF A;  5DNY A;  4OX9 E;  4B3T E;  2LE2 A;  2WBS A;  5KL5 A;  2ELY A;  1QU6 A;  2VRD A;  2WZO A;  2E5L E;  1EH8 A;  4GZN C;  3HPZ A;  5FLX C;  2B3T B;  5KL7 A;  1HNX E;  1B69 A;  2EOZ A;  2EPR A;  4B3R E;  4IJD A;  4DV3 E;  4NXN E;  1IBM E;  1TF3 A;  4BHC A;  1UN6 B;  2YRH A;  2EOY A;  3OML A;  3C6K A;  4HTG A;  2EMW A;  1QNT A;  2ELZ A;  5IV8 B;  2EN4 A;  1UIL A;  1ZU1 A;  2V89 A;  2EOS A;  4MLV A;  1GZ6 A;  2FTX B;  2KHX A;  2EMA A;  3QG5 C;  1UHZ A;  3VK6 A;  4F6N A;  3LML A;  1A1H A;  2KON A;  1HNZ E;  4IS1 C;  1YUJ A;  2MDG A;  3C4T A;  1XMO E;  5CFF E;  3KZY A;  1ZR9 A;  1X47 A;  1XNR E;  2DRP A;  2RSI A;  5A6B D;  5TSE A;  1WHQ A;  4M2Z A;  2YTN A;  4O24 A;  4JI0 E;  3DF6 A;  3ZOQ B;  2EMG A;  1IBK E;  3ADG A;  2ODR C;  3OTO E;  4DUZ E;  1BB8 A;  2LO3 A;  4GKK E;  4YHH E;  4RH8 A;  1IQO A;  1HNW E;  3KZZ A;  4X62 E;  3F6H A;  2YTP A;  1YYO A;  1X6F A;  2DIX A;  2L33 A;  2N3H A;  2A25 A;  2EPO A;  3T1H E;  2YTQ A;  4ZYG A;  4LU9 A;  2V87 A;  5A6B A;  4DR3 E;  2EN6 A;  2DB2 A;  1G2D C;  5LMU E;  1YFH A;  1KJK A;  2EM2 A;  2RSM A;  5LL6 R;  1HR0 E;  4JI4 E;  2EOQ A;  2WBU A;  2CPN A;  3DJW A;  2V83 A;  3VYY A;  4OOG C;  4TUG A;  2RPC A;  3BBG A;  3HPS A;  4KWY A;  3ADL A;  3EQ1 A;  2EN3 A;  1X5W A;  3THN A;  2EJ4 A;  4DV7 E;  3ECR A;  2L8T A;  4R2C A;  4DV4 E;  5KL2 A;  1X6H A;  2GHF A;  2HHH E;  3M99 B;  2UUA E;  2F8B A;  3BID A;  2EWL A;  3L00 A;  2CSH A;  4DR6 E;  1DQ3 A;  2E1M A;  2LJU A;  4L5N C;  1IBL E;  2EM9 A;  4WXD A;  2CTD A;  1PJT A;  4DMI A;  1N3G A;  1AH5 A;  2EZ6 A;  2EE8 A;  1MEY C;  4F54 A;  2VQF E;  4HEI A;  2ENC A;  2BB8 A;  2DMI A;  4YY3 E;  3J80 C;  2EOX A;  1Z1B A;  2M4I A;  1WXR A;  3BGH A;  2EQ3 A;  2NA2 A;  2JPA A;  2EPL X;  4WSG A;  4X65 E;  2VQE E;  1X49 A;  2DMY A;  4MLQ A;  2EQ1 A;  1JK1 A;  1RQ0 A;  2YTI A;  2EPX A;  1ZBQ A;  1PJQ A;  2V85 A;  2PRT A;  1XMQ E;  1X3C A;  2VF1 A;  5AE2 A;  1NEI A;  3IWC A;  4J8Z A;  4R2D A;  5KL3 A;  4BHB A;  2EM4 A;  3T1Y E;  1A1L A;  2NUF A;  4LF4 E;  1N32 E;  3HXL A;  2EPP A;  2DLK A;  2JVA A;  2ENA A;  4DV1 E;  1J26 A;  4DR7 E;  5AC5 A;  2L3J A;  1J5E E;  1I94 E;  1PJS A;  2YTD A;  1JK2 A;  2L92 A;  1GTK A;  4LFB E;  1N36 E;  2V8Q B;  2ENH A;  4JV5 E;  1RMD A;  4R2E A;  2M1S A;  1FKA E;  3LLH A;  2EM6 A;  2DGC A;  2EM5 A;  2JOX A;  2EOR A;  5KL4 A;  3C4B A;  1SFE A;  1XNQ E;  4KZS A;  1SR9 A;  2EM0 A;  2JWO A;  4DUY E;  1TF6 A;  4LFC E;  2JXP A;  2EMH A;  3P1X A;  2EPN A;  2KOU A;  2NUG A;  2YPN A;  2EPK X;  2R1F A;  3F6G A;  3VYX A;  1FJG E;  2EL5 A;  2EL6 A;  2JYA A;  4NHR A;  1YUI A;  3H09 A;  4B3M E;  4R2A A;  4FK5 C;  1WJP A;  4LF6 E;  1L4S A;  4Q35 B;  4P7D A;  4X64 E;  4X9J A;  4GKJ E;  1NCS A;  5A6K A;  1WHN A;  4ZYH A;  2ODR D;  4WFT A;  1G2F C;  2EPZ A;  2YTJ A;  3K6Q A;  5AE3 A;  2LBS B;  4M0V A;  1X6E A;  2HC5 A;  2JOB A;  4DV5 E;  2EOO A;  2LVH A;  2EMF A;  2LMZ A;  2EM7 A;  2RQL A;  2LCE A;  1KYQ A;  2MKD A;  2IHR 1;  1P47 A;  1UBD C;  4ZYE A;  4DKK A;  5KL6 A;  3JTZ A;  2EMB A;  2I9I A;  2MDR A;  2LTR A;  4LF8 E;  4DR4 E;  4DR2 E;  2EMI A;  4BS9 A;  2WCC 3;  2EN7 A;  2BBG A;  3THO B;  2LT7 A;  2L3C A;  2D9H A;  2VE7 C;  4KHP E;  1F2I G;  3EPH A;  2LUQ A;  1BBO A;  1YPN A;  2L6M A;  2EP3 A;  4LTY A;  4DV6 E;  2YTG A;  1A1I A;  2F4V E;  1T4L B;  4JI7 E;  2EOJ A;  2LJH A;  4BC7 A;  4JI1 E;  1N34 E;  2EM3 A;  1EH6 A;  2EL4 A;  3MSW A;  3HTX A;  2UUB E;  2L2M A;  5ADZ A;  2FGG A;  5AE1 A;  4LFA E;  2EQ0 A;  2J7J A;  1A1J A;  5A6A A;  2LV2 A;  1WRJ A;  2GLI A;  4GEQ B;  1X48 A;  2L2N A;  4F9B B;  2DLQ A;  3HQ1 A;  2EMC A;  1T39 A;  1PDA A;  2YSP A;  4BC9 A;  2YTO A;  2EOH A;  2YU5 A;  4P78 A;  2ZM6 E;  4BBY A;  1T38 A;  2RS6 A;  4DR5 E;  4ZYD A;  2MC5 A;  2K4V A;  2MC6 A;  2EPU A;  3AV0 A;  4O4K A;  1O0W A;  2LRS A;  2NUE A;  2YRK A;  2LUP B;  2UXC E;  2YZT A;  2YSO A;  4B3S E;  4K0K E;  2HGH A;  1MGT A;  4JI3 E;  2EOE A;  2HJJ A;  3VHT B;  1DGC A;  2UUC E;  2YU8 A;  3MHS C;  1BBG A;  4WPY A;  4F9C B;  2H36 X;  2EN2 A;  1AAY A;  1A1G A;  1ZAA C;  1A1F A;  3BF2 A;  4R2R A;  1DI2 A;  1T4N A;  2LTS A;  4JYA E;  5T6J A;  4BMJ A;  2RS7 A;  3EPK A;  2GPI A;  2EPC A;  4I8O A;  4X8W A;  4Q28 A;  5IT9 C;  2EMX A;  5F3W A;  2UXB E;  2EMY A;  2YTE A;  4BCA A;  2N8X A;  2UU9 E;  2YWQ A;  3J7A G;  1ZBT A;  2B7T A;  3EPL A;  4F6M A;  2EOI A;  2E72 A;  2JY9 A;  1IMU A;  3ADJ A;  2RTX A;  2WBT A;  3IWB A;  4NZV A;  2EMZ A;  2G7H A;  3TQM A;  1A1K A;  5AAS A;  2V86 A;  4M9V C;  4DV0 E;  4R2Q A;  4N4R B;  1RC7 A;  2EOM A;  3FIG A;  2R76 A;  5BR8 E;  3KWR A;  3IWD A;  2N3G A;  2MKN A;  4R2S A;  4O43 A;  4WSP A;  5LMN E;  1N33 E;  1YYK A;  2V88 A;  2ADR A;  4JI2 E;  2JR1 A;  1IQS A;  4WYQ B;  1YSA C;  1PKP A;  1YYW A;  4R2P A;  4DV2 E;  1TN9 A;  3MHH C;  4RHB B;  2M7Q A;  4F2J C;  3RMP A;  2EPA A;  4O5G A;  4M30 A;  2Q8U A;  2EOF A;  2YRM A;  4X66 E;  3J7Y p;  5IWA E;  2NAB A;  2L2K B;  3ADI A;  2EPM X;  4R03 A;  3AUZ A;  5A69 A;  5IXM B;  4TUI A;  4JI5 E;  2UXD E;  4DR1 E;  2M9A A;  1YZ9 A;  5AC4 A;  4NXM E;  5LLQ A;  4WX9 A;  2EML A;  2JP9 A;  2YT4 A;  4LF5 E;  3JU0 A;  5A6J A;  3JAM C;  2K7I A;  1STU A;  4R8O A;  4AQY E;  5A2Q C;  1T4O A;  4F9A B;  3J81 C; 
#chains in the Genus database with same CATH homology
 5IXM B;  4RHB B;  4KWY A;  5TSE A;  2JXP A;  2N8X A;  4RH8 A;  5IV8 B;  4N4R B;  4NHR A;  4Q35 B;  2R76 A;  3BF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...