3MSWA

Crystal structure of a protein with unknown function (bf3112) from bacteroides fragilis nctc 9343 at 1.90 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
139
structure length
139
Chain Sequence
GTNNGKQFIHNDTMEGGKLVCREIYAMNDAASGILNPVKMYKYSYDTDQQKTVKSTYAWNIFKNTWETESRTVISRYETETSVEYSVWNKEKGSFDLSKKYIYITDNNNQLIAQYAYKMNSRTNQWILEKDALTPIYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of a Protein with unknown function (BF3112) from Bacteroides fragilis NCTC 9343 at 1.90 A resolution
rcsb
source organism Bacteroides fragilis
total genus 25
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2010-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3mswA00
4R8OA 3MSWA 4R03A
chains in the Genus database with same CATH superfamily
2EP3A 2EPPA 3TQMA 2N3HA 4BHBA 2UUAE 4R8OA 4J8ZA 2EM2A 4B3TE 5AE2A 3VYYA 2M7QA 2WBTA 5AC4A 4JI6E 1L4SA 2EJ4A 2M1SA 1AAYA 4JI7E 1A1HA 4JI0E 1PJTA 4DMIA 2CSHA 2LO3A 3BIDA 2NUEA 2YTDA 2JWOA 4R2PA 3AUZA 3J80C 3J7Yp 4JI3E 1T4NA 2EE8A 4LF6E 2VQFE 2L2KB 4OOGC 1IBKE 2EZ6A 1N36E 5DNYA 1AH5A 2L6MA 1I94E 2HC5A 1DQ3A 2EMGA 1YUIA 4JYAE 2M4IA 3THNA 4O4KA 2EQ3A 2NUFA 2PRTA 2GPIA 2L2NA 4DV1E 2HHHE 1WJPA 2EPKX 1T4OA 2MC6A 3H09A 4B3RE 2BBGA 3C4BA 2ENHA 1X3CA 4JV5E 2V8QB 2EMZA 4RHBB 2ODRC 2EPAA 4GZNC 1NCSA 2KONA 2R1FA 4JI4E 2Q8UA 4R2SA 2LJUA 1FJGE 2JXPA 2JYAA 1J26A 1BBGA 2EM4A 2WBUA 1QNTA 2DMYA 4B3SE 2VQEE 1N32E 3BGHA 2EM6A 3EQ1A 2EQ1A 4GKJE 4BMJA 1IQSA 1WXRA 2LUPB 1A1GA 4F6MA 2JPAA 2EPUA 3LLHA 3DJWA 3EPLA 4ZYHA 4WYQB 2LRSA 1T4LB 2EN3A 4IS1C 3BF2A 2EMYA 2EPZA 1XMOE 2YZTA 5LMNE 2EOIA 1RMDA 4F6NA 5ADZA 1PDAA 3L00A 4TUGA 5IWAE 2EMWA 2YU8A 2EOXA 1KJKA 1RQ0A 1YUJA 4LF8E 2ODRD 2L33A 3ADGA 2DLKA 4ZYEA 4F2JC 2EL6A 1TN9A 2NA2A 1QU6A 1WHQA 4L5NC 4LFBE 4DV2E 1GQEA 2RS6A 1XNRE 2DRPA 5BR8E 2YT4A 2I9IA 2YPNA 2WCC3 2UU9E 2E72A 2EM9A 3VYXA 4X64E 2EMFA 4LF4E 2N3GA 5LMUE 2ADRA 4F9CB 2LJHA 1N33E 2RPCA 1ZR9A 5A6KA 1ZAAC 3M99B 3P1XA 3C6KA 4X8WA 1HNWE 4RH8A 2EOZA 4M30A 2ZM6E 1DGCA 3ADJA 2EM8A 2JR1A 2MDRA 2V86A 1F2IG 1ZBQA 2K4VA 2DB2A 4NZVA 4DV6E 4F54A 2GHFA 2V83A 1A1JA 2EN6A 3T1HE 2L92A 2YRMA 3F6HA 4WSGA 3HPZA 1UBDC 2MDGA 2MKDA 3ADLA 4X66E 4GEQB 1EH8A 5CFFE 2NABA 1IBME 4K0KE 4YY3E 3QG5C 5T6JA 1EH7A 2RSMA 5A6AA 1BBOA 3EPHA 2L8TA 1STUA 1XMQE 4LFCE 1XNQE 4R2DA 1PJQA 4JI2E 4WSPA 2M9AA 4FK5C 4LF5E 2CTDA 2EMKA 4X9JA 2JVAA 3OMLA 2VE7C 2A25A 1X6EA 4LU9A 2L3CA 4X62E 3ECRA 4R2AA 4M0VA 4R2QA 3OTOE 2EOYA 2V88A 2EN8A 2UUCE 1PKPA 1X6HA 1YFHA 2DLQA 5LL6R 3JAMC 2BB8A 3JTZA 2L3JA 1IMUA 2KOUA 2LT7A 2DGCA 4M9VC 2JOBA 2RSIA 2JP9A 4LF9E 2EWLA 4R2EA 1EH6A 2EMBA 4DR2E 1UHZA 2EM5A 3VK6A 5LLQA 2ENCA 4DV4E 4TUIA 1O0WA 1YSAC 2B3TB 1A1KA 4I8OA 2B7TA 4NXNE 2JOXA 2ELYA 5KL7A 2IHR1 1G2FC 1TF3A 3MHSC 3IWDA 3MHHC 5A6BD 2EM3A 2V87A 4OX9E 4LF7E 4MLVA 3C4TA 2HGHA 5KL5A 5KL6A 5KL4A 2YSPA 4DV7E 2H36X 3HXLA 2L2MA 5KL3A 2LTRA 2EOFA 2DSYA 2YTOA 2YRHA 2YTFA 1A1LA 2YTIA 3BBGA 4ZYGA 2G7HA 4F9BB 2F4VE 2EMHA 3AV0A 2EN7A 1YPNA 4B3ME 4BS9A 4NHRA 2EN4A 4X65E 2EOJA 2EMIA 1X6FA 2LE2A 2WBSA 5FLXC 1N3GA 5IXMB 4BC9A 2E5LE 4LFAE 5IV8B 2GLIA 2ELZA 2EM7A 2EOSA 2WZOA 3EPKA 4NXME 1JK1A 5IT9C 2EOQA 2YU5A 2EOOA 4DKKA 1LLMC 4DV5E 3IWCA 2I13A 3LMLA 1J5EE 2KHXA 4MLQA 2VF1A 1X47A 2V89A 1YZ9A 4O24A 1NEIA 3ADIA 2RTXA 2EOEA 2UXBE 1P47A 4ZYDA 1PJSA 4P78A 2VRDA 5F3WA 4DR4E 1X49A 2EPCA 5KL2A 3F6GA 3KZZA 4IJDA 1HR0E 2EPRA 1HNXE 1FKAE 2LCEA 3ZOQB 2YTEA 2CT1A 2N8XA 3HPSA 3HQ1A 1MGTA 1A1FA 2UXDE 1RC7A 3HTXA 2EQ0A 2EL4A 4BHCA 4KZSA 1A1IA 3RMPA 4DR6E 4KHPE 1G2DC 1T39A 4DUZE 3FIGA 3J7AG 3IWBA 2YRKA 1HNZE 2MKNA 4F9AB 4LTYA 4R03A 4M2ZA 2EMLA 2EMXA 1X48A 5A6BA 2YWQA 4JI5E 3KZYA 2FTXB 1WRJA 2EPXA 2EMCA 1YYOA 1ZBTA 4R2CA 1Z1BA 4DV0E 2HJJA 2V85A 5A69A 2UUBE 4HEIA 4Q35B 4BBYA 4WPYA 1IQOA 4DUYE 2DMIA 4WXDA 4AQYE 1BB8A 1WHNA 2EM0A 1YYKA 1B69A 2LMZA 3K6QA 1GZ6A 1X5WA 2F8BA 2B9DA 1SR9A 2RQLA 2J7JA 3MSWA 1DI2A 2UXCE 2EN1A 2NUGA 1ZU1A 2JY9A 4Q28A 2YTNA 2EPLX 2EN2A 2K7IA 4L8NA 4DR1E 3KWRA 2EPMX 2R76A 4DR7E 5AE1A 5AC5A 4JI1E 2D9HA 5TSEA 4DV3E 1SFEA 4BCAA 1TF6A 5A6JA 4DR5E 5AE3A 2RS7A 4P7DA 2CPNA 2YTPA 4O43A 2EOHA 1T38A 4KWYA 4HTGA 2YSOA 2YTGA 1IBLE 2ENAA 1UILA 2EPNA 3J81C 4DR3E 2EMAA 4YHHE 2LUQA 3T1YE 3VHTB 4BC7A 2LV2A 2MC5A 3THOB 1MEYC 5A2QC 1KYQA 2DIXA 3UK3C 4JI8E 2EPOA 2EOMA 2EORA 1UN6B 2LVHA 5AASA 4R2RA 2LBSB 2YTJA 3JU0A 3C6MA 1N34E 4N4RB 4GKKE 4O5GA 3DF6A 2FGGA 2EL5A 4WXCA 1JK2A 2B7VA 2YTQA 1EKZA 2E1MA 4WFTA 3EPJA 2FV4B 1YYWA 1GTKA 4WX9A 2LTSA
chains in the Genus database with same CATH topology
4DR6E 4DV4E 4KHPE 4TUIA 1O0WA 2N3HA 2B3TB 3FIGA 4DUZE 2UUAE 4JI6E 3IWBA 2B7TA 4I8OA 4J8ZA 4R8OA 4B3TE 4NXNE 3J7AG 2JOXA 2NA2A 1QU6A 1WHQA 4L5NC 5AE2A 1HNZE 4LFBE 2IHR1 4LTYA 4R03A 2M7QA 4F9AB 3VYYA 3IWDA 2M1SA 1GQEA 4DV2E 4M2ZA 4JI7E 2RS6A 2V87A 4JI0E 4DMIA 4OX9E 1XNRE 1X48A 5BR8E 2NUEA 4JI5E 2YT4A 4LF7E 2FTXB 2JWOA 3C4TA 3AUZA 3J80C 3J7Yp 2UU9E 4JI3E 3VYXA 4X64E 1YYOA 1T4NA 1ZBTA 4LF4E 4DV0E 2V85A 2N3GA 2UUBE 4LF6E 2VQFE 5LMUE 4F9CB 2L2KB 4BBYA 2LJHA 4WPYA 4DV7E 4OOGC 2H36X 3HXLA 1IBKE 4DUYE 1N33E 2L2MA 3P1XA 4AQYE 1HNWE 4X8WA 2EZ6A 1N36E 2LTRA 2DSYA 1WHNA 5DNYA 4M30A 2L6MA 2ZM6E 1I94E 3ADJA 1DQ3A 1YYKA 2LMZA 2JR1A 1GZ6A 2G7HA 2MDRA 2F8BA 2V86A 3K6QA 4F9BB 2F4VE 3AV0A 2M4IA 4JYAE 1ZBQA 2B9DA 1SR9A 2K4VA 2NUFA 2DB2A 4DV6E 3MSWA 1DI2A 4B3ME 2L2NA 2UXCE 4F54A 4DV1E 2HHHE 2V83A 2NUGA 3T1HE 1T4OA 2MC6A 3H09A 4B3RE 2JY9A 2L92A 4Q28A 3F6HA 3C4BA 4BS9A 4JV5E 4X65E 2V8QB 4L8NA 4DR1E 2ODRC 3KWRA 2LE2A 3HPZA 4DR7E 2KONA 5AE1A 4JI1E 4JI4E 4DV3E 3VK6A 4BCAA 5FLXC 3ADLA 4X66E 4GEQB 1FJGE 4BC9A 2E5LE 4DR5E 4LFAE 5AE3A 5CFFE 2RS7A 4P7DA 2CPNA 2WZOA 1IBME 4K0KE 1J26A 4YY3E 4NXME 5T6JA 1IBLE 2DMYA 5IT9C 1UILA 2RSMA 3J81C 4DR3E 4B3SE 2VQEE 2L8TA 1STUA 4YHHE 1XMQE 4DKKA 2LUQA 4LFCE 3T1YE 1N32E 4BC7A 1XNQE 2MC5A 4DV5E 3IWCA 4JI2E 4WSPA 3LMLA 5A2QC 4GKJE 4BMJA 2DIXA 2KHXA 4JI8E 2VF1A 1WXRA 2LUPB 1J5EE 4LF5E 1X47A 2V89A 2JVAA 3LLHA 3DJWA 3OMLA 2VE7C 5AASA 1YZ9A 3ADIA 4WYQB 4LU9A 2L3CA 4X62E 2LBSB 2RTXA 2UXBE 4M0VA 2LRSA 4P78A 1T4LB 3RMPA 5F3WA 4DR4E 3OTOE 3JU0A 1X49A 1N34E 2V88A 3F6GA 2UUCE 4GKKE 1PKPA 1HR0E 3DF6A 2FGGA 1XMOE 2YZTA 1FKAE 5LL6R 3JAMC 1HNXE 2L3JA 3JTZA 5LMNE 3ZOQB 2KOUA 5ADZA 3HPSA 2B7VA 3HQ1A 1EKZA 4TUGA 2JOBA 2E1MA 2UXDE 4WFTA 5IWAE 1RC7A 3HTXA 2FV4B 1RQ0A 1YYWA 4LF9E 4LF8E 2EWLA 2ODRD 2L33A 3ADGA 4KZSA 4DR2E 1UHZA 2LTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8O A;  3MSW A;  4R03 A; 
#chains in the Genus database with same CATH topology
 2EP3 A;  2EPP A;  3TQM A;  2N3H A;  4BHB A;  2UUA E;  4R8O A;  4J8Z A;  2EM2 A;  4B3T E;  5AE2 A;  3VYY A;  2M7Q A;  2WBT A;  5AC4 A;  4JI6 E;  1L4S A;  2EJ4 A;  2M1S A;  1AAY A;  4JI7 E;  1A1H A;  4JI0 E;  1PJT A;  4DMI A;  2CSH A;  2LO3 A;  3BID A;  2NUE A;  2YTD A;  2JWO A;  4R2P A;  3AUZ A;  3J80 C;  3J7Y p;  4JI3 E;  1T4N A;  2EE8 A;  4LF6 E;  2VQF E;  2L2K B;  4OOG C;  1IBK E;  2EZ6 A;  1N36 E;  5DNY A;  1AH5 A;  2L6M A;  1I94 E;  2HC5 A;  1DQ3 A;  2EMG A;  1YUI A;  4JYA E;  2M4I A;  3THN A;  4O4K A;  2EQ3 A;  2NUF A;  2PRT A;  2GPI A;  2L2N A;  4DV1 E;  2HHH E;  1WJP A;  2EPK X;  1T4O A;  2MC6 A;  3H09 A;  4B3R E;  2BBG A;  3C4B A;  2ENH A;  1X3C A;  4JV5 E;  2V8Q B;  2EMZ A;  4RHB B;  2ODR C;  2EPA A;  4GZN C;  1NCS A;  2KON A;  2R1F A;  4JI4 E;  2Q8U A;  4R2S A;  2LJU A;  1FJG E;  2JXP A;  2JYA A;  1J26 A;  1BBG A;  2EM4 A;  2WBU A;  1QNT A;  2DMY A;  4B3S E;  2VQE E;  1N32 E;  3BGH A;  2EM6 A;  3EQ1 A;  2EQ1 A;  4GKJ E;  4BMJ A;  1IQS A;  1WXR A;  2LUP B;  1A1G A;  4F6M A;  2JPA A;  2EPU A;  3LLH A;  3DJW A;  3EPL A;  4ZYH A;  4WYQ B;  2LRS A;  1T4L B;  2EN3 A;  4IS1 C;  3BF2 A;  2EMY A;  2EPZ A;  1XMO E;  2YZT A;  5LMN E;  2EOI A;  1RMD A;  4F6N A;  5ADZ A;  1PDA A;  3L00 A;  4TUG A;  5IWA E;  2EMW A;  2YU8 A;  2EOX A;  1KJK A;  1RQ0 A;  1YUJ A;  4LF8 E;  2ODR D;  2L33 A;  3ADG A;  2DLK A;  4ZYE A;  4F2J C;  2EL6 A;  1TN9 A;  2NA2 A;  1QU6 A;  1WHQ A;  4L5N C;  4LFB E;  4DV2 E;  1GQE A;  2RS6 A;  1XNR E;  2DRP A;  5BR8 E;  2YT4 A;  2I9I A;  2YPN A;  2WCC 3;  2UU9 E;  2E72 A;  2EM9 A;  3VYX A;  4X64 E;  2EMF A;  4LF4 E;  2N3G A;  5LMU E;  2ADR A;  4F9C B;  2LJH A;  1N33 E;  2RPC A;  1ZR9 A;  5A6K A;  1ZAA C;  3M99 B;  3P1X A;  3C6K A;  4X8W A;  1HNW E;  4RH8 A;  2EOZ A;  4M30 A;  2ZM6 E;  1DGC A;  3ADJ A;  2EM8 A;  2JR1 A;  2MDR A;  2V86 A;  1F2I G;  1ZBQ A;  2K4V A;  2DB2 A;  4NZV A;  4DV6 E;  4F54 A;  2GHF A;  2V83 A;  1A1J A;  2EN6 A;  3T1H E;  2L92 A;  2YRM A;  3F6H A;  4WSG A;  3HPZ A;  1UBD C;  2MDG A;  2MKD A;  3ADL A;  4X66 E;  4GEQ B;  1EH8 A;  5CFF E;  2NAB A;  1IBM E;  4K0K E;  4YY3 E;  3QG5 C;  5T6J A;  1EH7 A;  2RSM A;  5A6A A;  1BBO A;  3EPH A;  2L8T A;  1STU A;  1XMQ E;  4LFC E;  1XNQ E;  4R2D A;  1PJQ A;  4JI2 E;  4WSP A;  2M9A A;  4FK5 C;  4LF5 E;  2CTD A;  2EMK A;  4X9J A;  2JVA A;  3OML A;  2VE7 C;  2A25 A;  1X6E A;  4LU9 A;  2L3C A;  4X62 E;  3ECR A;  4R2A A;  4M0V A;  4R2Q A;  3OTO E;  2EOY A;  2V88 A;  2EN8 A;  2UUC E;  1PKP A;  1X6H A;  1YFH A;  2DLQ A;  5LL6 R;  3JAM C;  2BB8 A;  3JTZ A;  2L3J A;  1IMU A;  2KOU A;  2LT7 A;  2DGC A;  4M9V C;  2JOB A;  2RSI A;  2JP9 A;  4LF9 E;  2EWL A;  4R2E A;  1EH6 A;  2EMB A;  4DR2 E;  1UHZ A;  2EM5 A;  3VK6 A;  5LLQ A;  2ENC A;  4DV4 E;  4TUI A;  1O0W A;  1YSA C;  2B3T B;  1A1K A;  4I8O A;  2B7T A;  4NXN E;  2JOX A;  2ELY A;  5KL7 A;  2IHR 1;  1G2F C;  1TF3 A;  3MHS C;  3IWD A;  3MHH C;  5A6B D;  2EM3 A;  2V87 A;  4OX9 E;  4LF7 E;  4MLV A;  3C4T A;  2HGH A;  5KL5 A;  5KL6 A;  5KL4 A;  2YSP A;  4DV7 E;  2H36 X;  3HXL A;  2L2M A;  5KL3 A;  2LTR A;  2EOF A;  2DSY A;  2YTO A;  2YRH A;  2YTF A;  1A1L A;  2YTI A;  3BBG A;  4ZYG A;  2G7H A;  4F9B B;  2F4V E;  2EMH A;  3AV0 A;  2EN7 A;  1YPN A;  4B3M E;  4BS9 A;  4NHR A;  2EN4 A;  4X65 E;  2EOJ A;  2EMI A;  1X6F A;  2LE2 A;  2WBS A;  5FLX C;  1N3G A;  5IXM B;  4BC9 A;  2E5L E;  4LFA E;  5IV8 B;  2GLI A;  2ELZ A;  2EM7 A;  2EOS A;  2WZO A;  3EPK A;  4NXM E;  1JK1 A;  5IT9 C;  2EOQ A;  2YU5 A;  2EOO A;  4DKK A;  1LLM C;  4DV5 E;  3IWC A;  2I13 A;  3LML A;  1J5E E;  2KHX A;  4MLQ A;  2VF1 A;  1X47 A;  2V89 A;  1YZ9 A;  4O24 A;  1NEI A;  3ADI A;  2RTX A;  2EOE A;  2UXB E;  1P47 A;  4ZYD A;  1PJS A;  4P78 A;  2VRD A;  5F3W A;  4DR4 E;  1X49 A;  2EPC A;  5KL2 A;  3F6G A;  3KZZ A;  4IJD A;  1HR0 E;  2EPR A;  1HNX E;  1FKA E;  2LCE A;  3ZOQ B;  2YTE A;  2CT1 A;  2N8X A;  3HPS A;  3HQ1 A;  1MGT A;  1A1F A;  2UXD E;  1RC7 A;  3HTX A;  2EQ0 A;  2EL4 A;  4BHC A;  4KZS A;  1A1I A;  3RMP A;  4DR6 E;  4KHP E;  1G2D C;  1T39 A;  4DUZ E;  3FIG A;  3J7A G;  3IWB A;  2YRK A;  1HNZ E;  2MKN A;  4F9A B;  4LTY A;  4R03 A;  4M2Z A;  2EML A;  2EMX A;  1X48 A;  5A6B A;  2YWQ A;  4JI5 E;  3KZY A;  2FTX B;  1WRJ A;  2EPX A;  2EMC A;  1YYO A;  1ZBT A;  4R2C A;  1Z1B A;  4DV0 E;  2HJJ A;  2V85 A;  5A69 A;  2UUB E;  4HEI A;  4Q35 B;  4BBY A;  4WPY A;  1IQO A;  4DUY E;  2DMI A;  4WXD A;  4AQY E;  1BB8 A;  1WHN A;  2EM0 A;  1YYK A;  1B69 A;  2LMZ A;  3K6Q A;  1GZ6 A;  1X5W A;  2F8B A;  2B9D A;  1SR9 A;  2RQL A;  2J7J A;  3MSW A;  1DI2 A;  2UXC E;  2EN1 A;  2NUG A;  1ZU1 A;  2JY9 A;  4Q28 A;  2YTN A;  2EPL X;  2EN2 A;  2K7I A;  4L8N A;  4DR1 E;  3KWR A;  2EPM X;  2R76 A;  4DR7 E;  5AE1 A;  5AC5 A;  4JI1 E;  2D9H A;  5TSE A;  4DV3 E;  1SFE A;  4BCA A;  1TF6 A;  5A6J A;  4DR5 E;  5AE3 A;  2RS7 A;  4P7D A;  2CPN A;  2YTP A;  4O43 A;  2EOH A;  1T38 A;  4KWY A;  4HTG A;  2YSO A;  2YTG A;  1IBL E;  2ENA A;  1UIL A;  2EPN A;  3J81 C;  4DR3 E;  2EMA A;  4YHH E;  2LUQ A;  3T1Y E;  3VHT B;  4BC7 A;  2LV2 A;  2MC5 A;  3THO B;  1MEY C;  5A2Q C;  1KYQ A;  2DIX A;  3UK3 C;  4JI8 E;  2EPO A;  2EOM A;  2EOR A;  1UN6 B;  2LVH A;  5AAS A;  4R2R A;  2LBS B;  2YTJ A;  3JU0 A;  3C6M A;  1N34 E;  4N4R B;  4GKK E;  4O5G A;  3DF6 A;  2FGG A;  2EL5 A;  4WXC A;  1JK2 A;  2B7V A;  2YTQ A;  1EKZ A;  2E1M A;  4WFT A;  3EPJ A;  2FV4 B;  1YYW A;  1GTK A;  4WX9 A;  2LTS A; 
#chains in the Genus database with same CATH homology
 4DR6 E;  4DV4 E;  4KHP E;  4TUI A;  1O0W A;  2N3H A;  2B3T B;  3FIG A;  4DUZ E;  2UUA E;  4JI6 E;  3IWB A;  2B7T A;  4I8O A;  4J8Z A;  4R8O A;  4B3T E;  4NXN E;  3J7A G;  2JOX A;  2NA2 A;  1QU6 A;  1WHQ A;  4L5N C;  5AE2 A;  1HNZ E;  4LFB E;  2IHR 1;  4LTY A;  4R03 A;  2M7Q A;  4F9A B;  3VYY A;  3IWD A;  2M1S A;  1GQE A;  4DV2 E;  4M2Z A;  4JI7 E;  2RS6 A;  2V87 A;  4JI0 E;  4DMI A;  4OX9 E;  1XNR E;  1X48 A;  5BR8 E;  2NUE A;  4JI5 E;  2YT4 A;  4LF7 E;  2FTX B;  2JWO A;  3C4T A;  3AUZ A;  3J80 C;  3J7Y p;  2UU9 E;  4JI3 E;  3VYX A;  4X64 E;  1YYO A;  1T4N A;  1ZBT A;  4LF4 E;  4DV0 E;  2V85 A;  2N3G A;  2UUB E;  4LF6 E;  2VQF E;  5LMU E;  4F9C B;  2L2K B;  4BBY A;  2LJH A;  4WPY A;  4DV7 E;  4OOG C;  2H36 X;  3HXL A;  1IBK E;  4DUY E;  1N33 E;  2L2M A;  3P1X A;  4AQY E;  1HNW E;  4X8W A;  2EZ6 A;  1N36 E;  2LTR A;  2DSY A;  1WHN A;  5DNY A;  4M30 A;  2L6M A;  2ZM6 E;  1I94 E;  3ADJ A;  1DQ3 A;  1YYK A;  2LMZ A;  2JR1 A;  1GZ6 A;  2G7H A;  2MDR A;  2F8B A;  2V86 A;  3K6Q A;  4F9B B;  2F4V E;  3AV0 A;  2M4I A;  4JYA E;  1ZBQ A;  2B9D A;  1SR9 A;  2K4V A;  2NUF A;  2DB2 A;  4DV6 E;  3MSW A;  1DI2 A;  4B3M E;  2L2N A;  2UXC E;  4F54 A;  4DV1 E;  2HHH E;  2V83 A;  2NUG A;  3T1H E;  1T4O A;  2MC6 A;  3H09 A;  4B3R E;  2JY9 A;  2L92 A;  4Q28 A;  3F6H A;  3C4B A;  4BS9 A;  4JV5 E;  4X65 E;  2V8Q B;  4L8N A;  4DR1 E;  2ODR C;  3KWR A;  2LE2 A;  3HPZ A;  4DR7 E;  2KON A;  5AE1 A;  4JI1 E;  4JI4 E;  4DV3 E;  3VK6 A;  4BCA A;  5FLX C;  3ADL A;  4X66 E;  4GEQ B;  1FJG E;  4BC9 A;  2E5L E;  4DR5 E;  4LFA E;  5AE3 A;  5CFF E;  2RS7 A;  4P7D A;  2CPN A;  2WZO A;  1IBM E;  4K0K E;  1J26 A;  4YY3 E;  4NXM E;  5T6J A;  1IBL E;  2DMY A;  5IT9 C;  1UIL A;  2RSM A;  3J81 C;  4DR3 E;  4B3S E;  2VQE E;  2L8T A;  1STU A;  4YHH E;  1XMQ E;  4DKK A;  2LUQ A;  4LFC E;  3T1Y E;  1N32 E;  4BC7 A;  1XNQ E;  2MC5 A;  4DV5 E;  3IWC A;  4JI2 E;  4WSP A;  3LML A;  5A2Q C;  4GKJ E;  4BMJ A;  2DIX A;  2KHX A;  4JI8 E;  2VF1 A;  1WXR A;  2LUP B;  1J5E E;  4LF5 E;  1X47 A;  2V89 A;  2JVA A;  3LLH A;  3DJW A;  3OML A;  2VE7 C;  5AAS A;  1YZ9 A;  3ADI A;  4WYQ B;  4LU9 A;  2L3C A;  4X62 E;  2LBS B;  2RTX A;  2UXB E;  4M0V A;  2LRS A;  4P78 A;  1T4L B;  3RMP A;  5F3W A;  4DR4 E;  3OTO E;  3JU0 A;  1X49 A;  1N34 E;  2V88 A;  3F6G A;  2UUC E;  4GKK E;  1PKP A;  1HR0 E;  3DF6 A;  2FGG A;  1XMO E;  2YZT A;  1FKA E;  5LL6 R;  3JAM C;  1HNX E;  2L3J A;  3JTZ A;  5LMN E;  3ZOQ B;  2KOU A;  5ADZ A;  3HPS A;  2B7V A;  3HQ1 A;  1EKZ A;  4TUG A;  2JOB A;  2E1M A;  2UXD E;  4WFT A;  5IWA E;  1RC7 A;  3HTX A;  2FV4 B;  1RQ0 A;  1YYW A;  4LF9 E;  4LF8 E;  2EWL A;  2ODR D;  2L33 A;  3ADG A;  4KZS A;  4DR2 E;  1UHZ A;  2LTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...