1TF3A

Tfiiia finger 1-3 bound to dna, nmr, 22 structures
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5S RNA GENE
publication title Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A02
2EMFA 2MKDA 4F2JC 2EMIA 3MHHC 2EM6A 5KL6A 1YUJA 1A1GA 3EPKA 2LT7A 2DGCA 2NABA 1UN6B 2ENHA 4R2DA 2A25A 2EPZA 4R2PA 2CT1A 4R2SA 2YRMA 5KL2A 1B69A 2EMYA 4M9VC 5KL4A 1A1HA 1MEYC 2EPRA 2LO3A 2EM8A 2DLKA 2DRPA 2HGHA 3EPHA 2E72A 2YTIA 3EPJA 4WSGA 2EMLA 1X6EA 4R2RA 2EOMA 2D9HA 2ELZA 2JP9A 2YU8A 2EMHA 2EMGA 2EPPA 2PRTA 1TF3A 5KL3A 2GHFA 1X6FA 2YTPA 1WJPA 4GZNC 1DGCA 1TN9A 2ENCA 2EPCA 2YTJA 1P47A 4R2CA 2YTOA 2DMIA 2EL4A 1Z1BA 4R2EA 2GLIA 1UBDC 2EORA 3VHTB 2EOFA 4F6MA 1NCSA 1ZU1A 2ELYA 1BB8A 2JPAA 1X3CA 2YTDA 2WBSA 2EE8A 1BBOA 1A1FA 2EN2A 5KL7A 1ZR9A 4F6NA 1RMDA 2EMAA 1A1JA 2BB8A 2EPUA 1JK1A 2YTGA 2EN6A 2RPCA 4X9JA 2EQ0A 2EMKA 3UK3C 2EM4A 2WCC3 3M99B 2VRDA 3MHSC 4IS1C 2EL5A 2EL6A 2EJ4A 2ADRA 2EOHA 2EQ3A 2EMBA 2J7JA 2WBUA 1F2IG 1X6HA 2EOJA 2YTFA 2EQ1A 2EMXA 2YSPA 2RSIA 4R2QA 2R1FA 2CSHA 2YTEA 1G2FC 2EMZA 2YRKA 4FK5C 4IJDA 2EN3A 2EM7A 1YSAC 2WBTA 4R2AA 2I13A 2YU5A 5KL5A 1ZAAC 2EMCA 2EN1A 2LV2A 2YSOA 2EOSA 2LCEA 1JK2A 2EN7A 2EMWA 1KJKA 1LLMC 2EM9A 2EOQA 2EP3A 2EM3A 2LVHA 2EPXA 2EOIA 2YTQA 1A1IA 2DLQA 2CTDA 2M9AA 1A1KA 2EPAA 2EOXA 2EM5A 2EOEA 2EOZA 2EOOA 1A1LA 2EN8A 1AAYA 2EM0A 2MDGA 2EOYA 2EN4A 1TF6A 1X5WA 2YTNA 2ENAA 2MKNA 2EM2A 1G2DC 1YUIA 3EPLA 2YRHA
chains in the Genus database with same CATH superfamily
2MKDA 2EMIA 5KL6A 2V85A 5DNYA 4WXCA 2NABA 4R2DA 4DKKA 4YY3E 2JOXA 2DSYA 4R2PA 3ADGA 3OTOE 5KL2A 5KL4A 4LFBE 1A1HA 2M4IA 4BC7A 2LJUA 1MEYC 2EPRA 3BGHA 2EM8A 2DLKA 2DRPA 2JYAA 2N3HA 1ZBQA 2HGHA 2YZTA 1RC7A 3EPJA 2EMLA 4ZYDA 2NUGA 2UXDE 3F6GA 5A6BA 4JI6E 1WRJA 5AC4A 2EPMX 2B7VA 2HC5A 4DV5E 2KONA 3VK6A 1EH7A 1SR9A 5F3WA 2VE7C 2YTOA 3IWDA 1YYOA 2EL4A 4R2EA 3HTXA 2YTDA 2WBSA 2E1MA 5A6BD 2M1SA 3LMLA 2UXBE 3THOB 4F6NA 2RS7A 1WHQA 2UUAE 2L2KB 3ADLA 1IQSA 2LUPB 1EH8A 2WCC3 4JI4E 2L3CA 2Q8UA 3JAMC 2EL6A 2MC5A 2ADRA 2EQ3A 1IMUA 2EMBA 2J7JA 2LRSA 5IXMB 1X6HA 2EOJA 2YTFA 2JWOA 2RSIA 4R2QA 1WXRA 4KZSA 4DR1E 4F9BB 4LF9E 1O0WA 1XMQE 1ZAAC 1T4OA 3J81C 2FV4B 2RTXA 1J5EE 4JI5E 1KJKA 4WXDA 1MGTA 4DR2E 2NUFA 1EKZA 4OOGC 2DB2A 2EM3A 4BBYA 2EPXA 2EOIA 2F8BA 1A1IA 2DLQA 4RH8A 1A1KA 4MLQA 4B3RE 2FGGA 2B7TA 2EOYA 2LJHA 1EH6A 2MKNA 1FJGE 2K4VA 4TUIA 1G2DC 1YUIA 2BBGA 3C4BA 1X48A 2V83A 2YWQA 4DV2E 4F2JC 2UU9E 1GQEA 4LF5E 3QG5C 3C6MA 2LTSA 2MDRA 1N32E 2JY9A 4R2SA 2YRMA 2EMYA 4HTGA 4BCAA 5A6KA 4JI2E 2RSMA 3C6KA 5T6JA 4DV3E 2EPOA 1L4SA 4WSGA 3FIGA 1X6EA 4JI0E 1NEIA 4LF8E 4DUZE 3DF6A 4BC9A 2YU8A 2EMGA 2PRTA 1PKPA 5AC5A 5CFFE 1UILA 4O5GA 1WJPA 4M2ZA 3H09A 1TN9A 2N3GA 4R2CA 2DMIA 1UBDC 2EORA 1HR0E 1YFHA 2EOFA 2V86A 4DR4E 2WZOA 2ELYA 3ECRA 3KZZA 4LTYA 4ZYHA 2EN2A 1A1FA 1ZR9A 3ADJA 5LL6R 1RMDA 4NXNE 4KWYA 2EQ0A 4MLVA 4JI8E 2UUCE 3UK3C 2L2MA 4F9AB 2M7QA 5AE3A 5A69A 3IWCA 3T1HE 3F6HA 3M99B 4X66E 1YYKA 4IS1C 2EOHA 4DV7E 3HPZA 3BBGA 2EWLA 4DUYE 1PJTA 2YSPA 2YTEA 2CPNA 1YSAC 4WSPA 3AUZA 3JU0A 3P1XA 5AASA 3J7Yp 5KL5A 4DR7E 2EN1A 2R76A 3J7AG 2VQFE 2EP3A 4ZYGA 4WYQB 1XNQE 2YTQA 5IV8B 2VQEE 4DV1E 1N3GA 4BS9A 2EOOA 3BF2A 1A1LA 3MSWA 4O24A 4GKJE 4L5NC 2JOBA 2ENAA 2YPNA 2YRHA 2K7IA 2EMFA 4I8OA 1QNTA 4ZYEA 4LFAE 2EM6A 1A1GA 3EPKA 1HNXE 2LT7A 2DGCA 4Q35B 4R03A 1IBME 2A25A 4BHCA 5IWAE 2CT1A 1J26A 4M9VC 2LO3A 4B3SE 4N4RB 1YZ9A 5IT9C 3EPHA 4LU9A 3OMLA 4DV4E 5LMUE 3KZYA 2ELZA 2DMYA 4O4KA 2EPPA 3ADIA 2JXPA 2LBSB 1PDAA 2GHFA 1X6FA 5KL3A 2YTPA 4GZNC 3KWRA 5FLXC 2ENCA 2EPCA 2YTJA 2ODRC 2B3TB 1N33E 5LMNE 3C4TA 4DV0E 4X65E 2GLIA 2L33A 3VHTB 2JR1A 2V87A 4J8ZA 5A6JA 1BB8A 4DR5E 1XNRE 2JPAA 1X3CA 4LF7E 1BBOA 2JVAA 2L2NA 4TUGA 2F4VE 4JI7E 1T38A 1T4NA 4DR3E 3HPSA 2ZM6E 2L3JA 2LUQA 2EMAA 1A1JA 2EPUA 1ZBTA 2YTGA 2EN6A 2YT4A 1X49A 4LF4E 2B9DA 1YPNA 4JYAE 3EQ1A 4YHHE 4LF6E 2VRDA 3MHSC 1IBLE 4O43A 1X47A 4NXME 2WBUA 1N34E 2LTRA 1T4LB 4WPYA 2IHR1 2EQ1A 2RS6A 4X64E 1PJSA 2CSHA 2EMZA 2YRKA 2EN3A 2LE2A 1FKAE 2H36X 2WBTA 1DI2A 2I13A 2VF1A 2YU5A 3JTZA 2LV2A 2ODRD 4P7DA 2YSOA 2EOSA 2LCEA 1JK2A 2EMWA 1LLMC 3IWBA 2EOQA 4M30A 1STUA 2KHXA 2HHHE 2CTDA 4DMIA 2EM5A 1GTKA 4P78A 4BHBA 4F9CB 4KHPE 4DV6E 3LLHA 1TF6A 2UXCE 1HNWE 3EPLA 1UHZA 4L8NA 3MHHC 4WX9A 2DIXA 4GEQB 1IQOA 1YUJA 4DR6E 5AE1A 2MC6A 5TSEA 4B3TE 4X8WA 1UN6B 2ENHA 4AQYE 4F54A 2EPZA 3ZOQB 1B69A 1SFEA 2EZ6A 4HEIA 3BIDA 2V89A 1GZ6A 2E72A 2YTIA 4NHRA 4R2RA 3RMPA 5A2QC 2EOMA 2KOUA 2D9HA 2JP9A 2V88A 1YYWA 2EMHA 2HJJA 1TF3A 3DJWA 3T1YE 1DGCA 4B3ME 1IBKE 1P47A 4LFCE 2RQLA 4BMJA 1Z1BA 4GKKE 1AH5A 2FTXB 2NUEA 4X62E 1N36E 4F6MA 2N8XA 3TQMA 3VYYA 1NCSA 1ZU1A 1XMOE 3HQ1A 4WFTA 4JI3E 2EE8A 5KL7A 4R8OA 1HNZE 2I9IA 2E5LE 2BB8A 1JK1A 2RPCA 4X9JA 2EMKA 2EPNA 4M0VA 2EM4A 2L6MA 5LLQA 1KYQA 2GPIA 2EL5A 2EJ4A 2EPLX 2V8QB 1F2IG 1T39A 4JI1E 1DQ3A 2EMXA 1WHNA 2R1FA 1G2FC 2L8TA 4FK5C 4IJDA 4OX9E 2EM7A 4R2AA 5BR8E 4NZVA 4JV5E 2G7HA 2EMCA 2EPKX 4K0KE 2EN7A 5ADZA 4RHBB 1RQ0A 1BBGA 2EM9A 3THNA 3VYXA 2LVHA 2LMZA 2UUBE 3K6QA 3L00A 1QU6A 2M9AA 1PJQA 2EPAA 2EOXA 4Q28A 5A6AA 2EOEA 2EOZA 3J80C 3HXLA 2NA2A 2EN8A 1AAYA 3AV0A 2EM0A 2L92A 2MDGA 1I94E 2EN4A 1X5WA 2YTNA 2EM2A 5AE2A
chains in the Genus database with same CATH topology
2EMFA 2MKDA 4F2JC 2EMIA 3MHHC 2EM6A 5KL6A 1YUJA 1A1GA 3EPKA 2LT7A 2DGCA 2NABA 1UN6B 2ENHA 4R2DA 2A25A 2EPZA 4R2PA 2CT1A 4R2SA 2YRMA 5KL2A 1B69A 2EMYA 4M9VC 5KL4A 1A1HA 1MEYC 2EPRA 2LO3A 2EM8A 2DLKA 2DRPA 2HGHA 3EPHA 2E72A 2YTIA 3EPJA 4WSGA 2EMLA 1X6EA 4R2RA 2EOMA 2D9HA 2ELZA 2JP9A 2YU8A 2EMHA 2EMGA 2EPPA 2PRTA 1TF3A 5KL3A 2GHFA 1X6FA 2YTPA 1WJPA 4GZNC 1DGCA 1TN9A 2ENCA 2EPCA 2YTJA 1P47A 4R2CA 2YTOA 2DMIA 2EL4A 1Z1BA 4R2EA 2GLIA 1UBDC 2EORA 3VHTB 2EOFA 4F6MA 1NCSA 1ZU1A 2ELYA 1BB8A 2JPAA 1X3CA 2YTDA 2WBSA 2EE8A 1BBOA 1A1FA 2EN2A 5KL7A 1ZR9A 4F6NA 1RMDA 2EMAA 1A1JA 2BB8A 2EPUA 1JK1A 2YTGA 2EN6A 2RPCA 4X9JA 2EQ0A 2EMKA 3UK3C 2EM4A 2WCC3 3M99B 2VRDA 3MHSC 4IS1C 2EL5A 2EL6A 2EJ4A 2ADRA 2EOHA 2EQ3A 2EMBA 2J7JA 2WBUA 1F2IG 1X6HA 2EOJA 2YTFA 2EQ1A 2EMXA 2YSPA 2RSIA 4R2QA 2R1FA 2CSHA 2YTEA 1G2FC 2EMZA 2YRKA 4FK5C 4IJDA 2EN3A 2EM7A 1YSAC 2WBTA 4R2AA 2I13A 2YU5A 5KL5A 1ZAAC 2EMCA 2EN1A 2LV2A 2YSOA 2EOSA 2LCEA 1JK2A 2EN7A 2EMWA 1KJKA 1LLMC 2EM9A 2EOQA 2EP3A 2EM3A 2LVHA 2EPXA 2EOIA 2YTQA 1A1IA 2DLQA 2CTDA 2M9AA 1A1KA 2EPAA 2EOXA 2EM5A 2EOEA 2EOZA 2EOOA 1A1LA 2EN8A 1AAYA 2EM0A 2MDGA 2EOYA 2EN4A 1TF6A 1X5WA 2YTNA 2ENAA 2MKNA 2EM2A 1G2DC 1YUIA 3EPLA 2YRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMF A;  2MKD A;  4F2J C;  2EMI A;  3MHH C;  2EM6 A;  5KL6 A;  1YUJ A;  1A1G A;  3EPK A;  2LT7 A;  2DGC A;  2NAB A;  1UN6 B;  2ENH A;  4R2D A;  2A25 A;  2EPZ A;  4R2P A;  2CT1 A;  4R2S A;  2YRM A;  5KL2 A;  1B69 A;  2EMY A;  4M9V C;  5KL4 A;  1A1H A;  1MEY C;  2EPR A;  2LO3 A;  2EM8 A;  2DLK A;  2DRP A;  2HGH A;  3EPH A;  2E72 A;  2YTI A;  3EPJ A;  4WSG A;  2EML A;  1X6E A;  4R2R A;  2EOM A;  2D9H A;  2ELZ A;  2JP9 A;  2YU8 A;  2EMH A;  2EMG A;  2EPP A;  2PRT A;  1TF3 A;  5KL3 A;  2GHF A;  1X6F A;  2YTP A;  1WJP A;  4GZN C;  1DGC A;  1TN9 A;  2ENC A;  2EPC A;  2YTJ A;  1P47 A;  4R2C A;  2YTO A;  2DMI A;  2EL4 A;  1Z1B A;  4R2E A;  2GLI A;  1UBD C;  2EOR A;  3VHT B;  2EOF A;  4F6M A;  1NCS A;  1ZU1 A;  2ELY A;  1BB8 A;  2JPA A;  1X3C A;  2YTD A;  2WBS A;  2EE8 A;  1BBO A;  1A1F A;  2EN2 A;  5KL7 A;  1ZR9 A;  4F6N A;  1RMD A;  2EMA A;  1A1J A;  2BB8 A;  2EPU A;  1JK1 A;  2YTG A;  2EN6 A;  2RPC A;  4X9J A;  2EQ0 A;  2EMK A;  3UK3 C;  2EM4 A;  2WCC 3;  3M99 B;  2VRD A;  3MHS C;  4IS1 C;  2EL5 A;  2EL6 A;  2EJ4 A;  2ADR A;  2EOH A;  2EQ3 A;  2EMB A;  2J7J A;  2WBU A;  1F2I G;  1X6H A;  2EOJ A;  2YTF A;  2EQ1 A;  2EMX A;  2YSP A;  2RSI A;  4R2Q A;  2R1F A;  2CSH A;  2YTE A;  1G2F C;  2EMZ A;  2YRK A;  4FK5 C;  4IJD A;  2EN3 A;  2EM7 A;  1YSA C;  2WBT A;  4R2A A;  2I13 A;  2YU5 A;  5KL5 A;  1ZAA C;  2EMC A;  2EN1 A;  2LV2 A;  2YSO A;  2EOS A;  2LCE A;  1JK2 A;  2EN7 A;  2EMW A;  1KJK A;  1LLM C;  2EM9 A;  2EOQ A;  2EP3 A;  2EM3 A;  2LVH A;  2EPX A;  2EOI A;  2YTQ A;  1A1I A;  2DLQ A;  2CTD A;  2M9A A;  1A1K A;  2EPA A;  2EOX A;  2EM5 A;  2EOE A;  2EOZ A;  2EOO A;  1A1L A;  2EN8 A;  1AAY A;  2EM0 A;  2MDG A;  2EOY A;  2EN4 A;  1TF6 A;  1X5W A;  2YTN A;  2ENA A;  2MKN A;  2EM2 A;  1G2D C;  1YUI A;  3EPL A;  2YRH A; 
#chains in the Genus database with same CATH topology
 2MKD A;  2EMI A;  5KL6 A;  2V85 A;  5DNY A;  4WXC A;  2NAB A;  4R2D A;  4DKK A;  4YY3 E;  2JOX A;  2DSY A;  4R2P A;  3ADG A;  3OTO E;  5KL2 A;  5KL4 A;  4LFB E;  1A1H A;  2M4I A;  4BC7 A;  2LJU A;  1MEY C;  2EPR A;  3BGH A;  2EM8 A;  2DLK A;  2DRP A;  2JYA A;  2N3H A;  1ZBQ A;  2HGH A;  2YZT A;  1RC7 A;  3EPJ A;  2EML A;  4ZYD A;  2NUG A;  2UXD E;  3F6G A;  5A6B A;  4JI6 E;  1WRJ A;  5AC4 A;  2EPM X;  2B7V A;  2HC5 A;  4DV5 E;  2KON A;  3VK6 A;  1EH7 A;  1SR9 A;  5F3W A;  2VE7 C;  2YTO A;  3IWD A;  1YYO A;  2EL4 A;  4R2E A;  3HTX A;  2YTD A;  2WBS A;  2E1M A;  5A6B D;  2M1S A;  3LML A;  2UXB E;  3THO B;  4F6N A;  2RS7 A;  1WHQ A;  2UUA E;  2L2K B;  3ADL A;  1IQS A;  2LUP B;  1EH8 A;  2WCC 3;  4JI4 E;  2L3C A;  2Q8U A;  3JAM C;  2EL6 A;  2MC5 A;  2ADR A;  2EQ3 A;  1IMU A;  2EMB A;  2J7J A;  2LRS A;  5IXM B;  1X6H A;  2EOJ A;  2YTF A;  2JWO A;  2RSI A;  4R2Q A;  1WXR A;  4KZS A;  4DR1 E;  4F9B B;  4LF9 E;  1O0W A;  1XMQ E;  1ZAA C;  1T4O A;  3J81 C;  2FV4 B;  2RTX A;  1J5E E;  4JI5 E;  1KJK A;  4WXD A;  1MGT A;  4DR2 E;  2NUF A;  1EKZ A;  4OOG C;  2DB2 A;  2EM3 A;  4BBY A;  2EPX A;  2EOI A;  2F8B A;  1A1I A;  2DLQ A;  4RH8 A;  1A1K A;  4MLQ A;  4B3R E;  2FGG A;  2B7T A;  2EOY A;  2LJH A;  1EH6 A;  2MKN A;  1FJG E;  2K4V A;  4TUI A;  1G2D C;  1YUI A;  2BBG A;  3C4B A;  1X48 A;  2V83 A;  2YWQ A;  4DV2 E;  4F2J C;  2UU9 E;  1GQE A;  4LF5 E;  3QG5 C;  3C6M A;  2LTS A;  2MDR A;  1N32 E;  2JY9 A;  4R2S A;  2YRM A;  2EMY A;  4HTG A;  4BCA A;  5A6K A;  4JI2 E;  2RSM A;  3C6K A;  5T6J A;  4DV3 E;  2EPO A;  1L4S A;  4WSG A;  3FIG A;  1X6E A;  4JI0 E;  1NEI A;  4LF8 E;  4DUZ E;  3DF6 A;  4BC9 A;  2YU8 A;  2EMG A;  2PRT A;  1PKP A;  5AC5 A;  5CFF E;  1UIL A;  4O5G A;  1WJP A;  4M2Z A;  3H09 A;  1TN9 A;  2N3G A;  4R2C A;  2DMI A;  1UBD C;  2EOR A;  1HR0 E;  1YFH A;  2EOF A;  2V86 A;  4DR4 E;  2WZO A;  2ELY A;  3ECR A;  3KZZ A;  4LTY A;  4ZYH A;  2EN2 A;  1A1F A;  1ZR9 A;  3ADJ A;  5LL6 R;  1RMD A;  4NXN E;  4KWY A;  2EQ0 A;  4MLV A;  4JI8 E;  2UUC E;  3UK3 C;  2L2M A;  4F9A B;  2M7Q A;  5AE3 A;  5A69 A;  3IWC A;  3T1H E;  3F6H A;  3M99 B;  4X66 E;  1YYK A;  4IS1 C;  2EOH A;  4DV7 E;  3HPZ A;  3BBG A;  2EWL A;  4DUY E;  1PJT A;  2YSP A;  2YTE A;  2CPN A;  1YSA C;  4WSP A;  3AUZ A;  3JU0 A;  3P1X A;  5AAS A;  3J7Y p;  5KL5 A;  4DR7 E;  2EN1 A;  2R76 A;  3J7A G;  2VQF E;  2EP3 A;  4ZYG A;  4WYQ B;  1XNQ E;  2YTQ A;  5IV8 B;  2VQE E;  4DV1 E;  1N3G A;  4BS9 A;  2EOO A;  3BF2 A;  1A1L A;  3MSW A;  4O24 A;  4GKJ E;  4L5N C;  2JOB A;  2ENA A;  2YPN A;  2YRH A;  2K7I A;  2EMF A;  4I8O A;  1QNT A;  4ZYE A;  4LFA E;  2EM6 A;  1A1G A;  3EPK A;  1HNX E;  2LT7 A;  2DGC A;  4Q35 B;  4R03 A;  1IBM E;  2A25 A;  4BHC A;  5IWA E;  2CT1 A;  1J26 A;  4M9V C;  2LO3 A;  4B3S E;  4N4R B;  1YZ9 A;  5IT9 C;  3EPH A;  4LU9 A;  3OML A;  4DV4 E;  5LMU E;  3KZY A;  2ELZ A;  2DMY A;  4O4K A;  2EPP A;  3ADI A;  2JXP A;  2LBS B;  1PDA A;  2GHF A;  1X6F A;  5KL3 A;  2YTP A;  4GZN C;  3KWR A;  5FLX C;  2ENC A;  2EPC A;  2YTJ A;  2ODR C;  2B3T B;  1N33 E;  5LMN E;  3C4T A;  4DV0 E;  4X65 E;  2GLI A;  2L33 A;  3VHT B;  2JR1 A;  2V87 A;  4J8Z A;  5A6J A;  1BB8 A;  4DR5 E;  1XNR E;  2JPA A;  1X3C A;  4LF7 E;  1BBO A;  2JVA A;  2L2N A;  4TUG A;  2F4V E;  4JI7 E;  1T38 A;  1T4N A;  4DR3 E;  3HPS A;  2ZM6 E;  2L3J A;  2LUQ A;  2EMA A;  1A1J A;  2EPU A;  1ZBT A;  2YTG A;  2EN6 A;  2YT4 A;  1X49 A;  4LF4 E;  2B9D A;  1YPN A;  4JYA E;  3EQ1 A;  4YHH E;  4LF6 E;  2VRD A;  3MHS C;  1IBL E;  4O43 A;  1X47 A;  4NXM E;  2WBU A;  1N34 E;  2LTR A;  1T4L B;  4WPY A;  2IHR 1;  2EQ1 A;  2RS6 A;  4X64 E;  1PJS A;  2CSH A;  2EMZ A;  2YRK A;  2EN3 A;  2LE2 A;  1FKA E;  2H36 X;  2WBT A;  1DI2 A;  2I13 A;  2VF1 A;  2YU5 A;  3JTZ A;  2LV2 A;  2ODR D;  4P7D A;  2YSO A;  2EOS A;  2LCE A;  1JK2 A;  2EMW A;  1LLM C;  3IWB A;  2EOQ A;  4M30 A;  1STU A;  2KHX A;  2HHH E;  2CTD A;  4DMI A;  2EM5 A;  1GTK A;  4P78 A;  4BHB A;  4F9C B;  4KHP E;  4DV6 E;  3LLH A;  1TF6 A;  2UXC E;  1HNW E;  3EPL A;  1UHZ A;  4L8N A;  3MHH C;  4WX9 A;  2DIX A;  4GEQ B;  1IQO A;  1YUJ A;  4DR6 E;  5AE1 A;  2MC6 A;  5TSE A;  4B3T E;  4X8W A;  1UN6 B;  2ENH A;  4AQY E;  4F54 A;  2EPZ A;  3ZOQ B;  1B69 A;  1SFE A;  2EZ6 A;  4HEI A;  3BID A;  2V89 A;  1GZ6 A;  2E72 A;  2YTI A;  4NHR A;  4R2R A;  3RMP A;  5A2Q C;  2EOM A;  2KOU A;  2D9H A;  2JP9 A;  2V88 A;  1YYW A;  2EMH A;  2HJJ A;  1TF3 A;  3DJW A;  3T1Y E;  1DGC A;  4B3M E;  1IBK E;  1P47 A;  4LFC E;  2RQL A;  4BMJ A;  1Z1B A;  4GKK E;  1AH5 A;  2FTX B;  2NUE A;  4X62 E;  1N36 E;  4F6M A;  2N8X A;  3TQM A;  3VYY A;  1NCS A;  1ZU1 A;  1XMO E;  3HQ1 A;  4WFT A;  4JI3 E;  2EE8 A;  5KL7 A;  4R8O A;  1HNZ E;  2I9I A;  2E5L E;  2BB8 A;  1JK1 A;  2RPC A;  4X9J A;  2EMK A;  2EPN A;  4M0V A;  2EM4 A;  2L6M A;  5LLQ A;  1KYQ A;  2GPI A;  2EL5 A;  2EJ4 A;  2EPL X;  2V8Q B;  1F2I G;  1T39 A;  4JI1 E;  1DQ3 A;  2EMX A;  1WHN A;  2R1F A;  1G2F C;  2L8T A;  4FK5 C;  4IJD A;  4OX9 E;  2EM7 A;  4R2A A;  5BR8 E;  4NZV A;  4JV5 E;  2G7H A;  2EMC A;  2EPK X;  4K0K E;  2EN7 A;  5ADZ A;  4RHB B;  1RQ0 A;  1BBG A;  2EM9 A;  3THN A;  3VYX A;  2LVH A;  2LMZ A;  2UUB E;  3K6Q A;  3L00 A;  1QU6 A;  2M9A A;  1PJQ A;  2EPA A;  2EOX A;  4Q28 A;  5A6A A;  2EOE A;  2EOZ A;  3J80 C;  3HXL A;  2NA2 A;  2EN8 A;  1AAY A;  3AV0 A;  2EM0 A;  2L92 A;  2MDG A;  1I94 E;  2EN4 A;  1X5W A;  2YTN A;  2EM2 A;  5AE2 A; 
#chains in the Genus database with same CATH homology
 2EMF A;  2MKD A;  4F2J C;  2EMI A;  3MHH C;  2EM6 A;  5KL6 A;  1YUJ A;  1A1G A;  3EPK A;  2LT7 A;  2DGC A;  2NAB A;  1UN6 B;  2ENH A;  4R2D A;  2A25 A;  2EPZ A;  4R2P A;  2CT1 A;  4R2S A;  2YRM A;  5KL2 A;  1B69 A;  2EMY A;  4M9V C;  5KL4 A;  1A1H A;  1MEY C;  2EPR A;  2LO3 A;  2EM8 A;  2DLK A;  2DRP A;  2HGH A;  3EPH A;  2E72 A;  2YTI A;  3EPJ A;  4WSG A;  2EML A;  1X6E A;  4R2R A;  2EOM A;  2D9H A;  2ELZ A;  2JP9 A;  2YU8 A;  2EMH A;  2EMG A;  2EPP A;  2PRT A;  1TF3 A;  5KL3 A;  2GHF A;  1X6F A;  2YTP A;  1WJP A;  4GZN C;  1DGC A;  1TN9 A;  2ENC A;  2EPC A;  2YTJ A;  1P47 A;  4R2C A;  2YTO A;  2DMI A;  2EL4 A;  1Z1B A;  4R2E A;  2GLI A;  1UBD C;  2EOR A;  3VHT B;  2EOF A;  4F6M A;  1NCS A;  1ZU1 A;  2ELY A;  1BB8 A;  2JPA A;  1X3C A;  2YTD A;  2WBS A;  2EE8 A;  1BBO A;  1A1F A;  2EN2 A;  5KL7 A;  1ZR9 A;  4F6N A;  1RMD A;  2EMA A;  1A1J A;  2BB8 A;  2EPU A;  1JK1 A;  2YTG A;  2EN6 A;  2RPC A;  4X9J A;  2EQ0 A;  2EMK A;  3UK3 C;  2EM4 A;  2WCC 3;  3M99 B;  2VRD A;  3MHS C;  4IS1 C;  2EL5 A;  2EL6 A;  2EJ4 A;  2ADR A;  2EOH A;  2EQ3 A;  2EMB A;  2J7J A;  2WBU A;  1F2I G;  1X6H A;  2EOJ A;  2YTF A;  2EQ1 A;  2EMX A;  2YSP A;  2RSI A;  4R2Q A;  2R1F A;  2CSH A;  2YTE A;  1G2F C;  2EMZ A;  2YRK A;  4FK5 C;  4IJD A;  2EN3 A;  2EM7 A;  1YSA C;  2WBT A;  4R2A A;  2I13 A;  2YU5 A;  5KL5 A;  1ZAA C;  2EMC A;  2EN1 A;  2LV2 A;  2YSO A;  2EOS A;  2LCE A;  1JK2 A;  2EN7 A;  2EMW A;  1KJK A;  1LLM C;  2EM9 A;  2EOQ A;  2EP3 A;  2EM3 A;  2LVH A;  2EPX A;  2EOI A;  2YTQ A;  1A1I A;  2DLQ A;  2CTD A;  2M9A A;  1A1K A;  2EPA A;  2EOX A;  2EM5 A;  2EOE A;  2EOZ A;  2EOO A;  1A1L A;  2EN8 A;  1AAY A;  2EM0 A;  2MDG A;  2EOY A;  2EN4 A;  1TF6 A;  1X5W A;  2YTN A;  2ENA A;  2MKN A;  2EM2 A;  1G2D C;  1YUI A;  3EPL A;  2YRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...