1TF3A

Tfiiia finger 1-3 bound to dna, nmr, 22 structures
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
b'MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5S RNA GENE
publication title Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 30
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1997-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A03
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1tf3A02
2EE8A 2EPUA 2EMKA 2EOHA 2EOYA 2DRPA 2ENHA 2LVHA 2ELZA 4R2RA 2EP3A 2EMBA 2WCC3 2YTFA 2RPCA 4R2SA 2YRKA 2JP9A 2EM0A 2EOOA 1WJPA 1A1IA 2EOQA 1RMDA 4GZNC 5KL5A 1G2DC 2RSIA 2EQ3A 2EOMA 2YRHA 1A1FA 2EL6A 2EPPA 2LV2A 4F6MA 2YTQA 2EPZA 2MKNA 5KL4A 2EMWA 1YUIA 1B69A 2ENCA 2EM2A 1P47A 2EMYA 2YTDA 4IJDA 4R2CA 2EM3A 2PRTA 1BBOA 3MHHC 4R2DA 4FK5C 1TF3A 1X6HA 2EOFA 2WBTA 2YSPA 2J7JA 2EN3A 2LO3A 2JPAA 2EM5A 2DMIA 2YTPA 1A1HA 2MDGA 3M99B 3EPKA 1ZU1A 2D9HA 1ZAAC 2EQ0A 1BB8A 1AAYA 1X5WA 1DGCA 2GHFA 2EMAA 2EMHA 2MKDA 2EPAA 2EJ4A 2EN6A 1ZR9A 1NCSA 2EM8A 2EL5A 1X3CA 2EPXA 2EN4A 2LCEA 1A1LA 4R2EA 2DLQA 2EOXA 2ELYA 2EM4A 1G2FC 2EQ1A 2DLKA 2DGCA 2EN1A 2YTNA 2YU5A 2EOZA 2CTDA 2YSOA 2EMLA 2EOIA 4R2PA 2HGHA 2ENAA 4X9JA 2EPCA 2EOEA 5KL7A 2EN7A 3UK3C 1UN6B 1JK2A 3VHTB 2A25A 1A1JA 2CSHA 1KJKA 2YTOA 2CT1A 4M9VC 1F2IG 2YTGA 2BB8A 1LLMC 5KL2A 2ADRA 2LT7A 4WSGA 3EPHA 2WBUA 2I13A 1A1KA 2EM9A 2EMZA 4IS1C 2EL4A 2R1FA 2M9AA 2EMXA 2EOSA 2NABA 2EM6A 1YUJA 1X6EA 1UBDC 3EPLA 4R2QA 2EMIA 2VRDA 4F6NA 3EPJA 2EMCA 5KL3A 3MHSC 2EM7A 1MEYC 2E72A 2WBSA 2EN8A 1JK1A 1X6FA 1YSAC 4R2AA 2EMFA 2EMGA 2EN2A 2YTIA 5KL6A 4F2JC 1Z1BA 1A1GA 2YU8A 2EORA 2YTJA 2YRMA 2GLIA 2YTEA 1TN9A 2EOJA 2EPRA 1TF6A
chains in the Genus database with same CATH superfamily
4DR3E 5LMUE 4O5GA 2EOYA 2DSYA 1HNXE 4DV1E 4NHRA 5AE3A 3KWRA 4R2SA 1XMOE 2JP9A 2EM0A 5A6KA 4RH8A 2EOQA 2L6MA 4GZNC 2EOMA 3T1YE 2YRHA 2KONA 5IV8B 2MDRA 4F9CB 1MGTA 1T38A 2L33A 1I94E 2MKNA 5KL4A 2LJUA 2R76A 1B69A 1HNWE 2YTDA 2LMZA 4R2CA 4KWYA 2PRTA 1WRJA 2EPKX 4FK5C 2H36X 5AE1A 3OTOE 3F6HA 4M2ZA 4DR4E 2LUPB 2B9DA 5LMNE 2EN3A 1IBLE 1WXRA 2NUFA 3FIGA 1BB8A 2EMAA 2MKDA 2EPAA 2V89A 2VQFE 2YWQA 2UUAE 4R2EA 4I8OA 1G2FC 1EH8A 2EPLX 2LTSA 5AE2A 4DKKA 4NXNE 3LLHA 1X48A 5A6BA 4JI7E 4R2PA 2ODRC 4Q35B 2RSMA 1EH6A 5BR8E 2EPCA 5KL7A 4BS9A 3VHTB 2YTOA 2CT1A 1F2IG 2FGGA 1GZ6A 2YTGA 5KL2A 2M1SA 5AASA 4KZSA 3LMLA 1A1KA 2EM9A 2R1FA 4JI3E 1YYWA 1GQEA 4F9AB 1YUJA 4JYAE 4R2QA 4JI5E 3EPJA 5KL3A 3J81C 2Q8UA 2EM7A 1MEYC 2EN8A 4ZYEA 1YSAC 2EN2A 2YTIA 4DUYE 4F2JC 4LF5E 4LF8E 2RS6A 4DV5E 2V88A 4F54A 2EOJA 3IWDA 2B3TB 2EPUA 3BF2A 2EMKA 5IWAE 5ADZA 3MSWA 2L92A 5AC4A 4DUZE 3ECRA 2ELZA 4R2RA 2EP3A 2WCC3 4LFAE 4O4KA 3C4BA 2UU9E 2YRKA 2EOOA 1FJGE 2JVAA 1A1IA 4LF4E 1RMDA 2F4VE 1A1FA 2LV2A 1PJQA 3P1XA 5A2QC 1YFHA 2YTQA 2HJJA 4BCAA 1UILA 2ENCA 2EZ6A 1P47A 4YHHE 4K0KE 2EM3A 4R2DA 2L2NA 1DQ3A 3H09A 2M4IA 2VF1A 2WBTA 2J7JA 5TSEA 3VK6A 2JPAA 2LO3A 2EM5A 2DMIA 1A1HA 1SR9A 1PJSA 2E1MA 1WHNA 2D9HA 2ODRD 2EQ0A 1FKAE 1ZAAC 4O24A 1X5WA 1ZBTA 1DGCA 1YZ9A 2UXBE 2EJ4A 1PDAA 2LE2A 2EL5A 1X3CA 5A69A 1L4SA 4B3ME 2EPXA 2IHR1 4WFTA 2EN4A 1GTKA 4N4RB 2EM4A 2YZTA 5IXMB 2DGCA 2YPNA 2YTNA 2YU5A 2EOZA 2YT4A 3ADIA 3L00A 4LFCE 4BC7A 1XMQE 5LL6R 2HC5A 1T4LB 2FV4B 5A6AA 2EOEA 4BHBA 4DV2E 3UK3C 1N36E 4YY3E 2N8XA 4M9VC 4WPYA 2ADRA 1N32E 2L2KB 2LRSA 4R8OA 1T4NA 3AUZA 2FTXB 1X6EA 4F6NA 3KZZA 2RQLA 1J5EE 3IWBA 1QU6A 4GKKE 2WBSA 1JK1A 3J7AG 2EPOA 2L3JA 4JI8E 5KL6A 1Z1BA 2YU8A 1RQ0A 2GLIA 1X47A 3C4TA 4X65E 2UUCE 2EE8A 4MLVA 2LTRA 1N34E 1XNRE 4DR1E 1T4OA 1RC7A 3DF6A 2LVHA 2RPCA 2B7VA 1G2DC 2N3GA 2RSIA 4B3SE 3C6KA 2EQ3A 4OOGC 2NUGA 2EPZA 2K4VA 2EMWA 4WXDA 1IBKE 5T6JA 2E5LE 4DV7E 2EM2A 4BMJA 4X8WA 4WX9A 2HHHE 2EPMX 4DV4E 2EMYA 4DR5E 4IJDA 5DNYA 3BIDA 3MHHC 1XNQE 1YYKA 1YPNA 2EOFA 5AC5A 2GPIA 4JI0E 5CFFE 4LF7E 4LTYA 3TQMA 2KOUA 4DMIA 4M30A 1EKZA 3EPKA 2DMYA 3JAMC 4JV5E 1ZU1A 4B3RE 1AAYA 2L8TA 2L2MA 1N3GA 2EMHA 4KHPE 2EN6A 2JR1A 2UUBE 2B7TA 4LF6E 2EM8A 1STUA 4X66E 2EOXA 4L8NA 2ELYA 2EQ1A 2DLKA 2JOXA 4BC9A 4BBYA 3HTXA 2NA2A 4WSPA 2L3CA 2CTDA 4J8ZA 4LFBE 2EMLA 4O43A 2HGHA 4NXME 1WHQA 3THOB 4GEQB 4X9JA 2EN7A 1UN6B 1A1JA 1J26A 1KYQA 4Q28A 1KJKA 1DI2A 1LLMC 2LT7A 3EPHA 1BBGA 1T39A 4P7DA 4JI6E 2WBUA 4NZVA 4DV3E 4ZYHA 4IS1C 1PKPA 1UHZA 2I9IA 3OMLA 2KHXA 4HEIA 1NEIA 2EM6A 1X49A 4HTGA 4DV6E 1UBDC 2VRDA 2EWLA 5F3WA 4F9BB 3MHSC 3KZYA 2JY9A 2JXPA 3HPSA 1X6FA 4TUGA 2EMGA 3THNA 4DR7E 2LJHA 2VQEE 2V8QB 2YTJA 2YRMA 3J7Yp 4TUIA 1TN9A 4WXCA 2V85A 1A1GA 1IQSA 1IBME 5A6JA 2M7QA 2LBSB 3IWCA 2EOHA 2DRPA 2ENHA 2LUQA 2MC5A 2EMBA 4R03A 2YTFA 2VE7C 1HR0E 2JYAA 4LF9E 1WJPA 4LU9A 1YYOA 2BBGA 3VYYA 5KL5A 3AV0A 2DB2A 4B3TE 3JTZA 3QG5C 4DR2E 2CPNA 2EL6A 2EPPA 2JOBA 4F6MA 4L5NC 3ADLA 5FLXC 4DV0E 4RHBB 1IMUA 1YUIA 3K6QA 2NUEA 1PJTA 3VYXA 2JWOA 1IQOA 3BGHA 2DIXA 2G7HA 5A6BD 2F8BA 3ZOQB 4ZYGA 1BBOA 4P78A 3C6MA 1X6HA 1TF3A 2YSPA 4JI2E 1AH5A 2RTXA 2YTPA 3RMPA 5LLQA 2MDGA 3M99B 1ZBQA 3HQ1A 2RS7A 4ZYDA 2GHFA 2UXCE 4MLQA 4X62E 2K7IA 1ZR9A 2UXDE 1NCSA 2LCEA 1A1LA 2DLQA 1QNTA 2WZOA 2EN1A 2V83A 4X64E 4GKJE 1HNZE 3JU0A 2YSOA 2EOIA 3EQ1A 2ENAA 1SFEA 1O0WA 4DR6E 2ZM6E 1JK2A 2V86A 2A25A 3J80C 2CSHA 3HPZA 2N3HA 2BB8A 4WSGA 3F6GA 3BBGA 2MC6A 2I13A 4WYQB 2EPNA 2EMZA 2EL4A 4M0VA 2M9AA 2EMXA 2EOSA 2NABA 4JI1E 3T1HE 3EPLA 2EMIA 4AQYE 2EMCA 4OX9E 3ADJA 2V87A 2E72A 3ADGA 3HXLA 5IT9C 4R2AA 2EMFA 3DJWA 4BHCA 1N33E 4JI4E 2EORA 1EH7A 2YTEA 2EPRA 1TF6A
chains in the Genus database with same CATH topology
2EE8A 2EPUA 2EMKA 2EOHA 2EOYA 2DRPA 2ENHA 2LVHA 2ELZA 4R2RA 2EP3A 2EMBA 2WCC3 2YTFA 2RPCA 4R2SA 2YRKA 2JP9A 2EM0A 2EOOA 1WJPA 1A1IA 2EOQA 1RMDA 4GZNC 5KL5A 1G2DC 2RSIA 2EQ3A 2EOMA 2YRHA 1A1FA 2EL6A 2EPPA 2LV2A 4F6MA 2YTQA 2EPZA 2MKNA 5KL4A 2EMWA 1YUIA 1B69A 2ENCA 2EM2A 1P47A 2EMYA 2YTDA 4IJDA 4R2CA 2EM3A 2PRTA 1BBOA 3MHHC 4R2DA 4FK5C 1TF3A 1X6HA 2EOFA 2WBTA 2YSPA 2J7JA 2EN3A 2LO3A 2JPAA 2EM5A 2DMIA 2YTPA 1A1HA 2MDGA 3M99B 3EPKA 1ZU1A 2D9HA 1ZAAC 2EQ0A 1BB8A 1AAYA 1X5WA 1DGCA 2GHFA 2EMAA 2EMHA 2MKDA 2EPAA 2EJ4A 2EN6A 1ZR9A 1NCSA 2EM8A 2EL5A 1X3CA 2EPXA 2EN4A 2LCEA 1A1LA 4R2EA 2DLQA 2EOXA 2ELYA 2EM4A 1G2FC 2EQ1A 2DLKA 2DGCA 2EN1A 2YTNA 2YU5A 2EOZA 2CTDA 2YSOA 2EMLA 2EOIA 4R2PA 2HGHA 2ENAA 4X9JA 2EPCA 2EOEA 5KL7A 2EN7A 3UK3C 1UN6B 1JK2A 3VHTB 2A25A 1A1JA 2CSHA 1KJKA 2YTOA 2CT1A 4M9VC 1F2IG 2YTGA 2BB8A 1LLMC 5KL2A 2ADRA 2LT7A 4WSGA 3EPHA 2WBUA 2I13A 1A1KA 2EM9A 2EMZA 4IS1C 2EL4A 2R1FA 2M9AA 2EMXA 2EOSA 2NABA 2EM6A 1YUJA 1X6EA 1UBDC 3EPLA 4R2QA 2EMIA 2VRDA 4F6NA 3EPJA 2EMCA 5KL3A 3MHSC 2EM7A 1MEYC 2E72A 2WBSA 2EN8A 1JK1A 1X6FA 1YSAC 4R2AA 2EMFA 2EMGA 2EN2A 2YTIA 5KL6A 4F2JC 1Z1BA 1A1GA 2YU8A 2EORA 2YTJA 2YRMA 2GLIA 2YTEA 1TN9A 2EOJA 2EPRA 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EE8 A;  2EPU A;  2EMK A;  2EOH A;  2EOY A;  2DRP A;  2ENH A;  2LVH A;  2ELZ A;  4R2R A;  2EP3 A;  2EMB A;  2WCC 3;  2YTF A;  2RPC A;  4R2S A;  2YRK A;  2JP9 A;  2EM0 A;  2EOO A;  1WJP A;  1A1I A;  2EOQ A;  1RMD A;  4GZN C;  5KL5 A;  1G2D C;  2RSI A;  2EQ3 A;  2EOM A;  2YRH A;  1A1F A;  2EL6 A;  2EPP A;  2LV2 A;  4F6M A;  2YTQ A;  2EPZ A;  2MKN A;  5KL4 A;  2EMW A;  1YUI A;  1B69 A;  2ENC A;  2EM2 A;  1P47 A;  2EMY A;  2YTD A;  4IJD A;  4R2C A;  2EM3 A;  2PRT A;  1BBO A;  3MHH C;  4R2D A;  4FK5 C;  1TF3 A;  1X6H A;  2EOF A;  2WBT A;  2YSP A;  2J7J A;  2EN3 A;  2LO3 A;  2JPA A;  2EM5 A;  2DMI A;  2YTP A;  1A1H A;  2MDG A;  3M99 B;  3EPK A;  1ZU1 A;  2D9H A;  1ZAA C;  2EQ0 A;  1BB8 A;  1AAY A;  1X5W A;  1DGC A;  2GHF A;  2EMA A;  2EMH A;  2MKD A;  2EPA A;  2EJ4 A;  2EN6 A;  1ZR9 A;  1NCS A;  2EM8 A;  2EL5 A;  1X3C A;  2EPX A;  2EN4 A;  2LCE A;  1A1L A;  4R2E A;  2DLQ A;  2EOX A;  2ELY A;  2EM4 A;  1G2F C;  2EQ1 A;  2DLK A;  2DGC A;  2EN1 A;  2YTN A;  2YU5 A;  2EOZ A;  2CTD A;  2YSO A;  2EML A;  2EOI A;  4R2P A;  2HGH A;  2ENA A;  4X9J A;  2EPC A;  2EOE A;  5KL7 A;  2EN7 A;  3UK3 C;  1UN6 B;  1JK2 A;  3VHT B;  2A25 A;  1A1J A;  2CSH A;  1KJK A;  2YTO A;  2CT1 A;  4M9V C;  1F2I G;  2YTG A;  2BB8 A;  1LLM C;  5KL2 A;  2ADR A;  2LT7 A;  4WSG A;  3EPH A;  2WBU A;  2I13 A;  1A1K A;  2EM9 A;  2EMZ A;  4IS1 C;  2EL4 A;  2R1F A;  2M9A A;  2EMX A;  2EOS A;  2NAB A;  2EM6 A;  1YUJ A;  1X6E A;  1UBD C;  3EPL A;  4R2Q A;  2EMI A;  2VRD A;  4F6N A;  3EPJ A;  2EMC A;  5KL3 A;  3MHS C;  2EM7 A;  1MEY C;  2E72 A;  2WBS A;  2EN8 A;  1JK1 A;  1X6F A;  1YSA C;  4R2A A;  2EMF A;  2EMG A;  2EN2 A;  2YTI A;  5KL6 A;  4F2J C;  1Z1B A;  1A1G A;  2YU8 A;  2EOR A;  2YTJ A;  2YRM A;  2GLI A;  2YTE A;  1TN9 A;  2EOJ A;  2EPR A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 4DR3 E;  5LMU E;  4O5G A;  2EOY A;  2DSY A;  1HNX E;  4DV1 E;  4NHR A;  5AE3 A;  3KWR A;  4R2S A;  1XMO E;  2JP9 A;  2EM0 A;  5A6K A;  4RH8 A;  2EOQ A;  2L6M A;  4GZN C;  2EOM A;  3T1Y E;  2YRH A;  2KON A;  5IV8 B;  2MDR A;  4F9C B;  1MGT A;  1T38 A;  2L33 A;  1I94 E;  2MKN A;  5KL4 A;  2LJU A;  2R76 A;  1B69 A;  1HNW E;  2YTD A;  2LMZ A;  4R2C A;  4KWY A;  2PRT A;  1WRJ A;  2EPK X;  4FK5 C;  2H36 X;  5AE1 A;  3OTO E;  3F6H A;  4M2Z A;  4DR4 E;  2LUP B;  2B9D A;  5LMN E;  2EN3 A;  1IBL E;  1WXR A;  2NUF A;  3FIG A;  1BB8 A;  2EMA A;  2MKD A;  2EPA A;  2V89 A;  2VQF E;  2YWQ A;  2UUA E;  4R2E A;  4I8O A;  1G2F C;  1EH8 A;  2EPL X;  2LTS A;  5AE2 A;  4DKK A;  4NXN E;  3LLH A;  1X48 A;  5A6B A;  4JI7 E;  4R2P A;  2ODR C;  4Q35 B;  2RSM A;  1EH6 A;  5BR8 E;  2EPC A;  5KL7 A;  4BS9 A;  3VHT B;  2YTO A;  2CT1 A;  1F2I G;  2FGG A;  1GZ6 A;  2YTG A;  5KL2 A;  2M1S A;  5AAS A;  4KZS A;  3LML A;  1A1K A;  2EM9 A;  2R1F A;  4JI3 E;  1YYW A;  1GQE A;  4F9A B;  1YUJ A;  4JYA E;  4R2Q A;  4JI5 E;  3EPJ A;  5KL3 A;  3J81 C;  2Q8U A;  2EM7 A;  1MEY C;  2EN8 A;  4ZYE A;  1YSA C;  2EN2 A;  2YTI A;  4DUY E;  4F2J C;  4LF5 E;  4LF8 E;  2RS6 A;  4DV5 E;  2V88 A;  4F54 A;  2EOJ A;  3IWD A;  2B3T B;  2EPU A;  3BF2 A;  2EMK A;  5IWA E;  5ADZ A;  3MSW A;  2L92 A;  5AC4 A;  4DUZ E;  3ECR A;  2ELZ A;  4R2R A;  2EP3 A;  2WCC 3;  4LFA E;  4O4K A;  3C4B A;  2UU9 E;  2YRK A;  2EOO A;  1FJG E;  2JVA A;  1A1I A;  4LF4 E;  1RMD A;  2F4V E;  1A1F A;  2LV2 A;  1PJQ A;  3P1X A;  5A2Q C;  1YFH A;  2YTQ A;  2HJJ A;  4BCA A;  1UIL A;  2ENC A;  2EZ6 A;  1P47 A;  4YHH E;  4K0K E;  2EM3 A;  4R2D A;  2L2N A;  1DQ3 A;  3H09 A;  2M4I A;  2VF1 A;  2WBT A;  2J7J A;  5TSE A;  3VK6 A;  2JPA A;  2LO3 A;  2EM5 A;  2DMI A;  1A1H A;  1SR9 A;  1PJS A;  2E1M A;  1WHN A;  2D9H A;  2ODR D;  2EQ0 A;  1FKA E;  1ZAA C;  4O24 A;  1X5W A;  1ZBT A;  1DGC A;  1YZ9 A;  2UXB E;  2EJ4 A;  1PDA A;  2LE2 A;  2EL5 A;  1X3C A;  5A69 A;  1L4S A;  4B3M E;  2EPX A;  2IHR 1;  4WFT A;  2EN4 A;  1GTK A;  4N4R B;  2EM4 A;  2YZT A;  5IXM B;  2DGC A;  2YPN A;  2YTN A;  2YU5 A;  2EOZ A;  2YT4 A;  3ADI A;  3L00 A;  4LFC E;  4BC7 A;  1XMQ E;  5LL6 R;  2HC5 A;  1T4L B;  2FV4 B;  5A6A A;  2EOE A;  4BHB A;  4DV2 E;  3UK3 C;  1N36 E;  4YY3 E;  2N8X A;  4M9V C;  4WPY A;  2ADR A;  1N32 E;  2L2K B;  2LRS A;  4R8O A;  1T4N A;  3AUZ A;  2FTX B;  1X6E A;  4F6N A;  3KZZ A;  2RQL A;  1J5E E;  3IWB A;  1QU6 A;  4GKK E;  2WBS A;  1JK1 A;  3J7A G;  2EPO A;  2L3J A;  4JI8 E;  5KL6 A;  1Z1B A;  2YU8 A;  1RQ0 A;  2GLI A;  1X47 A;  3C4T A;  4X65 E;  2UUC E;  2EE8 A;  4MLV A;  2LTR A;  1N34 E;  1XNR E;  4DR1 E;  1T4O A;  1RC7 A;  3DF6 A;  2LVH A;  2RPC A;  2B7V A;  1G2D C;  2N3G A;  2RSI A;  4B3S E;  3C6K A;  2EQ3 A;  4OOG C;  2NUG A;  2EPZ A;  2K4V A;  2EMW A;  4WXD A;  1IBK E;  5T6J A;  2E5L E;  4DV7 E;  2EM2 A;  4BMJ A;  4X8W A;  4WX9 A;  2HHH E;  2EPM X;  4DV4 E;  2EMY A;  4DR5 E;  4IJD A;  5DNY A;  3BID A;  3MHH C;  1XNQ E;  1YYK A;  1YPN A;  2EOF A;  5AC5 A;  2GPI A;  4JI0 E;  5CFF E;  4LF7 E;  4LTY A;  3TQM A;  2KOU A;  4DMI A;  4M30 A;  1EKZ A;  3EPK A;  2DMY A;  3JAM C;  4JV5 E;  1ZU1 A;  4B3R E;  1AAY A;  2L8T A;  2L2M A;  1N3G A;  2EMH A;  4KHP E;  2EN6 A;  2JR1 A;  2UUB E;  2B7T A;  4LF6 E;  2EM8 A;  1STU A;  4X66 E;  2EOX A;  4L8N A;  2ELY A;  2EQ1 A;  2DLK A;  2JOX A;  4BC9 A;  4BBY A;  3HTX A;  2NA2 A;  4WSP A;  2L3C A;  2CTD A;  4J8Z A;  4LFB E;  2EML A;  4O43 A;  2HGH A;  4NXM E;  1WHQ A;  3THO B;  4GEQ B;  4X9J A;  2EN7 A;  1UN6 B;  1A1J A;  1J26 A;  1KYQ A;  4Q28 A;  1KJK A;  1DI2 A;  1LLM C;  2LT7 A;  3EPH A;  1BBG A;  1T39 A;  4P7D A;  4JI6 E;  2WBU A;  4NZV A;  4DV3 E;  4ZYH A;  4IS1 C;  1PKP A;  1UHZ A;  2I9I A;  3OML A;  2KHX A;  4HEI A;  1NEI A;  2EM6 A;  1X49 A;  4HTG A;  4DV6 E;  1UBD C;  2VRD A;  2EWL A;  5F3W A;  4F9B B;  3MHS C;  3KZY A;  2JY9 A;  2JXP A;  3HPS A;  1X6F A;  4TUG A;  2EMG A;  3THN A;  4DR7 E;  2LJH A;  2VQE E;  2V8Q B;  2YTJ A;  2YRM A;  3J7Y p;  4TUI A;  1TN9 A;  4WXC A;  2V85 A;  1A1G A;  1IQS A;  1IBM E;  5A6J A;  2M7Q A;  2LBS B;  3IWC A;  2EOH A;  2DRP A;  2ENH A;  2LUQ A;  2MC5 A;  2EMB A;  4R03 A;  2YTF A;  2VE7 C;  1HR0 E;  2JYA A;  4LF9 E;  1WJP A;  4LU9 A;  1YYO A;  2BBG A;  3VYY A;  5KL5 A;  3AV0 A;  2DB2 A;  4B3T E;  3JTZ A;  3QG5 C;  4DR2 E;  2CPN A;  2EL6 A;  2EPP A;  2JOB A;  4F6M A;  4L5N C;  3ADL A;  5FLX C;  4DV0 E;  4RHB B;  1IMU A;  1YUI A;  3K6Q A;  2NUE A;  1PJT A;  3VYX A;  2JWO A;  1IQO A;  3BGH A;  2DIX A;  2G7H A;  5A6B D;  2F8B A;  3ZOQ B;  4ZYG A;  1BBO A;  4P78 A;  3C6M A;  1X6H A;  1TF3 A;  2YSP A;  4JI2 E;  1AH5 A;  2RTX A;  2YTP A;  3RMP A;  5LLQ A;  2MDG A;  3M99 B;  1ZBQ A;  3HQ1 A;  2RS7 A;  4ZYD A;  2GHF A;  2UXC E;  4MLQ A;  4X62 E;  2K7I A;  1ZR9 A;  2UXD E;  1NCS A;  2LCE A;  1A1L A;  2DLQ A;  1QNT A;  2WZO A;  2EN1 A;  2V83 A;  4X64 E;  4GKJ E;  1HNZ E;  3JU0 A;  2YSO A;  2EOI A;  3EQ1 A;  2ENA A;  1SFE A;  1O0W A;  4DR6 E;  2ZM6 E;  1JK2 A;  2V86 A;  2A25 A;  3J80 C;  2CSH A;  3HPZ A;  2N3H A;  2BB8 A;  4WSG A;  3F6G A;  3BBG A;  2MC6 A;  2I13 A;  4WYQ B;  2EPN A;  2EMZ A;  2EL4 A;  4M0V A;  2M9A A;  2EMX A;  2EOS A;  2NAB A;  4JI1 E;  3T1H E;  3EPL A;  2EMI A;  4AQY E;  2EMC A;  4OX9 E;  3ADJ A;  2V87 A;  2E72 A;  3ADG A;  3HXL A;  5IT9 C;  4R2A A;  2EMF A;  3DJW A;  4BHC A;  1N33 E;  4JI4 E;  2EOR A;  1EH7 A;  2YTE A;  2EPR A;  1TF6 A; 
#chains in the Genus database with same CATH homology
 2EE8 A;  2EPU A;  2EMK A;  2EOH A;  2EOY A;  2DRP A;  2ENH A;  2LVH A;  2ELZ A;  4R2R A;  2EP3 A;  2EMB A;  2WCC 3;  2YTF A;  2RPC A;  4R2S A;  2YRK A;  2JP9 A;  2EM0 A;  2EOO A;  1WJP A;  1A1I A;  2EOQ A;  1RMD A;  4GZN C;  5KL5 A;  1G2D C;  2RSI A;  2EQ3 A;  2EOM A;  2YRH A;  1A1F A;  2EL6 A;  2EPP A;  2LV2 A;  4F6M A;  2YTQ A;  2EPZ A;  2MKN A;  5KL4 A;  2EMW A;  1YUI A;  1B69 A;  2ENC A;  2EM2 A;  1P47 A;  2EMY A;  2YTD A;  4IJD A;  4R2C A;  2EM3 A;  2PRT A;  1BBO A;  3MHH C;  4R2D A;  4FK5 C;  1TF3 A;  1X6H A;  2EOF A;  2WBT A;  2YSP A;  2J7J A;  2EN3 A;  2LO3 A;  2JPA A;  2EM5 A;  2DMI A;  2YTP A;  1A1H A;  2MDG A;  3M99 B;  3EPK A;  1ZU1 A;  2D9H A;  1ZAA C;  2EQ0 A;  1BB8 A;  1AAY A;  1X5W A;  1DGC A;  2GHF A;  2EMA A;  2EMH A;  2MKD A;  2EPA A;  2EJ4 A;  2EN6 A;  1ZR9 A;  1NCS A;  2EM8 A;  2EL5 A;  1X3C A;  2EPX A;  2EN4 A;  2LCE A;  1A1L A;  4R2E A;  2DLQ A;  2EOX A;  2ELY A;  2EM4 A;  1G2F C;  2EQ1 A;  2DLK A;  2DGC A;  2EN1 A;  2YTN A;  2YU5 A;  2EOZ A;  2CTD A;  2YSO A;  2EML A;  2EOI A;  4R2P A;  2HGH A;  2ENA A;  4X9J A;  2EPC A;  2EOE A;  5KL7 A;  2EN7 A;  3UK3 C;  1UN6 B;  1JK2 A;  3VHT B;  2A25 A;  1A1J A;  2CSH A;  1KJK A;  2YTO A;  2CT1 A;  4M9V C;  1F2I G;  2YTG A;  2BB8 A;  1LLM C;  5KL2 A;  2ADR A;  2LT7 A;  4WSG A;  3EPH A;  2WBU A;  2I13 A;  1A1K A;  2EM9 A;  2EMZ A;  4IS1 C;  2EL4 A;  2R1F A;  2M9A A;  2EMX A;  2EOS A;  2NAB A;  2EM6 A;  1YUJ A;  1X6E A;  1UBD C;  3EPL A;  4R2Q A;  2EMI A;  2VRD A;  4F6N A;  3EPJ A;  2EMC A;  5KL3 A;  3MHS C;  2EM7 A;  1MEY C;  2E72 A;  2WBS A;  2EN8 A;  1JK1 A;  1X6F A;  1YSA C;  4R2A A;  2EMF A;  2EMG A;  2EN2 A;  2YTI A;  5KL6 A;  4F2J C;  1Z1B A;  1A1G A;  2YU8 A;  2EOR A;  2YTJ A;  2YRM A;  2GLI A;  2YTE A;  1TN9 A;  2EOJ A;  2EPR A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...