3MSWA

Crystal structure of a protein with unknown function (bf3112) from bacteroides fragilis nctc 9343 at 1.90 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
139
structure length
139
Chain Sequence
GTNNGKQFIHNDTMEGGKLVCREIYAMNDAASGILNPVKMYKYSYDTDQQKTVKSTYAWNIFKNTWETESRTVISRYETETSVEYSVWNKEKGSFDLSKKYIYITDNNNQLIAQYAYKMNSRTNQWILEKDALTPIYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Protein with unknown function (BF3112) from Bacteroides fragilis NCTC 9343 at 1.90 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 25
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2010-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3mswA00
4R03A 3MSWA 4R8OA
chains in the Genus database with same CATH superfamily
2R1FA 1T4NA 5KL6A 4WSGA 4RH8A 5A2QC 1NCSA 2ENCA 4MLQA 2RSIA 2EN2A 2YTOA 2V86A 2EPCA 5A6BD 2RQLA 2GHFA 2DLQA 5LLQA 2Q8UA 1ZBQA 2YTJA 3HPZA 2EL5A 2L2MA 2I9IA 2EPMX 1WJPA 4NXNE 3K6QA 3JAMC 3VYXA 2BB8A 3IWDA 2DRPA 2NUFA 4JI7E 4LU9A 4ZYEA 1ZBTA 1L4SA 2UUBE 2EMLA 4GEQB 4L8NA 1WHNA 1PKPA 2EQ1A 2EM2A 4P7DA 2DGCA 2YWQA 2EPXA 3MHHC 4O4KA 3C4TA 2K7IA 2EN1A 4MLVA 4X65E 4P78A 3KWRA 5BR8E 2NABA 2WBTA 3OMLA 2VRDA 1PJQA 2JP9A 1YYKA 2LJUA 4F9CB 1HNZE 4KHPE 2YTGA 2YU5A 2ELYA 2UXBE 1YPNA 2M9AA 4N4RB 3TQMA 2EOJA 2L3JA 2B7TA 2YRMA 2M1SA 2CPNA 3HPSA 4DR4E 4JI0E 4M2ZA 4B3RE 2YTIA 3EPKA 1IMUA 2MC6A 1J26A 4R2EA 3J7Yp 2B7VA 2NUGA 4DV0E 4JI1E 5A6JA 2EOZA 1KJKA 5A6BA 1T4LB 2F4VE 3AUZA 4NHRA 2L3CA 5AE1A 2A25A 2EMWA 3VK6A 3JU0A 2EOSA 5AC5A 2K4VA 5A6AA 5KL2A 1PJSA 2EM8A 2EQ0A 2I13A 4OX9E 4YY3E 4WFTA 2M4IA 1DI2A 3HTXA 3EPLA 1Z1BA 3BBGA 3KZYA 1UHZA 2E72A 4HTGA 2CSHA 3ADJA 2PRTA 4TUIA 2EMHA 4JV5E 4DV5E 1IQSA 2EMZA 2EJ4A 5CFFE 2KOUA 5IWAE 2EPPA 3ECRA 3EQ1A 2EOEA 4DMIA 3C6KA 1X3CA 4DKKA 1XNQE 3T1HE 4F9BB 1JK1A 2V8QB 1SFEA 4R2PA 2YTNA 4LTYA 2E1MA 1X6FA 1ZR9A 2DMYA 3VYYA 2EP3A 2LVHA 1LLMC 4LF7E 4HEIA 3ADGA 1J5EE 2FGGA 2EE8A 1KYQA 2HGHA 4JI2E 4WSPA 4DR3E 4BCAA 1IBME 4O43A 4JI3E 3T1YE 1IBLE 1YYOA 2JYAA 3F6GA 3ADIA 2RTXA 2EORA 5LL6R 1HNWE 1XMQE 2EN3A 1N36E 4LF4E 3UK3C 3BIDA 4BBYA 4B3SE 2H36X 2ZM6E 4LF9E 4F6NA 2YTFA 4FK5C 2E5LE 4F54A 3DF6A 2LT7A 3RMPA 1DGCA 2D9HA 2EWLA 1YSAC 2B9DA 1A1IA 2YTPA 2GPIA 1A1LA 4M30A 2WCC3 5ADZA 4X62E 1GZ6A 2EPLX 2RPCA 2HC5A 1FKAE 5KL7A 2JOXA 4IJDA 1N32E 4BHBA 4X64E 2EOMA 4R03A 2FV4B 2M7QA 4DUYE 2CT1A 4ZYHA 3LMLA 1P47A 4B3ME 3AV0A 1DQ3A 1SR9A 1IBKE 1B69A 4DV7E 2L2NA 2DB2A 2EM6A 2JVAA 2DSYA 4WX9A 1RC7A 4WXDA 4DV2E 1EKZA 2DMIA 2EM3A 2EMYA 2L2KB 2BBGA 2JPAA 2HHHE 2EOYA 3MHSC 3J81C 3EPJA 2EOIA 2L92A 4R2CA 4TUGA 2UUAE 3THNA 2EMCA 1F2IG 3IWBA 3DJWA 4BS9A 4JI4E 3P1XA 1MEYC 2EN6A 2RSMA 4BC9A 1G2FC 1UN6B 2YTEA 1X6HA 2MDGA 3KZZA 3QG5C 4GZNC 1XMOE 1GQEA 2N3HA 4OOGC 1UILA 3MSWA 2WBUA 5A6KA 5FLXC 2EPZA 4WPYA 5LMUE 5KL5A 2LE2A 4K0KE 1QU6A 1O0WA 2DIXA 1BBOA 2IHR1 4R2SA 2EOOA 1TN9A 2EN8A 1A1KA 2ENAA 1MGTA 1A1JA 1YFHA 3FIGA 5AE3A 2EMGA 4AQYE 5IXMB 4M0VA 2EM0A 2HJJA 4JYAE 2EMKA 4BMJA 4DV1E 2YRKA 3J80C 5DNYA 4J8ZA 2EM4A 3H09A 5AE2A 1ZAAC 3LLHA 2WBSA 2EOXA 4DR6E 5KL3A 4DUZE 1STUA 2KONA 2LUPB 1X6EA 4YHHE 3L00A 1TF3A 2LCEA 4KWYA 5A69A 1T38A 1BB8A 1A1HA 1EH8A 2YT4A 1I94E 1G2DC 2VQFE 4DR5E 2MC5A 2EPUA 3EPHA 4Q35B 4GKKE 2R76A 4DR7E 1EH7A 4LF5E 1A1GA 4R2DA 2EMXA 2ELZA 4ZYDA 4WXCA 2V87A 2G7HA 4R2QA 2UU9E 1RQ0A 2EOFA 1PDAA 3IWCA 2V85A 1QNTA 2FTXB 5AC4A 1X48A 4KZSA 1BBGA 2EM9A 4F6MA 2EMAA 5IT9C 1XNRE 4RHBB 4L5NC 2JWOA 4LFCE 2RS7A 4ZYGA 1T39A 1N3GA 4R8OA 2JY9A 1NEIA 4I8OA 1EH6A 1FJGE 1WRJA 4R2RA 4F2JC 2LBSB 4LF6E 2UUCE 2YTDA 2EPOA 2VQEE 1HNXE 1YUIA 2EQ3A 2EN4A 4LFBE 2MDRA 1PJTA 4DR1E 1JK2A 4LFAE 5IV8B 4DV4E 4Q28A 1YUJA 4DR2E 1TF6A 1AH5A 4X9JA 2EZ6A 2EOHA 2NA2A 2EN7A 2VF1A 3HXLA 1WXRA 2F8BA 3HQ1A 4O5GA 2LUQA 3M99B 2L6MA 1IQOA 2ODRC 1GTKA 1YZ9A 4B3TE 2LMZA 4NZVA 3BGHA 4JI6E 2V89A 2UXDE 5AASA 1N34E 2L8TA 2UXCE 2YRHA 2YZTA 2YPNA 4O24A 2MKNA 2L33A 2EM7A 4X8WA 4IS1C 1A1FA 2ODRD 2LTRA 3ADLA 2EL6A 2EPRA 2EOQA 2WZOA 1N33E 1HR0E 4X66E 3BF2A 2LRSA 2V83A 2J7JA 4JI5E 2V88A 4M9VC 5TSEA 2B3TB 3THOB 2LJHA 2JXPA 2EPKX 2NUEA 2JOBA 2LV2A 4F9AB 1X47A 2JR1A 5KL4A 5LMNE 5T6JA 2EL4A 4GKJE 4WYQB 3VHTB 3C6MA 2CTDA 2MKDA 4R2AA 1RMDA 2ENHA 2LTSA 3JTZA 5F3WA 2YU8A 2YSOA 4BC7A 3J7AG 4DV6E 4LF8E 2DLKA 2GLIA 2ADRA 1AAYA 1WHQA 2N3GA 2N8XA 2EMFA 2YTQA 4NXME 2EMIA 1T4OA 2EM5A 4DV3E 1ZU1A 2VE7C 2EMBA 3OTOE 1X5WA 1X49A 3F6HA 3C4BA 4BHCA 2EPNA 2YSPA 2LO3A 1YYWA 2EPAA 2RS6A 3ZOQB 1UBDC 4JI8E 2KHXA
chains in the Genus database with same CATH topology
2UUAE 1FJGE 3ADJA 1T4NA 4TUIA 3IWBA 3DJWA 2LBSB 2UUCE 4LF6E 4BS9A 5A2QC 2VQEE 4DV5E 4JI4E 4JV5E 1HNXE 3P1XA 5CFFE 2RSMA 2KOUA 5IWAE 2V86A 4BC9A 4LFBE 1HNWE 2MDRA 4DMIA 4DR1E 1XMOE 4LFAE 4DKKA 1GQEA 1ZBQA 2N3HA 3HPZA 4DV4E 2L2MA 1XNQE 4OOGC 3T1HE 4F9BB 1UILA 2V8QB 4Q28A 4NXNE 3MSWA 3K6QA 3JAMC 4DR2E 3VYXA 5FLXC 4WPYA 5LMUE 4LTYA 2EZ6A 2E1MA 2NA2A 2LE2A 3IWDA 2NUFA 4JI7E 2DMYA 4LU9A 3VYYA 2VF1A 3HXLA 1WXRA 2F8BA 3HQ1A 4K0KE 1QU6A 1O0WA 1ZBTA 4LF7E 2DIXA 3ADGA 1J5EE 2LUQA 2IHR1 2FGGA 2UUBE 2L6MA 4GEQB 2ODRC 4L8NA 1WHNA 4JI2E 1PKPA 1YZ9A 4WSPA 2LMZA 4P7DA 4B3TE 4DR3E 4JI6E 4BCAA 2NUGA 2V89A 1IBME 3FIGA 5AASA 5AE3A 2L8TA 3T1YE 1N34E 1IBLE 4AQYE 4JI3E 2UXCE 2YZTA 4M0VA 3C4TA 1YYOA 2L33A 3F6GA 3ADIA 4JYAE 2RTXA 4X8WA 4BMJA 4X65E 4P78A 3KWRA 5LL6R 4DV1E 5BR8E 3J80C 1XMQE 2ODRD 5DNYA 1N36E 2LTRA 4J8ZA 3H09A 4LF4E 4LF8E 3ADLA 5AE2A 3LLHA 4BBYA 4B3SE 4DR6E 3OMLA 4DUZE 2WZOA 1N33E 1STUA 2KONA 2H36X 2LUPB 1HR0E 4X66E 4YHHE 2ZM6E 4LF9E 2LRSA 2V83A 1YYKA 2E5LE 4F9CB 4F54A 1HNZE 4JI5E 4KHPE 3DF6A 2V88A 3RMPA 2B3TB 2YT4A 2UXBE 1I94E 2LJHA 2VQFE 2EWLA 2MC5A 4DR5E 2NUEA 2JOBA 2B7TA 4F9AB 2L3JA 4GKKE 2B9DA 1X47A 2M1SA 4DR7E 2JR1A 2CPNA 3ZOQB 5LMNE 3HPSA 4LF5E 5T6JA 4DR4E 4JI0E 4M30A 4M2ZA 4WYQB 5ADZA 4X62E 4B3RE 1GZ6A 4GKJE 2V87A 1FKAE 2LTSA 2G7HA 2MC6A 2JOXA 3JTZA 5F3WA 1N32E 1J26A 4BC7A 3J7Yp 2UU9E 3J7AG 1RQ0A 4X64E 2B7VA 4R03A 2FV4B 2M7QA 3IWCA 2V85A 4DV0E 2FTXB 4DUYE 4DV6E 1T4LB 4JI1E 1X48A 2F4VE 3AUZA 3LMLA 1WHQA 2N3GA 4B3ME 2L3CA 5AE1A 3AV0A 4KZSA 1DQ3A 1SR9A 3VK6A 4NXME 3JU0A 1IBKE 2K4VA 5IT9C 4DV7E 1XNRE 2L2NA 2DB2A 4L5NC 2JWOA 1T4OA 4LFCE 2JVAA 2RS7A 2DSYA 2VE7C 4DV3E 1RC7A 3OTOE 4DV2E 1EKZA 4OX9E 4YY3E 1X49A 4R8OA 4WFTA 3F6HA 2JY9A 3C4BA 2L2KB 2M4IA 1DI2A 3HTXA 2HHHE 1YYWA 4I8OA 2UXDE 3J81C 2RS6A 1UHZA 2L92A 4JI8E 2KHXA 4TUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R03 A;  3MSW A;  4R8O A; 
#chains in the Genus database with same CATH topology
 2R1F A;  1T4N A;  5KL6 A;  4WSG A;  4RH8 A;  5A2Q C;  1NCS A;  2ENC A;  4MLQ A;  2RSI A;  2EN2 A;  2YTO A;  2V86 A;  2EPC A;  5A6B D;  2RQL A;  2GHF A;  2DLQ A;  5LLQ A;  2Q8U A;  1ZBQ A;  2YTJ A;  3HPZ A;  2EL5 A;  2L2M A;  2I9I A;  2EPM X;  1WJP A;  4NXN E;  3K6Q A;  3JAM C;  3VYX A;  2BB8 A;  3IWD A;  2DRP A;  2NUF A;  4JI7 E;  4LU9 A;  4ZYE A;  1ZBT A;  1L4S A;  2UUB E;  2EML A;  4GEQ B;  4L8N A;  1WHN A;  1PKP A;  2EQ1 A;  2EM2 A;  4P7D A;  2DGC A;  2YWQ A;  2EPX A;  3MHH C;  4O4K A;  3C4T A;  2K7I A;  2EN1 A;  4MLV A;  4X65 E;  4P78 A;  3KWR A;  5BR8 E;  2NAB A;  2WBT A;  3OML A;  2VRD A;  1PJQ A;  2JP9 A;  1YYK A;  2LJU A;  4F9C B;  1HNZ E;  4KHP E;  2YTG A;  2YU5 A;  2ELY A;  2UXB E;  1YPN A;  2M9A A;  4N4R B;  3TQM A;  2EOJ A;  2L3J A;  2B7T A;  2YRM A;  2M1S A;  2CPN A;  3HPS A;  4DR4 E;  4JI0 E;  4M2Z A;  4B3R E;  2YTI A;  3EPK A;  1IMU A;  2MC6 A;  1J26 A;  4R2E A;  3J7Y p;  2B7V A;  2NUG A;  4DV0 E;  4JI1 E;  5A6J A;  2EOZ A;  1KJK A;  5A6B A;  1T4L B;  2F4V E;  3AUZ A;  4NHR A;  2L3C A;  5AE1 A;  2A25 A;  2EMW A;  3VK6 A;  3JU0 A;  2EOS A;  5AC5 A;  2K4V A;  5A6A A;  5KL2 A;  1PJS A;  2EM8 A;  2EQ0 A;  2I13 A;  4OX9 E;  4YY3 E;  4WFT A;  2M4I A;  1DI2 A;  3HTX A;  3EPL A;  1Z1B A;  3BBG A;  3KZY A;  1UHZ A;  2E72 A;  4HTG A;  2CSH A;  3ADJ A;  2PRT A;  4TUI A;  2EMH A;  4JV5 E;  4DV5 E;  1IQS A;  2EMZ A;  2EJ4 A;  5CFF E;  2KOU A;  5IWA E;  2EPP A;  3ECR A;  3EQ1 A;  2EOE A;  4DMI A;  3C6K A;  1X3C A;  4DKK A;  1XNQ E;  3T1H E;  4F9B B;  1JK1 A;  2V8Q B;  1SFE A;  4R2P A;  2YTN A;  4LTY A;  2E1M A;  1X6F A;  1ZR9 A;  2DMY A;  3VYY A;  2EP3 A;  2LVH A;  1LLM C;  4LF7 E;  4HEI A;  3ADG A;  1J5E E;  2FGG A;  2EE8 A;  1KYQ A;  2HGH A;  4JI2 E;  4WSP A;  4DR3 E;  4BCA A;  1IBM E;  4O43 A;  4JI3 E;  3T1Y E;  1IBL E;  1YYO A;  2JYA A;  3F6G A;  3ADI A;  2RTX A;  2EOR A;  5LL6 R;  1HNW E;  1XMQ E;  2EN3 A;  1N36 E;  4LF4 E;  3UK3 C;  3BID A;  4BBY A;  4B3S E;  2H36 X;  2ZM6 E;  4LF9 E;  4F6N A;  2YTF A;  4FK5 C;  2E5L E;  4F54 A;  3DF6 A;  2LT7 A;  3RMP A;  1DGC A;  2D9H A;  2EWL A;  1YSA C;  2B9D A;  1A1I A;  2YTP A;  2GPI A;  1A1L A;  4M30 A;  2WCC 3;  5ADZ A;  4X62 E;  1GZ6 A;  2EPL X;  2RPC A;  2HC5 A;  1FKA E;  5KL7 A;  2JOX A;  4IJD A;  1N32 E;  4BHB A;  4X64 E;  2EOM A;  4R03 A;  2FV4 B;  2M7Q A;  4DUY E;  2CT1 A;  4ZYH A;  3LML A;  1P47 A;  4B3M E;  3AV0 A;  1DQ3 A;  1SR9 A;  1IBK E;  1B69 A;  4DV7 E;  2L2N A;  2DB2 A;  2EM6 A;  2JVA A;  2DSY A;  4WX9 A;  1RC7 A;  4WXD A;  4DV2 E;  1EKZ A;  2DMI A;  2EM3 A;  2EMY A;  2L2K B;  2BBG A;  2JPA A;  2HHH E;  2EOY A;  3MHS C;  3J81 C;  3EPJ A;  2EOI A;  2L92 A;  4R2C A;  4TUG A;  2UUA E;  3THN A;  2EMC A;  1F2I G;  3IWB A;  3DJW A;  4BS9 A;  4JI4 E;  3P1X A;  1MEY C;  2EN6 A;  2RSM A;  4BC9 A;  1G2F C;  1UN6 B;  2YTE A;  1X6H A;  2MDG A;  3KZZ A;  3QG5 C;  4GZN C;  1XMO E;  1GQE A;  2N3H A;  4OOG C;  1UIL A;  3MSW A;  2WBU A;  5A6K A;  5FLX C;  2EPZ A;  4WPY A;  5LMU E;  5KL5 A;  2LE2 A;  4K0K E;  1QU6 A;  1O0W A;  2DIX A;  1BBO A;  2IHR 1;  4R2S A;  2EOO A;  1TN9 A;  2EN8 A;  1A1K A;  2ENA A;  1MGT A;  1A1J A;  1YFH A;  3FIG A;  5AE3 A;  2EMG A;  4AQY E;  5IXM B;  4M0V A;  2EM0 A;  2HJJ A;  4JYA E;  2EMK A;  4BMJ A;  4DV1 E;  2YRK A;  3J80 C;  5DNY A;  4J8Z A;  2EM4 A;  3H09 A;  5AE2 A;  1ZAA C;  3LLH A;  2WBS A;  2EOX A;  4DR6 E;  5KL3 A;  4DUZ E;  1STU A;  2KON A;  2LUP B;  1X6E A;  4YHH E;  3L00 A;  1TF3 A;  2LCE A;  4KWY A;  5A69 A;  1T38 A;  1BB8 A;  1A1H A;  1EH8 A;  2YT4 A;  1I94 E;  1G2D C;  2VQF E;  4DR5 E;  2MC5 A;  2EPU A;  3EPH A;  4Q35 B;  4GKK E;  2R76 A;  4DR7 E;  1EH7 A;  4LF5 E;  1A1G A;  4R2D A;  2EMX A;  2ELZ A;  4ZYD A;  4WXC A;  2V87 A;  2G7H A;  4R2Q A;  2UU9 E;  1RQ0 A;  2EOF A;  1PDA A;  3IWC A;  2V85 A;  1QNT A;  2FTX B;  5AC4 A;  1X48 A;  4KZS A;  1BBG A;  2EM9 A;  4F6M A;  2EMA A;  5IT9 C;  1XNR E;  4RHB B;  4L5N C;  2JWO A;  4LFC E;  2RS7 A;  4ZYG A;  1T39 A;  1N3G A;  4R8O A;  2JY9 A;  1NEI A;  4I8O A;  1EH6 A;  1FJG E;  1WRJ A;  4R2R A;  4F2J C;  2LBS B;  4LF6 E;  2UUC E;  2YTD A;  2EPO A;  2VQE E;  1HNX E;  1YUI A;  2EQ3 A;  2EN4 A;  4LFB E;  2MDR A;  1PJT A;  4DR1 E;  1JK2 A;  4LFA E;  5IV8 B;  4DV4 E;  4Q28 A;  1YUJ A;  4DR2 E;  1TF6 A;  1AH5 A;  4X9J A;  2EZ6 A;  2EOH A;  2NA2 A;  2EN7 A;  2VF1 A;  3HXL A;  1WXR A;  2F8B A;  3HQ1 A;  4O5G A;  2LUQ A;  3M99 B;  2L6M A;  1IQO A;  2ODR C;  1GTK A;  1YZ9 A;  4B3T E;  2LMZ A;  4NZV A;  3BGH A;  4JI6 E;  2V89 A;  2UXD E;  5AAS A;  1N34 E;  2L8T A;  2UXC E;  2YRH A;  2YZT A;  2YPN A;  4O24 A;  2MKN A;  2L33 A;  2EM7 A;  4X8W A;  4IS1 C;  1A1F A;  2ODR D;  2LTR A;  3ADL A;  2EL6 A;  2EPR A;  2EOQ A;  2WZO A;  1N33 E;  1HR0 E;  4X66 E;  3BF2 A;  2LRS A;  2V83 A;  2J7J A;  4JI5 E;  2V88 A;  4M9V C;  5TSE A;  2B3T B;  3THO B;  2LJH A;  2JXP A;  2EPK X;  2NUE A;  2JOB A;  2LV2 A;  4F9A B;  1X47 A;  2JR1 A;  5KL4 A;  5LMN E;  5T6J A;  2EL4 A;  4GKJ E;  4WYQ B;  3VHT B;  3C6M A;  2CTD A;  2MKD A;  4R2A A;  1RMD A;  2ENH A;  2LTS A;  3JTZ A;  5F3W A;  2YU8 A;  2YSO A;  4BC7 A;  3J7A G;  4DV6 E;  4LF8 E;  2DLK A;  2GLI A;  2ADR A;  1AAY A;  1WHQ A;  2N3G A;  2N8X A;  2EMF A;  2YTQ A;  4NXM E;  2EMI A;  1T4O A;  2EM5 A;  4DV3 E;  1ZU1 A;  2VE7 C;  2EMB A;  3OTO E;  1X5W A;  1X49 A;  3F6H A;  3C4B A;  4BHC A;  2EPN A;  2YSP A;  2LO3 A;  1YYW A;  2EPA A;  2RS6 A;  3ZOQ B;  1UBD C;  4JI8 E;  2KHX A; 
#chains in the Genus database with same CATH homology
 2UUA E;  1FJG E;  3ADJ A;  1T4N A;  4TUI A;  3IWB A;  3DJW A;  2LBS B;  2UUC E;  4LF6 E;  4BS9 A;  5A2Q C;  2VQE E;  4DV5 E;  4JI4 E;  4JV5 E;  1HNX E;  3P1X A;  5CFF E;  2RSM A;  2KOU A;  5IWA E;  2V86 A;  4BC9 A;  4LFB E;  1HNW E;  2MDR A;  4DMI A;  4DR1 E;  1XMO E;  4LFA E;  4DKK A;  1GQE A;  1ZBQ A;  2N3H A;  3HPZ A;  4DV4 E;  2L2M A;  1XNQ E;  4OOG C;  3T1H E;  4F9B B;  1UIL A;  2V8Q B;  4Q28 A;  4NXN E;  3MSW A;  3K6Q A;  3JAM C;  4DR2 E;  3VYX A;  5FLX C;  4WPY A;  5LMU E;  4LTY A;  2EZ6 A;  2E1M A;  2NA2 A;  2LE2 A;  3IWD A;  2NUF A;  4JI7 E;  2DMY A;  4LU9 A;  3VYY A;  2VF1 A;  3HXL A;  1WXR A;  2F8B A;  3HQ1 A;  4K0K E;  1QU6 A;  1O0W A;  1ZBT A;  4LF7 E;  2DIX A;  3ADG A;  1J5E E;  2LUQ A;  2IHR 1;  2FGG A;  2UUB E;  2L6M A;  4GEQ B;  2ODR C;  4L8N A;  1WHN A;  4JI2 E;  1PKP A;  1YZ9 A;  4WSP A;  2LMZ A;  4P7D A;  4B3T E;  4DR3 E;  4JI6 E;  4BCA A;  2NUG A;  2V89 A;  1IBM E;  3FIG A;  5AAS A;  5AE3 A;  2L8T A;  3T1Y E;  1N34 E;  1IBL E;  4AQY E;  4JI3 E;  2UXC E;  2YZT A;  4M0V A;  3C4T A;  1YYO A;  2L33 A;  3F6G A;  3ADI A;  4JYA E;  2RTX A;  4X8W A;  4BMJ A;  4X65 E;  4P78 A;  3KWR A;  5LL6 R;  4DV1 E;  5BR8 E;  3J80 C;  1XMQ E;  2ODR D;  5DNY A;  1N36 E;  2LTR A;  4J8Z A;  3H09 A;  4LF4 E;  4LF8 E;  3ADL A;  5AE2 A;  3LLH A;  4BBY A;  4B3S E;  4DR6 E;  3OML A;  4DUZ E;  2WZO A;  1N33 E;  1STU A;  2KON A;  2H36 X;  2LUP B;  1HR0 E;  4X66 E;  4YHH E;  2ZM6 E;  4LF9 E;  2LRS A;  2V83 A;  1YYK A;  2E5L E;  4F9C B;  4F54 A;  1HNZ E;  4JI5 E;  4KHP E;  3DF6 A;  2V88 A;  3RMP A;  2B3T B;  2YT4 A;  2UXB E;  1I94 E;  2LJH A;  2VQF E;  2EWL A;  2MC5 A;  4DR5 E;  2NUE A;  2JOB A;  2B7T A;  4F9A B;  2L3J A;  4GKK E;  2B9D A;  1X47 A;  2M1S A;  4DR7 E;  2JR1 A;  2CPN A;  3ZOQ B;  5LMN E;  3HPS A;  4LF5 E;  5T6J A;  4DR4 E;  4JI0 E;  4M30 A;  4M2Z A;  4WYQ B;  5ADZ A;  4X62 E;  4B3R E;  1GZ6 A;  4GKJ E;  2V87 A;  1FKA E;  2LTS A;  2G7H A;  2MC6 A;  2JOX A;  3JTZ A;  5F3W A;  1N32 E;  1J26 A;  4BC7 A;  3J7Y p;  2UU9 E;  3J7A G;  1RQ0 A;  4X64 E;  2B7V A;  4R03 A;  2FV4 B;  2M7Q A;  3IWC A;  2V85 A;  4DV0 E;  2FTX B;  4DUY E;  4DV6 E;  1T4L B;  4JI1 E;  1X48 A;  2F4V E;  3AUZ A;  3LML A;  1WHQ A;  2N3G A;  4B3M E;  2L3C A;  5AE1 A;  3AV0 A;  4KZS A;  1DQ3 A;  1SR9 A;  3VK6 A;  4NXM E;  3JU0 A;  1IBK E;  2K4V A;  5IT9 C;  4DV7 E;  1XNR E;  2L2N A;  2DB2 A;  4L5N C;  2JWO A;  1T4O A;  4LFC E;  2JVA A;  2RS7 A;  2DSY A;  2VE7 C;  4DV3 E;  1RC7 A;  3OTO E;  4DV2 E;  1EKZ A;  4OX9 E;  4YY3 E;  1X49 A;  4R8O A;  4WFT A;  3F6H A;  2JY9 A;  3C4B A;  2L2K B;  2M4I A;  1DI2 A;  3HTX A;  2HHH E;  1YYW A;  4I8O A;  2UXD E;  3J81 C;  2RS6 A;  1UHZ A;  2L92 A;  4JI8 E;  2KHX A;  4TUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...