1TF3A

Tfiiia finger 1-3 bound to dna, nmr, 22 structures
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
molecule keywords 5S RNA GENE
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A02
2DLKA 2EOHA 2YTGA 1B69A 2EQ0A 2DMIA 2LCEA 2EPPA 1A1HA 2VRDA 2EM7A 2EL5A 2EOYA 2EMWA 2EMKA 2DGCA 2EMGA 1BB8A 2LVHA 4F6MA 2GHFA 4F2JC 2EN2A 2EN1A 3MHSC 1AAYA 2EQ3A 1X3CA 2E72A 2EM5A 2EM4A 2BB8A 1JK1A 2WBTA 2EQ1A 2JP9A 2DLQA 1LLMC 2RSIA 2EMHA 2EMZA 2YRMA 2EN4A 2EMBA 1F2IG 1A1FA 3EPLA 2ADRA 2EPUA 5KL2A 3EPHA 1X6EA 1YUJA 3MHHC 4GZNC 2EPRA 2EPCA 1ZR9A 2EORA 1A1KA 2EPAA 1P47A 1BBOA 2CTDA 1X5WA 2CSHA 2EL4A 1JK2A 2ENHA 2EOIA 5KL5A 2J7JA 2EMXA 4WSGA 4IJDA 1ZAAC 5KL4A 2I13A 2NABA 2YRKA 1ZU1A 2EMIA 2ENAA 4R2SA 3UK3C 1KJKA 2ENCA 3VHTB 4FK5C 1A1JA 1A1IA 2EPZA 2EOJA 2EM2A 1YSAC 2ELYA 2WBSA 4R2PA 5KL3A 2YTOA 2EPXA 2EMFA 1Z1BA 1TF3A 2YTJA 2EM6A 2PRTA 1DGCA 1X6FA 2EM9A 2WBUA 2EM8A 3EPKA 4R2CA 2EN7A 2MKNA 1X6HA 2MDGA 2EM3A 2R1FA 4F6NA 2EOMA 2LT7A 1RMDA 2YTIA 4R2QA 2EOXA 2YSPA 2EMCA 4IS1C 2EMAA 5KL6A 2EJ4A 4R2DA 2LO3A 3EPJA 1A1LA 1G2FC 1NCSA 2EP3A 1TF6A 2EOQA 2YU8A 2EOSA 2HGHA 1YUIA 2GLIA 2YU5A 1A1GA 2EN6A 4M9VC 2YTEA 2EMLA 2YSOA 4R2RA 1TN9A 2YRHA 2DRPA 1UN6B 3M99B 2CT1A 2YTDA 4R2AA 4X9JA 2EOFA 2YTNA 2RPCA 2YTQA 2EOOA 1UBDC 1WJPA 2EN3A 2JPAA 2EM0A 2EN8A 1G2DC 2D9HA 2YTPA 4R2EA 2EOEA 2WCC3 5KL7A 2LV2A 2EE8A 2MKDA 2YTFA 1MEYC 2EMYA 2EL6A 2EOZA 2M9AA 2ELZA 2A25A
chains in the Genus database with same CATH superfamily
4LU9A 3IWCA 1IQOA 3KZZA 2LCEA 4X62E 4M0VA 2N3GA 4YY3E 1O0WA 1BB8A 1YFHA 5ADZA 3C4BA 4F2JC 2M7QA 2DIXA 1X3CA 2EM5A 4MLVA 4DV5E 1IBME 2DLQA 1LLMC 2F8BA 4B3SE 2EMZA 5AC5A 1N3GA 3ADIA 2EMBA 4ZYEA 2EPUA 5AE3A 3MHHC 4GZNC 2EPRA 2EORA 4DV4E 5IV8B 5BR8E 1N32E 2V87A 4X66E 2VQEE 4LF6E 4DV7E 2GPIA 2LRSA 2L2MA 1ZAAC 3BBGA 5KL4A 2V85A 4R2SA 4F9CB 2M4IA 3VYXA 2LUPB 1XNRE 2YPNA 4NXNE 5AE1A 2UXDE 2WBSA 2RTXA 4KWYA 3J80C 4BHCA 4R2PA 4LF5E 4TUGA 4LFBE 5TSEA 1DGCA 3EPKA 4R2CA 1T39A 2MKNA 4B3ME 1X6HA 5A69A 4JI1E 2R1FA 1BBGA 2LT7A 1RC7A 2B7VA 4GKJE 2YSPA 1GTKA 2G7HA 4R2DA 2E1MA 2JY9A 3EPJA 1A1LA 1RQ0A 2HGHA 1YUIA 1N34E 1A1GA 2EN6A 2RS6A 4M9VC 1TN9A 2L33A 3J81C 1YYKA 2CT1A 2YTDA 4JI0E 2YTQA 3AUZA 2EWLA 2K4VA 1WHQA 4DV2E 2JXPA 2MDRA 2YTPA 3HTXA 2WCC3 5KL7A 4WYQB 2V83A 1YYWA 3ECRA 2V8QB 2NUFA 1EKZA 2YTGA 4DR7E 2EQ0A 4DUZE 2EPPA 1A1HA 2EPNA 2LTRA 2VRDA 2EM7A 2CPNA 2LJHA 2LUQA 4O43A 4RH8A 2L2NA 1AAYA 2ODRD 1ZBQA 3C4TA 2NUEA 4X65E 2EQ1A 4R03A 3L00A 5AASA 2EMHA 3BIDA 1EH6A 3BGHA 2NUGA 4K0KE 4BBYA 2EN4A 1F2IG 3IWBA 5KL2A 1WXRA 1X47A 2B7TA 2YWQA 2EPCA 1A1KA 4X8WA 1SR9A 1BBOA 1X5WA 1X48A 1JK2A 2R76A 4GKKE 5KL5A 2J7JA 4R8OA 2L8TA 2YRKA 4DR4E 3P1XA 2EMIA 2ENAA 3UK3C 3VHTB 4OOGC 3EQ1A 2EPZA 2UUBE 5IXMB 3VYYA 4L8NA 3TQMA 3C6MA 2RS7A 2EPXA 1Z1BA 1DI2A 2EM9A 2WBUA 4AQYE 2EM8A 4TUIA 2EN7A 2JOXA 3C6KA 4HEIA 4BHBA 4WXCA 4JV5E 1J26A 4ZYDA 4DR2E 1RMDA 2NA2A 4JI6E 1XMOE 3JU0A 4ZYGA 1IBLE 2EMCA 4IS1C 4JI5E 2KONA 2LO3A 4LTYA 2EOQA 2YU8A 4DKKA 3T1HE 1QNTA 1AH5A 4R2RA 3DF6A 2V89A 4R2AA 2B9DA 3HQ1A 3HPZA 5LMUE 2EOOA 4I8OA 4KHPE 3K6QA 2EM0A 4J8ZA 1PKPA 5LLQA 2D9HA 3F6HA 1YYOA 2YTFA 3KZYA 2FTXB 5A6KA 2VQFE 1B69A 2DMIA 4O5GA 1X49A 4P7DA 1T4NA 2EMWA 2EMKA 4DMIA 2EMGA 1GQEA 2LVHA 3QG5C 4LF9E 5DNYA 5A6JA 5A6BA 1J5EE 2EPKX 2MC6A 1L4SA 4WFTA 2EM4A 2BB8A 3J7Yp 2JP9A 1MGTA 4JI4E 4BCAA 2EZ6A 2RSIA 1HR0E 4O24A 2YRMA 1A1FA 3EPLA 3EPHA 1X6EA 1NEIA 4ZYHA 1HNZE 4JI3E 2EPAA 2YT4A 4Q35B 3DJWA 3F6GA 2EL4A 5A6BD 3HXLA 2EOIA 4DR5E 4WSGA 2MC5A 4DUYE 2VE7C 1ZU1A 1KJKA 1T4OA 4LF7E 2VF1A 2WZOA 4FK5C 5IWAE 1A1IA 4Q28A 2DSYA 2M1SA 2EM2A 4DR1E 2N8XA 1YSAC 4JI2E 1IQSA 2YTOA 2EMFA 3ADJA 1TF3A 2YTJA 2EM6A 2PRTA 3ADGA 2KOUA 2MDGA 2N3HA 4KZSA 3H09A 2EM3A 2HJJA 4F6NA 4P78A 1T38A 2FV4B 1I94E 4F54A 1KYQA 2EOXA 3LLHA 5KL6A 2EJ4A 1T4LB 1TF6A 1YZ9A 2GLIA 2DB2A 2YU5A 3HPSA 4LFAE 2YSOA 1STUA 2EPOA 3JTZA 1FJGE 1YPNA 2UXBE 4HTGA 3OTOE 2DMYA 1UHZA 4N4RB 1UN6B 3M99B 4DV0E 4RHBB 2B3TB 4X9JA 5CFFE 1UILA 2EOFA 2EPLX 2RPCA 2YTNA 2UXCE 2ELZA 4F9BB 2IHR1 3RMPA 2JYAA 2UU9E 2E5LE 2JVAA 4WPYA 5A2QC 2RQLA 2EN8A 1G2DC 1N36E 4R2EA 2EOEA 1PJSA 1HNWE 4O4KA 2EMYA 3J7AG 2UUCE 2YZTA 2EOZA 2RSMA 2M9AA 3THOB 4BS9A 1P47A 2DLKA 2EOHA 4WSPA 4NHRA 2JR1A 2LE2A 4WX9A 2EL5A 2BBGA 2EOYA 5T6JA 1FKAE 3IWDA 2DGCA 2ODRC 3THNA 1EH8A 4F6MA 2GHFA 2EN2A 2EN1A 3MHSC 2EQ3A 1SFEA 3MSWA 3FIGA 4BC7A 4LF4E 2I9IA 2E72A 1JK1A 2WBTA 2L3JA 4OX9E 1N33E 4YHHE 5IT9C 1XNQE 3OMLA 1IMUA 2ADRA 2L3CA 1YUJA 4DV1E 2L92A 1ZR9A 2FGGA 2LBSB 2F4VE 4DR3E 3KWRA 2CTDA 1ZBTA 2CSHA 3ADLA 4NZVA 4BMJA 1DQ3A 2ENHA 2EMXA 4IJDA 4X64E 2NABA 2I13A 2KHXA 4LFCE 2ENCA 3VK6A 2LMZA 1PJTA 1A1JA 2JWOA 2EOJA 2LTSA 4M2ZA 2ELYA 3AV0A 5KL3A 5AE2A 4F9AB 4DR6E 1X6FA 5A6AA 3T1YE 4NXME 2EPMX 1IBKE 2L6MA 2Q8UA 5LMNE 4M30A 2EOMA 3LMLA 1WRJA 2HC5A 2YTIA 4R2QA 4GEQB 2EMAA 2UUAE 4DV3E 1G2FC 1NCSA 2EP3A 2V88A 4JI7E 5FLXC 2EOSA 2ZM6E 2HHHE 2K7IA 2V86A 4B3RE 2YTEA 2EMLA 2H36X 4MLQA 2YRHA 2DRPA 4WXDA 1QU6A 2LJUA 4LF8E 4JYAE 4B3TE 4BC9A 3BF2A 1PDAA 2L2KB 5LL6R 1UBDC 1WJPA 2EN3A 2JPAA 5AC4A 1WHNA 4DV6E 1HNXE 3ZOQB 1GZ6A 1EH7A 2LV2A 1PJQA 2EE8A 2MKDA 5F3WA 1MEYC 2EL6A 1XMQE 4L5NC 3JAMC 2JOBA 4JI8E 2A25A
chains in the Genus database with same CATH topology
2DLKA 2EOHA 2YTGA 1B69A 2EQ0A 2DMIA 2LCEA 2EPPA 1A1HA 2VRDA 2EM7A 2EL5A 2EOYA 2EMWA 2EMKA 2DGCA 2EMGA 1BB8A 2LVHA 4F6MA 2GHFA 4F2JC 2EN2A 2EN1A 3MHSC 1AAYA 2EQ3A 1X3CA 2E72A 2EM5A 2EM4A 2BB8A 1JK1A 2WBTA 2EQ1A 2JP9A 2DLQA 1LLMC 2RSIA 2EMHA 2EMZA 2YRMA 2EN4A 2EMBA 1F2IG 1A1FA 3EPLA 2ADRA 2EPUA 5KL2A 3EPHA 1X6EA 1YUJA 3MHHC 4GZNC 2EPRA 2EPCA 1ZR9A 2EORA 1A1KA 2EPAA 1P47A 1BBOA 2CTDA 1X5WA 2CSHA 2EL4A 1JK2A 2ENHA 2EOIA 5KL5A 2J7JA 2EMXA 4WSGA 4IJDA 1ZAAC 5KL4A 2I13A 2NABA 2YRKA 1ZU1A 2EMIA 2ENAA 4R2SA 3UK3C 1KJKA 2ENCA 3VHTB 4FK5C 1A1JA 1A1IA 2EPZA 2EOJA 2EM2A 1YSAC 2ELYA 2WBSA 4R2PA 5KL3A 2YTOA 2EPXA 2EMFA 1Z1BA 1TF3A 2YTJA 2EM6A 2PRTA 1DGCA 1X6FA 2EM9A 2WBUA 2EM8A 3EPKA 4R2CA 2EN7A 2MKNA 1X6HA 2MDGA 2EM3A 2R1FA 4F6NA 2EOMA 2LT7A 1RMDA 2YTIA 4R2QA 2EOXA 2YSPA 2EMCA 4IS1C 2EMAA 5KL6A 2EJ4A 4R2DA 2LO3A 3EPJA 1A1LA 1G2FC 1NCSA 2EP3A 1TF6A 2EOQA 2YU8A 2EOSA 2HGHA 1YUIA 2GLIA 2YU5A 1A1GA 2EN6A 4M9VC 2YTEA 2EMLA 2YSOA 4R2RA 1TN9A 2YRHA 2DRPA 1UN6B 3M99B 2CT1A 2YTDA 4R2AA 4X9JA 2EOFA 2YTNA 2RPCA 2YTQA 2EOOA 1UBDC 1WJPA 2EN3A 2JPAA 2EM0A 2EN8A 1G2DC 2D9HA 2YTPA 4R2EA 2EOEA 2WCC3 5KL7A 2LV2A 2EE8A 2MKDA 2YTFA 1MEYC 2EMYA 2EL6A 2EOZA 2M9AA 2ELZA 2A25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLK A;  2EOH A;  2YTG A;  1B69 A;  2EQ0 A;  2DMI A;  2LCE A;  2EPP A;  1A1H A;  2VRD A;  2EM7 A;  2EL5 A;  2EOY A;  2EMW A;  2EMK A;  2DGC A;  2EMG A;  1BB8 A;  2LVH A;  4F6M A;  2GHF A;  4F2J C;  2EN2 A;  2EN1 A;  3MHS C;  1AAY A;  2EQ3 A;  1X3C A;  2E72 A;  2EM5 A;  2EM4 A;  2BB8 A;  1JK1 A;  2WBT A;  2EQ1 A;  2JP9 A;  2DLQ A;  1LLM C;  2RSI A;  2EMH A;  2EMZ A;  2YRM A;  2EN4 A;  2EMB A;  1F2I G;  1A1F A;  3EPL A;  2ADR A;  2EPU A;  5KL2 A;  3EPH A;  1X6E A;  1YUJ A;  3MHH C;  4GZN C;  2EPR A;  2EPC A;  1ZR9 A;  2EOR A;  1A1K A;  2EPA A;  1P47 A;  1BBO A;  2CTD A;  1X5W A;  2CSH A;  2EL4 A;  1JK2 A;  2ENH A;  2EOI A;  5KL5 A;  2J7J A;  2EMX A;  4WSG A;  4IJD A;  1ZAA C;  5KL4 A;  2I13 A;  2NAB A;  2YRK A;  1ZU1 A;  2EMI A;  2ENA A;  4R2S A;  3UK3 C;  1KJK A;  2ENC A;  3VHT B;  4FK5 C;  1A1J A;  1A1I A;  2EPZ A;  2EOJ A;  2EM2 A;  1YSA C;  2ELY A;  2WBS A;  4R2P A;  5KL3 A;  2YTO A;  2EPX A;  2EMF A;  1Z1B A;  1TF3 A;  2YTJ A;  2EM6 A;  2PRT A;  1DGC A;  1X6F A;  2EM9 A;  2WBU A;  2EM8 A;  3EPK A;  4R2C A;  2EN7 A;  2MKN A;  1X6H A;  2MDG A;  2EM3 A;  2R1F A;  4F6N A;  2EOM A;  2LT7 A;  1RMD A;  2YTI A;  4R2Q A;  2EOX A;  2YSP A;  2EMC A;  4IS1 C;  2EMA A;  5KL6 A;  2EJ4 A;  4R2D A;  2LO3 A;  3EPJ A;  1A1L A;  1G2F C;  1NCS A;  2EP3 A;  1TF6 A;  2EOQ A;  2YU8 A;  2EOS A;  2HGH A;  1YUI A;  2GLI A;  2YU5 A;  1A1G A;  2EN6 A;  4M9V C;  2YTE A;  2EML A;  2YSO A;  4R2R A;  1TN9 A;  2YRH A;  2DRP A;  1UN6 B;  3M99 B;  2CT1 A;  2YTD A;  4R2A A;  4X9J A;  2EOF A;  2YTN A;  2RPC A;  2YTQ A;  2EOO A;  1UBD C;  1WJP A;  2EN3 A;  2JPA A;  2EM0 A;  2EN8 A;  1G2D C;  2D9H A;  2YTP A;  4R2E A;  2EOE A;  2WCC 3;  5KL7 A;  2LV2 A;  2EE8 A;  2MKD A;  2YTF A;  1MEY C;  2EMY A;  2EL6 A;  2EOZ A;  2M9A A;  2ELZ A;  2A25 A; 
#chains in the Genus database with same CATH topology
 4LU9 A;  3IWC A;  1IQO A;  3KZZ A;  2LCE A;  4X62 E;  4M0V A;  2N3G A;  4YY3 E;  1O0W A;  1BB8 A;  1YFH A;  5ADZ A;  3C4B A;  4F2J C;  2M7Q A;  2DIX A;  1X3C A;  2EM5 A;  4MLV A;  4DV5 E;  1IBM E;  2DLQ A;  1LLM C;  2F8B A;  4B3S E;  2EMZ A;  5AC5 A;  1N3G A;  3ADI A;  2EMB A;  4ZYE A;  2EPU A;  5AE3 A;  3MHH C;  4GZN C;  2EPR A;  2EOR A;  4DV4 E;  5IV8 B;  5BR8 E;  1N32 E;  2V87 A;  4X66 E;  2VQE E;  4LF6 E;  4DV7 E;  2GPI A;  2LRS A;  2L2M A;  1ZAA C;  3BBG A;  5KL4 A;  2V85 A;  4R2S A;  4F9C B;  2M4I A;  3VYX A;  2LUP B;  1XNR E;  2YPN A;  4NXN E;  5AE1 A;  2UXD E;  2WBS A;  2RTX A;  4KWY A;  3J80 C;  4BHC A;  4R2P A;  4LF5 E;  4TUG A;  4LFB E;  5TSE A;  1DGC A;  3EPK A;  4R2C A;  1T39 A;  2MKN A;  4B3M E;  1X6H A;  5A69 A;  4JI1 E;  2R1F A;  1BBG A;  2LT7 A;  1RC7 A;  2B7V A;  4GKJ E;  2YSP A;  1GTK A;  2G7H A;  4R2D A;  2E1M A;  2JY9 A;  3EPJ A;  1A1L A;  1RQ0 A;  2HGH A;  1YUI A;  1N34 E;  1A1G A;  2EN6 A;  2RS6 A;  4M9V C;  1TN9 A;  2L33 A;  3J81 C;  1YYK A;  2CT1 A;  2YTD A;  4JI0 E;  2YTQ A;  3AUZ A;  2EWL A;  2K4V A;  1WHQ A;  4DV2 E;  2JXP A;  2MDR A;  2YTP A;  3HTX A;  2WCC 3;  5KL7 A;  4WYQ B;  2V83 A;  1YYW A;  3ECR A;  2V8Q B;  2NUF A;  1EKZ A;  2YTG A;  4DR7 E;  2EQ0 A;  4DUZ E;  2EPP A;  1A1H A;  2EPN A;  2LTR A;  2VRD A;  2EM7 A;  2CPN A;  2LJH A;  2LUQ A;  4O43 A;  4RH8 A;  2L2N A;  1AAY A;  2ODR D;  1ZBQ A;  3C4T A;  2NUE A;  4X65 E;  2EQ1 A;  4R03 A;  3L00 A;  5AAS A;  2EMH A;  3BID A;  1EH6 A;  3BGH A;  2NUG A;  4K0K E;  4BBY A;  2EN4 A;  1F2I G;  3IWB A;  5KL2 A;  1WXR A;  1X47 A;  2B7T A;  2YWQ A;  2EPC A;  1A1K A;  4X8W A;  1SR9 A;  1BBO A;  1X5W A;  1X48 A;  1JK2 A;  2R76 A;  4GKK E;  5KL5 A;  2J7J A;  4R8O A;  2L8T A;  2YRK A;  4DR4 E;  3P1X A;  2EMI A;  2ENA A;  3UK3 C;  3VHT B;  4OOG C;  3EQ1 A;  2EPZ A;  2UUB E;  5IXM B;  3VYY A;  4L8N A;  3TQM A;  3C6M A;  2RS7 A;  2EPX A;  1Z1B A;  1DI2 A;  2EM9 A;  2WBU A;  4AQY E;  2EM8 A;  4TUI A;  2EN7 A;  2JOX A;  3C6K A;  4HEI A;  4BHB A;  4WXC A;  4JV5 E;  1J26 A;  4ZYD A;  4DR2 E;  1RMD A;  2NA2 A;  4JI6 E;  1XMO E;  3JU0 A;  4ZYG A;  1IBL E;  2EMC A;  4IS1 C;  4JI5 E;  2KON A;  2LO3 A;  4LTY A;  2EOQ A;  2YU8 A;  4DKK A;  3T1H E;  1QNT A;  1AH5 A;  4R2R A;  3DF6 A;  2V89 A;  4R2A A;  2B9D A;  3HQ1 A;  3HPZ A;  5LMU E;  2EOO A;  4I8O A;  4KHP E;  3K6Q A;  2EM0 A;  4J8Z A;  1PKP A;  5LLQ A;  2D9H A;  3F6H A;  1YYO A;  2YTF A;  3KZY A;  2FTX B;  5A6K A;  2VQF E;  1B69 A;  2DMI A;  4O5G A;  1X49 A;  4P7D A;  1T4N A;  2EMW A;  2EMK A;  4DMI A;  2EMG A;  1GQE A;  2LVH A;  3QG5 C;  4LF9 E;  5DNY A;  5A6J A;  5A6B A;  1J5E E;  2EPK X;  2MC6 A;  1L4S A;  4WFT A;  2EM4 A;  2BB8 A;  3J7Y p;  2JP9 A;  1MGT A;  4JI4 E;  4BCA A;  2EZ6 A;  2RSI A;  1HR0 E;  4O24 A;  2YRM A;  1A1F A;  3EPL A;  3EPH A;  1X6E A;  1NEI A;  4ZYH A;  1HNZ E;  4JI3 E;  2EPA A;  2YT4 A;  4Q35 B;  3DJW A;  3F6G A;  2EL4 A;  5A6B D;  3HXL A;  2EOI A;  4DR5 E;  4WSG A;  2MC5 A;  4DUY E;  2VE7 C;  1ZU1 A;  1KJK A;  1T4O A;  4LF7 E;  2VF1 A;  2WZO A;  4FK5 C;  5IWA E;  1A1I A;  4Q28 A;  2DSY A;  2M1S A;  2EM2 A;  4DR1 E;  2N8X A;  1YSA C;  4JI2 E;  1IQS A;  2YTO A;  2EMF A;  3ADJ A;  1TF3 A;  2YTJ A;  2EM6 A;  2PRT A;  3ADG A;  2KOU A;  2MDG A;  2N3H A;  4KZS A;  3H09 A;  2EM3 A;  2HJJ A;  4F6N A;  4P78 A;  1T38 A;  2FV4 B;  1I94 E;  4F54 A;  1KYQ A;  2EOX A;  3LLH A;  5KL6 A;  2EJ4 A;  1T4L B;  1TF6 A;  1YZ9 A;  2GLI A;  2DB2 A;  2YU5 A;  3HPS A;  4LFA E;  2YSO A;  1STU A;  2EPO A;  3JTZ A;  1FJG E;  1YPN A;  2UXB E;  4HTG A;  3OTO E;  2DMY A;  1UHZ A;  4N4R B;  1UN6 B;  3M99 B;  4DV0 E;  4RHB B;  2B3T B;  4X9J A;  5CFF E;  1UIL A;  2EOF A;  2EPL X;  2RPC A;  2YTN A;  2UXC E;  2ELZ A;  4F9B B;  2IHR 1;  3RMP A;  2JYA A;  2UU9 E;  2E5L E;  2JVA A;  4WPY A;  5A2Q C;  2RQL A;  2EN8 A;  1G2D C;  1N36 E;  4R2E A;  2EOE A;  1PJS A;  1HNW E;  4O4K A;  2EMY A;  3J7A G;  2UUC E;  2YZT A;  2EOZ A;  2RSM A;  2M9A A;  3THO B;  4BS9 A;  1P47 A;  2DLK A;  2EOH A;  4WSP A;  4NHR A;  2JR1 A;  2LE2 A;  4WX9 A;  2EL5 A;  2BBG A;  2EOY A;  5T6J A;  1FKA E;  3IWD A;  2DGC A;  2ODR C;  3THN A;  1EH8 A;  4F6M A;  2GHF A;  2EN2 A;  2EN1 A;  3MHS C;  2EQ3 A;  1SFE A;  3MSW A;  3FIG A;  4BC7 A;  4LF4 E;  2I9I A;  2E72 A;  1JK1 A;  2WBT A;  2L3J A;  4OX9 E;  1N33 E;  4YHH E;  5IT9 C;  1XNQ E;  3OML A;  1IMU A;  2ADR A;  2L3C A;  1YUJ A;  4DV1 E;  2L92 A;  1ZR9 A;  2FGG A;  2LBS B;  2F4V E;  4DR3 E;  3KWR A;  2CTD A;  1ZBT A;  2CSH A;  3ADL A;  4NZV A;  4BMJ A;  1DQ3 A;  2ENH A;  2EMX A;  4IJD A;  4X64 E;  2NAB A;  2I13 A;  2KHX A;  4LFC E;  2ENC A;  3VK6 A;  2LMZ A;  1PJT A;  1A1J A;  2JWO A;  2EOJ A;  2LTS A;  4M2Z A;  2ELY A;  3AV0 A;  5KL3 A;  5AE2 A;  4F9A B;  4DR6 E;  1X6F A;  5A6A A;  3T1Y E;  4NXM E;  2EPM X;  1IBK E;  2L6M A;  2Q8U A;  5LMN E;  4M30 A;  2EOM A;  3LML A;  1WRJ A;  2HC5 A;  2YTI A;  4R2Q A;  4GEQ B;  2EMA A;  2UUA E;  4DV3 E;  1G2F C;  1NCS A;  2EP3 A;  2V88 A;  4JI7 E;  5FLX C;  2EOS A;  2ZM6 E;  2HHH E;  2K7I A;  2V86 A;  4B3R E;  2YTE A;  2EML A;  2H36 X;  4MLQ A;  2YRH A;  2DRP A;  4WXD A;  1QU6 A;  2LJU A;  4LF8 E;  4JYA E;  4B3T E;  4BC9 A;  3BF2 A;  1PDA A;  2L2K B;  5LL6 R;  1UBD C;  1WJP A;  2EN3 A;  2JPA A;  5AC4 A;  1WHN A;  4DV6 E;  1HNX E;  3ZOQ B;  1GZ6 A;  1EH7 A;  2LV2 A;  1PJQ A;  2EE8 A;  2MKD A;  5F3W A;  1MEY C;  2EL6 A;  1XMQ E;  4L5N C;  3JAM C;  2JOB A;  4JI8 E;  2A25 A; 
#chains in the Genus database with same CATH homology
 2DLK A;  2EOH A;  2YTG A;  1B69 A;  2EQ0 A;  2DMI A;  2LCE A;  2EPP A;  1A1H A;  2VRD A;  2EM7 A;  2EL5 A;  2EOY A;  2EMW A;  2EMK A;  2DGC A;  2EMG A;  1BB8 A;  2LVH A;  4F6M A;  2GHF A;  4F2J C;  2EN2 A;  2EN1 A;  3MHS C;  1AAY A;  2EQ3 A;  1X3C A;  2E72 A;  2EM5 A;  2EM4 A;  2BB8 A;  1JK1 A;  2WBT A;  2EQ1 A;  2JP9 A;  2DLQ A;  1LLM C;  2RSI A;  2EMH A;  2EMZ A;  2YRM A;  2EN4 A;  2EMB A;  1F2I G;  1A1F A;  3EPL A;  2ADR A;  2EPU A;  5KL2 A;  3EPH A;  1X6E A;  1YUJ A;  3MHH C;  4GZN C;  2EPR A;  2EPC A;  1ZR9 A;  2EOR A;  1A1K A;  2EPA A;  1P47 A;  1BBO A;  2CTD A;  1X5W A;  2CSH A;  2EL4 A;  1JK2 A;  2ENH A;  2EOI A;  5KL5 A;  2J7J A;  2EMX A;  4WSG A;  4IJD A;  1ZAA C;  5KL4 A;  2I13 A;  2NAB A;  2YRK A;  1ZU1 A;  2EMI A;  2ENA A;  4R2S A;  3UK3 C;  1KJK A;  2ENC A;  3VHT B;  4FK5 C;  1A1J A;  1A1I A;  2EPZ A;  2EOJ A;  2EM2 A;  1YSA C;  2ELY A;  2WBS A;  4R2P A;  5KL3 A;  2YTO A;  2EPX A;  2EMF A;  1Z1B A;  1TF3 A;  2YTJ A;  2EM6 A;  2PRT A;  1DGC A;  1X6F A;  2EM9 A;  2WBU A;  2EM8 A;  3EPK A;  4R2C A;  2EN7 A;  2MKN A;  1X6H A;  2MDG A;  2EM3 A;  2R1F A;  4F6N A;  2EOM A;  2LT7 A;  1RMD A;  2YTI A;  4R2Q A;  2EOX A;  2YSP A;  2EMC A;  4IS1 C;  2EMA A;  5KL6 A;  2EJ4 A;  4R2D A;  2LO3 A;  3EPJ A;  1A1L A;  1G2F C;  1NCS A;  2EP3 A;  1TF6 A;  2EOQ A;  2YU8 A;  2EOS A;  2HGH A;  1YUI A;  2GLI A;  2YU5 A;  1A1G A;  2EN6 A;  4M9V C;  2YTE A;  2EML A;  2YSO A;  4R2R A;  1TN9 A;  2YRH A;  2DRP A;  1UN6 B;  3M99 B;  2CT1 A;  2YTD A;  4R2A A;  4X9J A;  2EOF A;  2YTN A;  2RPC A;  2YTQ A;  2EOO A;  1UBD C;  1WJP A;  2EN3 A;  2JPA A;  2EM0 A;  2EN8 A;  1G2D C;  2D9H A;  2YTP A;  4R2E A;  2EOE A;  2WCC 3;  5KL7 A;  2LV2 A;  2EE8 A;  2MKD A;  2YTF A;  1MEY C;  2EMY A;  2EL6 A;  2EOZ A;  2M9A A;  2ELZ A;  2A25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...