4Q35B

Structure of a membrane protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
GWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly protein LptD
publication title Structural basis for lipopolysaccharide insertion in the bacterial outer membrane
doi rcsb
source organism Shigella flexneri
molecule tags Membrane protein
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4q35B00
5IXMB 4N4RB 4Q35B 4KWYA 5TSEA 5IV8B 2JXPA 3BF2A 4NHRA 2R76A 4RH8A 4RHBB 2N8XA
chains in the Genus database with same CATH superfamily
1SFEA 4WYQB 3HQ1A 2EMYA 4I8OA 5LL6R 1A1GA 4R2EA 4ZYDA 1YYOA 2YRHA 2UXCE 1BBGA 3HXLA 4R2AA 4DV1E 2EZ6A 4DR5E 2RSIA 4LF9E 4LTYA 4F6NA 3T1HE 4DV0E 2EMXA 4BBYA 2YTGA 1J5EE 3IWBA 1PJQA 1A1JA 1NCSA 1A1HA 2EMGA 2YSPA 4LFAE 4M0VA 2ODRC 4R2QA 4DR2E 1T39A 5LMNE 2EM0A 2EN3A 2LVHA 4NXME 2EPNA 2RPCA 4R2SA 3AUZA 4BMJA 2YRKA 2EPLX 5A6BD 2EMKA 2LTRA 2LBSB 4R2CA 1PJTA 2EMZA 2VRDA 4X62E 5A69A 3VYYA 4DV6E 3C6MA 2V85A 1X48A 2EN4A 3BIDA 3THNA 3T1YE 2FTXB 3KZZA 4BHCA 1JK2A 2NUEA 2EN6A 2L2KB 1X6EA 5AE2A 1PDAA 4LU9A 2EM4A 3LMLA 1T4NA 3J80C 2EM6A 2DSYA 3MHSC 1HNXE 1EH8A 2EL4A 4B3TE 5AC5A 2EPOA 2LMZA 2JR1A 1UBDC 5AE1A 1QU6A 2LO3A 4P7DA 1DGCA 4KWYA 5LLQA 1RMDA 2JP9A 2YTNA 4JI8E 4JI1E 5AE3A 4DUYE 5A6JA 2VF1A 1IBKE 2EMWA 3HPZA 5AC4A 1WXRA 2L8TA 1ZBQA 2EM7A 2EN7A 2EOSA 4TUGA 1A1KA 2NABA 2JPAA 2I13A 3C6KA 4B3RE 1YPNA 5DNYA 1FKAE 1X6HA 4P78A 4DV4E 1XMOE 2YPNA 2UXBE 2EOHA 2EOMA 4RHBB 3ZOQB 1YYWA 4K0KE 2LRSA 2BB8A 4Q28A 4JI6E 2FV4B 4J8ZA 1QNTA 2HGHA 4DV7E 2EOOA 2EOIA 2YZTA 4DV3E 3F6GA 1X5WA 2B7TA 3ADLA 1YFHA 2RS6A 4LF5E 2B9DA 3P1XA 5A6KA 2EL6A 2L3JA 4LFCE 4F9BB 2UUCE 2K4VA 1XNQE 4MLQA 1MGTA 4JYAE 1UN6B 3J81C 4GZNC 1X47A 2YTDA 2LCEA 4B3SE 3VK6A 2CTDA 4JI0E 1HR0E 1X6FA 4GKKE 2YSOA 2YTPA 5BR8E 4DR3E 3ADGA 2N3GA 2E5LE 1F2IG 2GPIA 2KHXA 2EOZA 2GLIA 2JYAA 2EQ1A 3EQ1A 3MSWA 2RQLA 5T6JA 2G7HA 2YTOA 3AV0A 3HPSA 2EPXA 2EORA 5ADZA 1EH6A 2EPPA 1YYKA 1ZU1A 4BHBA 4O4KA 3ADJA 2EM8A 1N32E 2CSHA 2HJJA 2N8XA 2YT4A 2R76A 4IJDA 3UK3C 2V8QB 1TN9A 5IWAE 4WXCA 2UUAE 2K7IA 1XMQE 5IT9C 2N3HA 4DR6E 1L4SA 4F6MA 2VE7C 4JV5E 2EPCA 3DF6A 2J7JA 2Q8UA 1SR9A 2YTEA 2VQEE 2V89A 4GEQB 2YRMA 4L5NC 2WCC3 4JI3E 2EPMX 4O43A 4R2RA 4NZVA 1YSAC 2EWLA 2EMAA 5A6AA 1AAYA 2M1SA 2YU8A 3MHHC 1DI2A 3IWCA 2EPUA 5FLXC 5TSEA 2RTXA 2V83A 4M30A 4GKJE 2ODRD 1HNZE 4HTGA 5LMUE 2ENHA 4F9CB 4KZSA 2M7QA 2BBGA 2E72A 2EM2A 2NA2A 2L33A 4X66E 2UXDE 3FIGA 1YZ9A 1N33E 4F2JC 4DR7E 2EOYA 2EPRA 4DUZE 2ZM6E 4LF8E 2ELZA 1P47A 2DRPA 3THOB 1WJPA 2L3CA 2HHHE 1G2FC 2L2MA 3EPLA 4DR4E 2IHR1 4LF7E 3BBGA 2NUGA 2YWQA 5AASA 2EP3A 2EPZA 4TUIA 1KYQA 2EN1A 2M9AA 4X8WA 2L6MA 4B3ME 2MKNA 3LLHA 2LJHA 2LUQA 1A1FA 1LLMC 1GZ6A 3EPJA 2YTIA 4WSPA 2V87A 1KJKA 4HEIA 2EM9A 4Q35B 4BCAA 2A25A 4AQYE 4O24A 2WBSA 5F3WA 1JK1A 1STUA 2L2NA 1X3CA 4FK5C 5CFFE 1IBLE 2EOJA 3ECRA 3OTOE 3EPHA 5IV8B 4DR1E 4BC7A 1HNWE 2EMIA 5KL3A 4WFTA 1GTKA 5KL5A 4WPYA 2DLKA 2HC5A 2LE2A 4OOGC 1PKPA 1MEYC 4ZYEA 2ENCA 4DV5E 2LV2A 1AH5A 1X49A 2MC5A 2WZOA 4KHPE 3C4BA 2KOUA 2MDRA 1J26A 2F8BA 5KL6A 4LFBE 2EOFA 4JI5E 2YTFA 4LF4E 2EPAA 3JU0A 1T38A 2EQ0A 3H09A 4R2PA 2EQ3A 2EOQA 2RS7A 4O5GA 3VYXA 2EMCA 1ZR9A 1GQEA 1UHZA 4R2DA 3J7AG 4IS1C 4JI4E 4F54A 3ADIA 1WHQA 2JOBA 2M4IA 4BC9A 4NXNE 2DB2A 4WXDA 2JWOA 2EOXA 4X65E 4X64E 2EOEA 2L92A 1T4LB 3L00A 2CT1A 1TF3A 2EMHA 1G2DC 4ZYHA 3QG5C 1EKZA 3VHTB 1YUJA 4R8OA 2CPNA 2DMIA 4DKKA 2UUBE 2MDGA 3M99B 2EM5A 4M9VC 1WHNA 3C4TA 2EN2A 4YHHE 2GHFA 2DLQA 1BB8A 2KONA 3BF2A 2MKDA 1TF6A 2JOXA 5A6BA 3HTXA 3RMPA 1T4OA 2NUFA 1A1IA 1ZAAC 4R03A 4LF6E 2EMFA 2MC6A 3BGHA 1UILA 1A1LA 1NEIA 1WRJA 4WSGA 2V86A 3K6QA 4NHRA 4RH8A 5A2QC 1IMUA 2EPKX 1Z1BA 1RC7A 2JXPA 2LUPB 4JI2E 2VQFE 4WX9A 5KL4A 4DMIA 2UU9E 2F4VE 2FGGA 4YY3E 2H36X 2V88A 1DQ3A 4JI7E 3DJWA 1N34E 2EM3A 2LT7A 1EH7A 1BBOA 1I94E 2ENAA 1XNRE 2B3TB 2DIXA 4OX9E 2JVAA 2E1MA 4DV2E 2EL5A 2YU5A 1IQOA 2D9HA 2ADRA 2WBTA 1IBME 2ELYA 5KL2A 1PJSA 3JTZA 3KWRA 3OMLA 5KL7A 2LJUA 1N3GA 2B7VA 4F9AB 2JY9A 1RQ0A 2R1FA 2RSMA 4MLVA 2WBUA 3IWDA 2LTSA 3J7Yp 2DGCA 4ZYGA 3F6HA 3EPKA 2DMYA 1FJGE 2EMLA 1O0WA 5IXMB 3KZYA 2YTQA 1B69A 4BS9A 3JAMC 1YUIA 1IQSA 2EN8A 1ZBTA 2EJ4A 4M2ZA 2I9IA 2EE8A 2EMBA 1N36E 4L8NA 4N4RB 2YTJA 3TQMA 2PRTA 4X9JA
chains in the Genus database with same CATH topology
5IXMB 4N4RB 4Q35B 4KWYA 5TSEA 5IV8B 2JXPA 3BF2A 4NHRA 2R76A 4RH8A 4RHBB 2N8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IXM B;  4N4R B;  4Q35 B;  4KWY A;  5TSE A;  5IV8 B;  2JXP A;  3BF2 A;  4NHR A;  2R76 A;  4RH8 A;  4RHB B;  2N8X A; 
#chains in the Genus database with same CATH topology
 1SFE A;  4WYQ B;  3HQ1 A;  2EMY A;  4I8O A;  5LL6 R;  1A1G A;  4R2E A;  4ZYD A;  1YYO A;  2YRH A;  2UXC E;  1BBG A;  3HXL A;  4R2A A;  4DV1 E;  2EZ6 A;  4DR5 E;  2RSI A;  4LF9 E;  4LTY A;  4F6N A;  3T1H E;  4DV0 E;  2EMX A;  4BBY A;  2YTG A;  1J5E E;  3IWB A;  1PJQ A;  1A1J A;  1NCS A;  1A1H A;  2EMG A;  2YSP A;  4LFA E;  4M0V A;  2ODR C;  4R2Q A;  4DR2 E;  1T39 A;  5LMN E;  2EM0 A;  2EN3 A;  2LVH A;  4NXM E;  2EPN A;  2RPC A;  4R2S A;  3AUZ A;  4BMJ A;  2YRK A;  2EPL X;  5A6B D;  2EMK A;  2LTR A;  2LBS B;  4R2C A;  1PJT A;  2EMZ A;  2VRD A;  4X62 E;  5A69 A;  3VYY A;  4DV6 E;  3C6M A;  2V85 A;  1X48 A;  2EN4 A;  3BID A;  3THN A;  3T1Y E;  2FTX B;  3KZZ A;  4BHC A;  1JK2 A;  2NUE A;  2EN6 A;  2L2K B;  1X6E A;  5AE2 A;  1PDA A;  4LU9 A;  2EM4 A;  3LML A;  1T4N A;  3J80 C;  2EM6 A;  2DSY A;  3MHS C;  1HNX E;  1EH8 A;  2EL4 A;  4B3T E;  5AC5 A;  2EPO A;  2LMZ A;  2JR1 A;  1UBD C;  5AE1 A;  1QU6 A;  2LO3 A;  4P7D A;  1DGC A;  4KWY A;  5LLQ A;  1RMD A;  2JP9 A;  2YTN A;  4JI8 E;  4JI1 E;  5AE3 A;  4DUY E;  5A6J A;  2VF1 A;  1IBK E;  2EMW A;  3HPZ A;  5AC4 A;  1WXR A;  2L8T A;  1ZBQ A;  2EM7 A;  2EN7 A;  2EOS A;  4TUG A;  1A1K A;  2NAB A;  2JPA A;  2I13 A;  3C6K A;  4B3R E;  1YPN A;  5DNY A;  1FKA E;  1X6H A;  4P78 A;  4DV4 E;  1XMO E;  2YPN A;  2UXB E;  2EOH A;  2EOM A;  4RHB B;  3ZOQ B;  1YYW A;  4K0K E;  2LRS A;  2BB8 A;  4Q28 A;  4JI6 E;  2FV4 B;  4J8Z A;  1QNT A;  2HGH A;  4DV7 E;  2EOO A;  2EOI A;  2YZT A;  4DV3 E;  3F6G A;  1X5W A;  2B7T A;  3ADL A;  1YFH A;  2RS6 A;  4LF5 E;  2B9D A;  3P1X A;  5A6K A;  2EL6 A;  2L3J A;  4LFC E;  4F9B B;  2UUC E;  2K4V A;  1XNQ E;  4MLQ A;  1MGT A;  4JYA E;  1UN6 B;  3J81 C;  4GZN C;  1X47 A;  2YTD A;  2LCE A;  4B3S E;  3VK6 A;  2CTD A;  4JI0 E;  1HR0 E;  1X6F A;  4GKK E;  2YSO A;  2YTP A;  5BR8 E;  4DR3 E;  3ADG A;  2N3G A;  2E5L E;  1F2I G;  2GPI A;  2KHX A;  2EOZ A;  2GLI A;  2JYA A;  2EQ1 A;  3EQ1 A;  3MSW A;  2RQL A;  5T6J A;  2G7H A;  2YTO A;  3AV0 A;  3HPS A;  2EPX A;  2EOR A;  5ADZ A;  1EH6 A;  2EPP A;  1YYK A;  1ZU1 A;  4BHB A;  4O4K A;  3ADJ A;  2EM8 A;  1N32 E;  2CSH A;  2HJJ A;  2N8X A;  2YT4 A;  2R76 A;  4IJD A;  3UK3 C;  2V8Q B;  1TN9 A;  5IWA E;  4WXC A;  2UUA E;  2K7I A;  1XMQ E;  5IT9 C;  2N3H A;  4DR6 E;  1L4S A;  4F6M A;  2VE7 C;  4JV5 E;  2EPC A;  3DF6 A;  2J7J A;  2Q8U A;  1SR9 A;  2YTE A;  2VQE E;  2V89 A;  4GEQ B;  2YRM A;  4L5N C;  2WCC 3;  4JI3 E;  2EPM X;  4O43 A;  4R2R A;  4NZV A;  1YSA C;  2EWL A;  2EMA A;  5A6A A;  1AAY A;  2M1S A;  2YU8 A;  3MHH C;  1DI2 A;  3IWC A;  2EPU A;  5FLX C;  5TSE A;  2RTX A;  2V83 A;  4M30 A;  4GKJ E;  2ODR D;  1HNZ E;  4HTG A;  5LMU E;  2ENH A;  4F9C B;  4KZS A;  2M7Q A;  2BBG A;  2E72 A;  2EM2 A;  2NA2 A;  2L33 A;  4X66 E;  2UXD E;  3FIG A;  1YZ9 A;  1N33 E;  4F2J C;  4DR7 E;  2EOY A;  2EPR A;  4DUZ E;  2ZM6 E;  4LF8 E;  2ELZ A;  1P47 A;  2DRP A;  3THO B;  1WJP A;  2L3C A;  2HHH E;  1G2F C;  2L2M A;  3EPL A;  4DR4 E;  2IHR 1;  4LF7 E;  3BBG A;  2NUG A;  2YWQ A;  5AAS A;  2EP3 A;  2EPZ A;  4TUI A;  1KYQ A;  2EN1 A;  2M9A A;  4X8W A;  2L6M A;  4B3M E;  2MKN A;  3LLH A;  2LJH A;  2LUQ A;  1A1F A;  1LLM C;  1GZ6 A;  3EPJ A;  2YTI A;  4WSP A;  2V87 A;  1KJK A;  4HEI A;  2EM9 A;  4Q35 B;  4BCA A;  2A25 A;  4AQY E;  4O24 A;  2WBS A;  5F3W A;  1JK1 A;  1STU A;  2L2N A;  1X3C A;  4FK5 C;  5CFF E;  1IBL E;  2EOJ A;  3ECR A;  3OTO E;  3EPH A;  5IV8 B;  4DR1 E;  4BC7 A;  1HNW E;  2EMI A;  5KL3 A;  4WFT A;  1GTK A;  5KL5 A;  4WPY A;  2DLK A;  2HC5 A;  2LE2 A;  4OOG C;  1PKP A;  1MEY C;  4ZYE A;  2ENC A;  4DV5 E;  2LV2 A;  1AH5 A;  1X49 A;  2MC5 A;  2WZO A;  4KHP E;  3C4B A;  2KOU A;  2MDR A;  1J26 A;  2F8B A;  5KL6 A;  4LFB E;  2EOF A;  4JI5 E;  2YTF A;  4LF4 E;  2EPA A;  3JU0 A;  1T38 A;  2EQ0 A;  3H09 A;  4R2P A;  2EQ3 A;  2EOQ A;  2RS7 A;  4O5G A;  3VYX A;  2EMC A;  1ZR9 A;  1GQE A;  1UHZ A;  4R2D A;  3J7A G;  4IS1 C;  4JI4 E;  4F54 A;  3ADI A;  1WHQ A;  2JOB A;  2M4I A;  4BC9 A;  4NXN E;  2DB2 A;  4WXD A;  2JWO A;  2EOX A;  4X65 E;  4X64 E;  2EOE A;  2L92 A;  1T4L B;  3L00 A;  2CT1 A;  1TF3 A;  2EMH A;  1G2D C;  4ZYH A;  3QG5 C;  1EKZ A;  3VHT B;  1YUJ A;  4R8O A;  2CPN A;  2DMI A;  4DKK A;  2UUB E;  2MDG A;  3M99 B;  2EM5 A;  4M9V C;  1WHN A;  3C4T A;  2EN2 A;  4YHH E;  2GHF A;  2DLQ A;  1BB8 A;  2KON A;  3BF2 A;  2MKD A;  1TF6 A;  2JOX A;  5A6B A;  3HTX A;  3RMP A;  1T4O A;  2NUF A;  1A1I A;  1ZAA C;  4R03 A;  4LF6 E;  2EMF A;  2MC6 A;  3BGH A;  1UIL A;  1A1L A;  1NEI A;  1WRJ A;  4WSG A;  2V86 A;  3K6Q A;  4NHR A;  4RH8 A;  5A2Q C;  1IMU A;  2EPK X;  1Z1B A;  1RC7 A;  2JXP A;  2LUP B;  4JI2 E;  2VQF E;  4WX9 A;  5KL4 A;  4DMI A;  2UU9 E;  2F4V E;  2FGG A;  4YY3 E;  2H36 X;  2V88 A;  1DQ3 A;  4JI7 E;  3DJW A;  1N34 E;  2EM3 A;  2LT7 A;  1EH7 A;  1BBO A;  1I94 E;  2ENA A;  1XNR E;  2B3T B;  2DIX A;  4OX9 E;  2JVA A;  2E1M A;  4DV2 E;  2EL5 A;  2YU5 A;  1IQO A;  2D9H A;  2ADR A;  2WBT A;  1IBM E;  2ELY A;  5KL2 A;  1PJS A;  3JTZ A;  3KWR A;  3OML A;  5KL7 A;  2LJU A;  1N3G A;  2B7V A;  4F9A B;  2JY9 A;  1RQ0 A;  2R1F A;  2RSM A;  4MLV A;  2WBU A;  3IWD A;  2LTS A;  3J7Y p;  2DGC A;  4ZYG A;  3F6H A;  3EPK A;  2DMY A;  1FJG E;  2EML A;  1O0W A;  5IXM B;  3KZY A;  2YTQ A;  1B69 A;  4BS9 A;  3JAM C;  1YUI A;  1IQS A;  2EN8 A;  1ZBT A;  2EJ4 A;  4M2Z A;  2I9I A;  2EE8 A;  2EMB A;  1N36 E;  4L8N A;  4N4R B;  2YTJ A;  3TQM A;  2PRT A;  4X9J A; 
#chains in the Genus database with same CATH homology
 5IXM B;  4N4R B;  4Q35 B;  4KWY A;  5TSE A;  5IV8 B;  2JXP A;  3BF2 A;  4NHR A;  2R76 A;  4RH8 A;  4RHB B;  2N8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...