1TF3A

Tfiiia finger 1-3 bound to dna, nmr, 22 structures
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5S RNA GENE
publication title Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A02
4R2CA 1TF3A 1KJKA 1YUJA 2EM2A 2EM4A 5KL3A 2LO3A 1AAYA 1G2DC 2YTEA 5KL6A 4WSGA 2EL6A 1UBDC 4X9JA 2YTFA 1B69A 2DRPA 2YTGA 2EMZA 2EN7A 2EN1A 2EOHA 2EOFA 2GLIA 2DLQA 2EMAA 2YSPA 2LCEA 2NABA 2EOQA 4R2SA 1LLMC 4IJDA 2EMKA 1F2IG 2EN6A 1ZAAC 1JK2A 4F6MA 1A1LA 1TN9A 1X5WA 4R2PA 2J7JA 2PRTA 5KL2A 2MDGA 1ZU1A 2EMLA 2E72A 2YRHA 2D9HA 2LV2A 2YTJA 3EPHA 2YSOA 2ADRA 1BB8A 2GHFA 2EPZA 2EPRA 2YTDA 2EM7A 2RSIA 4FK5C 2RPCA 2EN2A 2VRDA 2ELYA 2EMHA 2WBSA 2M9AA 2WBUA 2JPAA 2YRKA 2EJ4A 1JK1A 2EQ0A 2MKDA 2EOIA 2YTPA 1DGCA 1A1FA 1BBOA 5KL4A 2EPUA 2EORA 2EM5A 2ENAA 2EPXA 2EPCA 1Z1BA 2YTQA 2EMWA 5KL5A 2HGHA 2ENCA 1NCSA 1A1JA 2EMFA 4M9VC 5KL7A 1X3CA 4IS1C 2EL4A 1P47A 2YRMA 2A25A 1TF6A 1A1IA 2EM9A 2WBTA 2BB8A 1WJPA 2EMCA 2EM3A 2EOXA 2JP9A 2CTDA 2EMXA 2DGCA 2EOJA 2EOYA 1A1GA 2EP3A 1G2FC 2EMBA 2EOZA 2EM0A 2EMIA 2EOOA 3MHSC 4R2EA 2EL5A 1UN6B 2EPAA 4R2DA 2MKNA 2YU5A 3VHTB 2WCC3 3EPLA 2YTOA 1X6FA 4R2RA 3UK3C 2EMYA 2EM6A 4R2QA 2EE8A 2LVHA 2YTNA 1X6HA 2CSHA 4F6NA 2YU8A 3M99B 2EN8A 1YUIA 1MEYC 3EPJA 2CT1A 2DLKA 2EQ3A 2EPPA 1A1HA 1YSAC 2ENHA 2EQ1A 2EN3A 2ELZA 1X6EA 1RMDA 1ZR9A 4R2AA 2YTIA 3MHHC 4GZNC 2DMIA 2I13A 2EOMA 3EPKA 2LT7A 2EOEA 2EOSA 2R1FA 1A1KA 2EN4A 2EMGA 4F2JC 2EM8A
chains in the Genus database with same CATH superfamily
2UU9E 4I8OA 3HTXA 1KJKA 4GKKE 4JI2E 2EM4A 5KL3A 2LO3A 2LTRA 5T6JA 3JAMC 2YTEA 2FTXB 3T1HE 3IWDA 1PJQA 4X9JA 2HC5A 2EMZA 2KHXA 2EOHA 2GLIA 1RQ0A 2IHR1 2YSPA 2NABA 1I94E 4IJDA 1F2IG 1JK2A 3ADIA 3LLHA 1X5WA 5AE1A 2J7JA 4X8WA 2PRTA 2DIXA 5CFFE 5A2QC 1T39A 2VE7C 3HPZA 2D9HA 3EPHA 2YSOA 4DV5E 3F6HA 2ADRA 4DUYE 2EPZA 2UXDE 1GQEA 2K7IA 3C4TA 4O4KA 4AQYE 2RPCA 5LMNE 4LF9E 1FJGE 2M9AA 2N3GA 4LU9A 3VYXA 2EJ4A 2MKDA 1DGCA 4O43A 1XNQE 2EM5A 4GEQB 1O0WA 2EMWA 4X64E 2ENCA 1YZ9A 2L8TA 1T38A 2RSMA 4NZVA 4BMJA 4LFAE 4GKJE 1ZBQA 2EM9A 2MC5A 1WJPA 4LF8E 2EOXA 2EWLA 2E1MA 2LE2A 1EH6A 3J7Yp 4DR7E 2EOYA 2V89A 3DJWA 4M0VA 4BC7A 4MLQA 2EOOA 3MHSC 3J7AG 4WXCA 4WXDA 5A6JA 4LTYA 2YU5A 3VHTB 2WCC3 1IBKE 1WRJA 2L2KB 1BBGA 3ZOQB 4LFCE 4R2QA 2EE8A 2YTNA 1X6HA 1T4OA 2KONA 5IWAE 4BS9A 4F6NA 3M99B 2DLKA 2EQ1A 2JVAA 2M7QA 2EZ6A 5AASA 3MHHC 2JXPA 4DV7E 3HXLA 5A6BD 1A1KA 4ZYGA 2EM8A 2VQFE 5DNYA 3QG5C 1XNRE 4DR3E 1IQOA 2CPNA 2Q8UA 2EPMX 3K6QA 4P7DA 3H09A 2JY9A 3IWBA 3J81C 1PJTA 4RHBB 2L92A 5KL6A 2EL6A 2V85A 1B69A 2LMZA 2JYAA 2EN7A 2EN1A 4HTGA 2EOFA 4BHBA 3DF6A 2WZOA 2LCEA 3C4BA 2EOQA 1TN9A 2RQLA 4R2PA 4JI4E 2UXBE 4DKKA 1N32E 2YT4A 4DV3E 1UILA 4WPYA 4JI5E 1BB8A 4WX9A 2DSYA 2EPRA 2M4IA 4DV6E 2EM7A 4NXNE 2RS6A 4F9AB 3ADLA 2WBSA 2YRKA 1DQ3A 2UXCE 4JYAE 2EQ0A 1BBOA 5KL4A 2EPUA 1Z1BA 2YTQA 3KZYA 5KL5A 2HHHE 1WHNA 2EMFA 1IMUA 2L33A 3F6GA 4OX9E 1TF6A 4DV1E 5LLQA 2JP9A 1PKPA 1A1GA 1SFEA 4KWYA 2EMBA 4B3TE 2EM0A 4DR2E 3C6KA 5BR8E 2JOBA 2V8QB 1KYQA 1DI2A 4JI3E 1X6FA 4R2RA 4DV4E 4DUZE 2I9IA 3L00A 2L2MA 1YPNA 2CSHA 2ZM6E 4JI0E 1MEYC 2EQ3A 1A1HA 4LFBE 2ELZA 4GZNC 2DMIA 2LT7A 2EOSA 4MLVA 2MDRA 5AE3A 1MGTA 3THOB 3TQMA 1QNTA 2EPLX 1TF3A 1XMOE 2EM2A 4DR5E 4YY3E 3VK6A 2UUAE 1AH5A 2RS7A 2L6MA 1G2DC 4M30A 2ODRD 4KZSA 3ADJA 2H36X 2N8XA 2NUFA 2DRPA 3IWCA 1IBME 1IQSA 2LTSA 4BBYA 2EMAA 2V88A 2LJHA 2EPOA 4DR1E 1LLMC 2EMKA 2EN6A 1ZAAC 4F6MA 1A1LA 2YZTA 2HJJA 1T4NA 1FKAE 2EMLA 2YRHA 2LV2A 2YTJA 2GHFA 2RSIA 2NUGA 1N3GA 1STUA 4N4RB 2EN2A 5TSEA 3T1YE 2VRDA 2EMHA 2LUPB 2WBUA 1GTKA 4O5GA 4BHCA 3MSWA 4YHHE 3HPSA 2LUQA 5AE2A 1T4LB 2EOIA 1A1FA 2V83A 3C6MA 5AC5A 2EPCA 2EPNA 4X66E 5IT9C 3JTZA 1HNXE 1HNZE 4M9VC 5KL7A 3THNA 3KWRA 1P47A 2YRMA 3LMLA 1EH7A 1A1IA 1SR9A 3EQ1A 2BB8A 2EMCA 2VQEE 2EM3A 5IV8B 3JU0A 4WSPA 5A69A 4LF6E 4JV5E 2CTDA 2EMXA 2EOJA 2KOUA 2B7TA 2EP3A 2MC6A 2NUEA 4NXME 1N36E 1G2FC 2F4VE 4B3RE 2EMIA 5F3WA 1J26A 2GPIA 4X62E 1WHQA 2EPKX 2YTOA 4DV0E 3J80C 3UK3C 4F9CB 2EM6A 3KZZA 4TUGA 2LVHA 5LL6R 2YU8A 2G7HA 2V86A 1RC7A 2VF1A 2EN8A 3BBGA 2B7VA 4B3SE 3EPJA 2F8BA 1YYWA 2ENHA 2EN3A 1ZR9A 4R2AA 2I13A 2EOMA 3EPKA 4ZYEA 2EOEA 2RTXA 4WFTA 2EN4A 2EMGA 5A6BA 4F2JC 4ZYHA 4R2CA 1L4SA 4LF4E 1YFHA 1YUJA 4X65E 2LJUA 3OTOE 2R76A 2UUCE 5FLXC 4DR6E 5A6AA 1HNWE 5ADZA 2YPNA 2V87A 2N3HA 1AAYA 4B3ME 3BGHA 4WSGA 1EKZA 2B9DA 2FV4B 1UBDC 2YTFA 1UHZA 2YTGA 4O24A 1X48A 4M2ZA 2DLQA 5A6KA 2JR1A 3BF2A 4R2SA 3AUZA 1N34E 4BC9A 3VYYA 5KL2A 2MDGA 1ZU1A 4LF7E 2LBSB 2E72A 4ZYDA 2DB2A 5LMUE 3P1XA 4DMIA 2FGGA 1J5EE 1X47A 2YTDA 4R03A 2BBGA 4Q28A 3ECRA 4FK5C 4HEIA 4JI1E 2ELYA 4WYQB 4JI6E 1HR0E 4Q35B 2L2NA 2M1SA 1YYOA 3OMLA 2JPAA 1YYKA 1JK1A 1PDAA 3BIDA 2YTPA 4J8ZA 2L3CA 4LF5E 4NHRA 2EORA 2ENAA 2EPXA 4JI7E 2JWOA 2B3TB 2NA2A 2L3JA 2HGHA 1NCSA 1A1JA 1WXRA 1X3CA 4IS1C 4JI8E 2EL4A 2ODRC 1N33E 4KHPE 2A25A 1PJSA 2WBTA 3ADGA 4OOGC 5AC4A 4F9BB 4RH8A 2DGCA 3RMPA 4DV2E 4R8OA 2EOZA 4R2EA 3FIGA 2EL5A 1UN6B 2EPAA 4R2DA 2YWQA 3EPLA 2LRSA 2MKNA 1X49A 4P78A 4DR4E 1GZ6A 2EMYA 1ZBTA 2E5LE 5IXMB 4L5NC 3HQ1A 2K4VA 1XMQE 1EH8A 1YUIA 2CT1A 2EPPA 2DMYA 4K0KE 1YSAC 2JOXA 1X6EA 1RMDA 1QU6A 2YTIA 1NEIA 4L8NA 1IBLE 2R1FA 3AV0A 4BCAA 4F54A 4TUIA 2UUBE
chains in the Genus database with same CATH topology
4R2CA 1TF3A 1KJKA 1YUJA 2EM2A 2EM4A 5KL3A 2LO3A 1AAYA 1G2DC 2YTEA 5KL6A 4WSGA 2EL6A 1UBDC 4X9JA 2YTFA 1B69A 2DRPA 2YTGA 2EMZA 2EN7A 2EN1A 2EOHA 2EOFA 2GLIA 2DLQA 2EMAA 2YSPA 2LCEA 2NABA 2EOQA 4R2SA 1LLMC 4IJDA 2EMKA 1F2IG 2EN6A 1ZAAC 1JK2A 4F6MA 1A1LA 1TN9A 1X5WA 4R2PA 2J7JA 2PRTA 5KL2A 2MDGA 1ZU1A 2EMLA 2E72A 2YRHA 2D9HA 2LV2A 2YTJA 3EPHA 2YSOA 2ADRA 1BB8A 2GHFA 2EPZA 2EPRA 2YTDA 2EM7A 2RSIA 4FK5C 2RPCA 2EN2A 2VRDA 2ELYA 2EMHA 2WBSA 2M9AA 2WBUA 2JPAA 2YRKA 2EJ4A 1JK1A 2EQ0A 2MKDA 2EOIA 2YTPA 1DGCA 1A1FA 1BBOA 5KL4A 2EPUA 2EORA 2EM5A 2ENAA 2EPXA 2EPCA 1Z1BA 2YTQA 2EMWA 5KL5A 2HGHA 2ENCA 1NCSA 1A1JA 2EMFA 4M9VC 5KL7A 1X3CA 4IS1C 2EL4A 1P47A 2YRMA 2A25A 1TF6A 1A1IA 2EM9A 2WBTA 2BB8A 1WJPA 2EMCA 2EM3A 2EOXA 2JP9A 2CTDA 2EMXA 2DGCA 2EOJA 2EOYA 1A1GA 2EP3A 1G2FC 2EMBA 2EOZA 2EM0A 2EMIA 2EOOA 3MHSC 4R2EA 2EL5A 1UN6B 2EPAA 4R2DA 2MKNA 2YU5A 3VHTB 2WCC3 3EPLA 2YTOA 1X6FA 4R2RA 3UK3C 2EMYA 2EM6A 4R2QA 2EE8A 2LVHA 2YTNA 1X6HA 2CSHA 4F6NA 2YU8A 3M99B 2EN8A 1YUIA 1MEYC 3EPJA 2CT1A 2DLKA 2EQ3A 2EPPA 1A1HA 1YSAC 2ENHA 2EQ1A 2EN3A 2ELZA 1X6EA 1RMDA 1ZR9A 4R2AA 2YTIA 3MHHC 4GZNC 2DMIA 2I13A 2EOMA 3EPKA 2LT7A 2EOEA 2EOSA 2R1FA 1A1KA 2EN4A 2EMGA 4F2JC 2EM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2C A;  1TF3 A;  1KJK A;  1YUJ A;  2EM2 A;  2EM4 A;  5KL3 A;  2LO3 A;  1AAY A;  1G2D C;  2YTE A;  5KL6 A;  4WSG A;  2EL6 A;  1UBD C;  4X9J A;  2YTF A;  1B69 A;  2DRP A;  2YTG A;  2EMZ A;  2EN7 A;  2EN1 A;  2EOH A;  2EOF A;  2GLI A;  2DLQ A;  2EMA A;  2YSP A;  2LCE A;  2NAB A;  2EOQ A;  4R2S A;  1LLM C;  4IJD A;  2EMK A;  1F2I G;  2EN6 A;  1ZAA C;  1JK2 A;  4F6M A;  1A1L A;  1TN9 A;  1X5W A;  4R2P A;  2J7J A;  2PRT A;  5KL2 A;  2MDG A;  1ZU1 A;  2EML A;  2E72 A;  2YRH A;  2D9H A;  2LV2 A;  2YTJ A;  3EPH A;  2YSO A;  2ADR A;  1BB8 A;  2GHF A;  2EPZ A;  2EPR A;  2YTD A;  2EM7 A;  2RSI A;  4FK5 C;  2RPC A;  2EN2 A;  2VRD A;  2ELY A;  2EMH A;  2WBS A;  2M9A A;  2WBU A;  2JPA A;  2YRK A;  2EJ4 A;  1JK1 A;  2EQ0 A;  2MKD A;  2EOI A;  2YTP A;  1DGC A;  1A1F A;  1BBO A;  5KL4 A;  2EPU A;  2EOR A;  2EM5 A;  2ENA A;  2EPX A;  2EPC A;  1Z1B A;  2YTQ A;  2EMW A;  5KL5 A;  2HGH A;  2ENC A;  1NCS A;  1A1J A;  2EMF A;  4M9V C;  5KL7 A;  1X3C A;  4IS1 C;  2EL4 A;  1P47 A;  2YRM A;  2A25 A;  1TF6 A;  1A1I A;  2EM9 A;  2WBT A;  2BB8 A;  1WJP A;  2EMC A;  2EM3 A;  2EOX A;  2JP9 A;  2CTD A;  2EMX A;  2DGC A;  2EOJ A;  2EOY A;  1A1G A;  2EP3 A;  1G2F C;  2EMB A;  2EOZ A;  2EM0 A;  2EMI A;  2EOO A;  3MHS C;  4R2E A;  2EL5 A;  1UN6 B;  2EPA A;  4R2D A;  2MKN A;  2YU5 A;  3VHT B;  2WCC 3;  3EPL A;  2YTO A;  1X6F A;  4R2R A;  3UK3 C;  2EMY A;  2EM6 A;  4R2Q A;  2EE8 A;  2LVH A;  2YTN A;  1X6H A;  2CSH A;  4F6N A;  2YU8 A;  3M99 B;  2EN8 A;  1YUI A;  1MEY C;  3EPJ A;  2CT1 A;  2DLK A;  2EQ3 A;  2EPP A;  1A1H A;  1YSA C;  2ENH A;  2EQ1 A;  2EN3 A;  2ELZ A;  1X6E A;  1RMD A;  1ZR9 A;  4R2A A;  2YTI A;  3MHH C;  4GZN C;  2DMI A;  2I13 A;  2EOM A;  3EPK A;  2LT7 A;  2EOE A;  2EOS A;  2R1F A;  1A1K A;  2EN4 A;  2EMG A;  4F2J C;  2EM8 A; 
#chains in the Genus database with same CATH topology
 2UU9 E;  4I8O A;  3HTX A;  1KJK A;  4GKK E;  4JI2 E;  2EM4 A;  5KL3 A;  2LO3 A;  2LTR A;  5T6J A;  3JAM C;  2YTE A;  2FTX B;  3T1H E;  3IWD A;  1PJQ A;  4X9J A;  2HC5 A;  2EMZ A;  2KHX A;  2EOH A;  2GLI A;  1RQ0 A;  2IHR 1;  2YSP A;  2NAB A;  1I94 E;  4IJD A;  1F2I G;  1JK2 A;  3ADI A;  3LLH A;  1X5W A;  5AE1 A;  2J7J A;  4X8W A;  2PRT A;  2DIX A;  5CFF E;  5A2Q C;  1T39 A;  2VE7 C;  3HPZ A;  2D9H A;  3EPH A;  2YSO A;  4DV5 E;  3F6H A;  2ADR A;  4DUY E;  2EPZ A;  2UXD E;  1GQE A;  2K7I A;  3C4T A;  4O4K A;  4AQY E;  2RPC A;  5LMN E;  4LF9 E;  1FJG E;  2M9A A;  2N3G A;  4LU9 A;  3VYX A;  2EJ4 A;  2MKD A;  1DGC A;  4O43 A;  1XNQ E;  2EM5 A;  4GEQ B;  1O0W A;  2EMW A;  4X64 E;  2ENC A;  1YZ9 A;  2L8T A;  1T38 A;  2RSM A;  4NZV A;  4BMJ A;  4LFA E;  4GKJ E;  1ZBQ A;  2EM9 A;  2MC5 A;  1WJP A;  4LF8 E;  2EOX A;  2EWL A;  2E1M A;  2LE2 A;  1EH6 A;  3J7Y p;  4DR7 E;  2EOY A;  2V89 A;  3DJW A;  4M0V A;  4BC7 A;  4MLQ A;  2EOO A;  3MHS C;  3J7A G;  4WXC A;  4WXD A;  5A6J A;  4LTY A;  2YU5 A;  3VHT B;  2WCC 3;  1IBK E;  1WRJ A;  2L2K B;  1BBG A;  3ZOQ B;  4LFC E;  4R2Q A;  2EE8 A;  2YTN A;  1X6H A;  1T4O A;  2KON A;  5IWA E;  4BS9 A;  4F6N A;  3M99 B;  2DLK A;  2EQ1 A;  2JVA A;  2M7Q A;  2EZ6 A;  5AAS A;  3MHH C;  2JXP A;  4DV7 E;  3HXL A;  5A6B D;  1A1K A;  4ZYG A;  2EM8 A;  2VQF E;  5DNY A;  3QG5 C;  1XNR E;  4DR3 E;  1IQO A;  2CPN A;  2Q8U A;  2EPM X;  3K6Q A;  4P7D A;  3H09 A;  2JY9 A;  3IWB A;  3J81 C;  1PJT A;  4RHB B;  2L92 A;  5KL6 A;  2EL6 A;  2V85 A;  1B69 A;  2LMZ A;  2JYA A;  2EN7 A;  2EN1 A;  4HTG A;  2EOF A;  4BHB A;  3DF6 A;  2WZO A;  2LCE A;  3C4B A;  2EOQ A;  1TN9 A;  2RQL A;  4R2P A;  4JI4 E;  2UXB E;  4DKK A;  1N32 E;  2YT4 A;  4DV3 E;  1UIL A;  4WPY A;  4JI5 E;  1BB8 A;  4WX9 A;  2DSY A;  2EPR A;  2M4I A;  4DV6 E;  2EM7 A;  4NXN E;  2RS6 A;  4F9A B;  3ADL A;  2WBS A;  2YRK A;  1DQ3 A;  2UXC E;  4JYA E;  2EQ0 A;  1BBO A;  5KL4 A;  2EPU A;  1Z1B A;  2YTQ A;  3KZY A;  5KL5 A;  2HHH E;  1WHN A;  2EMF A;  1IMU A;  2L33 A;  3F6G A;  4OX9 E;  1TF6 A;  4DV1 E;  5LLQ A;  2JP9 A;  1PKP A;  1A1G A;  1SFE A;  4KWY A;  2EMB A;  4B3T E;  2EM0 A;  4DR2 E;  3C6K A;  5BR8 E;  2JOB A;  2V8Q B;  1KYQ A;  1DI2 A;  4JI3 E;  1X6F A;  4R2R A;  4DV4 E;  4DUZ E;  2I9I A;  3L00 A;  2L2M A;  1YPN A;  2CSH A;  2ZM6 E;  4JI0 E;  1MEY C;  2EQ3 A;  1A1H A;  4LFB E;  2ELZ A;  4GZN C;  2DMI A;  2LT7 A;  2EOS A;  4MLV A;  2MDR A;  5AE3 A;  1MGT A;  3THO B;  3TQM A;  1QNT A;  2EPL X;  1TF3 A;  1XMO E;  2EM2 A;  4DR5 E;  4YY3 E;  3VK6 A;  2UUA E;  1AH5 A;  2RS7 A;  2L6M A;  1G2D C;  4M30 A;  2ODR D;  4KZS A;  3ADJ A;  2H36 X;  2N8X A;  2NUF A;  2DRP A;  3IWC A;  1IBM E;  1IQS A;  2LTS A;  4BBY A;  2EMA A;  2V88 A;  2LJH A;  2EPO A;  4DR1 E;  1LLM C;  2EMK A;  2EN6 A;  1ZAA C;  4F6M A;  1A1L A;  2YZT A;  2HJJ A;  1T4N A;  1FKA E;  2EML A;  2YRH A;  2LV2 A;  2YTJ A;  2GHF A;  2RSI A;  2NUG A;  1N3G A;  1STU A;  4N4R B;  2EN2 A;  5TSE A;  3T1Y E;  2VRD A;  2EMH A;  2LUP B;  2WBU A;  1GTK A;  4O5G A;  4BHC A;  3MSW A;  4YHH E;  3HPS A;  2LUQ A;  5AE2 A;  1T4L B;  2EOI A;  1A1F A;  2V83 A;  3C6M A;  5AC5 A;  2EPC A;  2EPN A;  4X66 E;  5IT9 C;  3JTZ A;  1HNX E;  1HNZ E;  4M9V C;  5KL7 A;  3THN A;  3KWR A;  1P47 A;  2YRM A;  3LML A;  1EH7 A;  1A1I A;  1SR9 A;  3EQ1 A;  2BB8 A;  2EMC A;  2VQE E;  2EM3 A;  5IV8 B;  3JU0 A;  4WSP A;  5A69 A;  4LF6 E;  4JV5 E;  2CTD A;  2EMX A;  2EOJ A;  2KOU A;  2B7T A;  2EP3 A;  2MC6 A;  2NUE A;  4NXM E;  1N36 E;  1G2F C;  2F4V E;  4B3R E;  2EMI A;  5F3W A;  1J26 A;  2GPI A;  4X62 E;  1WHQ A;  2EPK X;  2YTO A;  4DV0 E;  3J80 C;  3UK3 C;  4F9C B;  2EM6 A;  3KZZ A;  4TUG A;  2LVH A;  5LL6 R;  2YU8 A;  2G7H A;  2V86 A;  1RC7 A;  2VF1 A;  2EN8 A;  3BBG A;  2B7V A;  4B3S E;  3EPJ A;  2F8B A;  1YYW A;  2ENH A;  2EN3 A;  1ZR9 A;  4R2A A;  2I13 A;  2EOM A;  3EPK A;  4ZYE A;  2EOE A;  2RTX A;  4WFT A;  2EN4 A;  2EMG A;  5A6B A;  4F2J C;  4ZYH A;  4R2C A;  1L4S A;  4LF4 E;  1YFH A;  1YUJ A;  4X65 E;  2LJU A;  3OTO E;  2R76 A;  2UUC E;  5FLX C;  4DR6 E;  5A6A A;  1HNW E;  5ADZ A;  2YPN A;  2V87 A;  2N3H A;  1AAY A;  4B3M E;  3BGH A;  4WSG A;  1EKZ A;  2B9D A;  2FV4 B;  1UBD C;  2YTF A;  1UHZ A;  2YTG A;  4O24 A;  1X48 A;  4M2Z A;  2DLQ A;  5A6K A;  2JR1 A;  3BF2 A;  4R2S A;  3AUZ A;  1N34 E;  4BC9 A;  3VYY A;  5KL2 A;  2MDG A;  1ZU1 A;  4LF7 E;  2LBS B;  2E72 A;  4ZYD A;  2DB2 A;  5LMU E;  3P1X A;  4DMI A;  2FGG A;  1J5E E;  1X47 A;  2YTD A;  4R03 A;  2BBG A;  4Q28 A;  3ECR A;  4FK5 C;  4HEI A;  4JI1 E;  2ELY A;  4WYQ B;  4JI6 E;  1HR0 E;  4Q35 B;  2L2N A;  2M1S A;  1YYO A;  3OML A;  2JPA A;  1YYK A;  1JK1 A;  1PDA A;  3BID A;  2YTP A;  4J8Z A;  2L3C A;  4LF5 E;  4NHR A;  2EOR A;  2ENA A;  2EPX A;  4JI7 E;  2JWO A;  2B3T B;  2NA2 A;  2L3J A;  2HGH A;  1NCS A;  1A1J A;  1WXR A;  1X3C A;  4IS1 C;  4JI8 E;  2EL4 A;  2ODR C;  1N33 E;  4KHP E;  2A25 A;  1PJS A;  2WBT A;  3ADG A;  4OOG C;  5AC4 A;  4F9B B;  4RH8 A;  2DGC A;  3RMP A;  4DV2 E;  4R8O A;  2EOZ A;  4R2E A;  3FIG A;  2EL5 A;  1UN6 B;  2EPA A;  4R2D A;  2YWQ A;  3EPL A;  2LRS A;  2MKN A;  1X49 A;  4P78 A;  4DR4 E;  1GZ6 A;  2EMY A;  1ZBT A;  2E5L E;  5IXM B;  4L5N C;  3HQ1 A;  2K4V A;  1XMQ E;  1EH8 A;  1YUI A;  2CT1 A;  2EPP A;  2DMY A;  4K0K E;  1YSA C;  2JOX A;  1X6E A;  1RMD A;  1QU6 A;  2YTI A;  1NEI A;  4L8N A;  1IBL E;  2R1F A;  3AV0 A;  4BCA A;  4F54 A;  4TUI A;  2UUB E; 
#chains in the Genus database with same CATH homology
 4R2C A;  1TF3 A;  1KJK A;  1YUJ A;  2EM2 A;  2EM4 A;  5KL3 A;  2LO3 A;  1AAY A;  1G2D C;  2YTE A;  5KL6 A;  4WSG A;  2EL6 A;  1UBD C;  4X9J A;  2YTF A;  1B69 A;  2DRP A;  2YTG A;  2EMZ A;  2EN7 A;  2EN1 A;  2EOH A;  2EOF A;  2GLI A;  2DLQ A;  2EMA A;  2YSP A;  2LCE A;  2NAB A;  2EOQ A;  4R2S A;  1LLM C;  4IJD A;  2EMK A;  1F2I G;  2EN6 A;  1ZAA C;  1JK2 A;  4F6M A;  1A1L A;  1TN9 A;  1X5W A;  4R2P A;  2J7J A;  2PRT A;  5KL2 A;  2MDG A;  1ZU1 A;  2EML A;  2E72 A;  2YRH A;  2D9H A;  2LV2 A;  2YTJ A;  3EPH A;  2YSO A;  2ADR A;  1BB8 A;  2GHF A;  2EPZ A;  2EPR A;  2YTD A;  2EM7 A;  2RSI A;  4FK5 C;  2RPC A;  2EN2 A;  2VRD A;  2ELY A;  2EMH A;  2WBS A;  2M9A A;  2WBU A;  2JPA A;  2YRK A;  2EJ4 A;  1JK1 A;  2EQ0 A;  2MKD A;  2EOI A;  2YTP A;  1DGC A;  1A1F A;  1BBO A;  5KL4 A;  2EPU A;  2EOR A;  2EM5 A;  2ENA A;  2EPX A;  2EPC A;  1Z1B A;  2YTQ A;  2EMW A;  5KL5 A;  2HGH A;  2ENC A;  1NCS A;  1A1J A;  2EMF A;  4M9V C;  5KL7 A;  1X3C A;  4IS1 C;  2EL4 A;  1P47 A;  2YRM A;  2A25 A;  1TF6 A;  1A1I A;  2EM9 A;  2WBT A;  2BB8 A;  1WJP A;  2EMC A;  2EM3 A;  2EOX A;  2JP9 A;  2CTD A;  2EMX A;  2DGC A;  2EOJ A;  2EOY A;  1A1G A;  2EP3 A;  1G2F C;  2EMB A;  2EOZ A;  2EM0 A;  2EMI A;  2EOO A;  3MHS C;  4R2E A;  2EL5 A;  1UN6 B;  2EPA A;  4R2D A;  2MKN A;  2YU5 A;  3VHT B;  2WCC 3;  3EPL A;  2YTO A;  1X6F A;  4R2R A;  3UK3 C;  2EMY A;  2EM6 A;  4R2Q A;  2EE8 A;  2LVH A;  2YTN A;  1X6H A;  2CSH A;  4F6N A;  2YU8 A;  3M99 B;  2EN8 A;  1YUI A;  1MEY C;  3EPJ A;  2CT1 A;  2DLK A;  2EQ3 A;  2EPP A;  1A1H A;  1YSA C;  2ENH A;  2EQ1 A;  2EN3 A;  2ELZ A;  1X6E A;  1RMD A;  1ZR9 A;  4R2A A;  2YTI A;  3MHH C;  4GZN C;  2DMI A;  2I13 A;  2EOM A;  3EPK A;  2LT7 A;  2EOE A;  2EOS A;  2R1F A;  1A1K A;  2EN4 A;  2EMG A;  4F2J C;  2EM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...