3MSWA

Crystal structure of a protein with unknown function (bf3112) from bacteroides fragilis nctc 9343 at 1.90 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
139
structure length
139
Chain Sequence
GTNNGKQFIHNDTMEGGKLVCREIYAMNDAASGILNPVKMYKYSYDTDQQKTVKSTYAWNIFKNTWETESRTVISRYETETSVEYSVWNKEKGSFDLSKKYIYITDNNNQLIAQYAYKMNSRTNQWILEKDALTPIYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of a Protein with unknown function (BF3112) from Bacteroides fragilis NCTC 9343 at 1.90 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 25
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2010-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.630 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3mswA00
4R03A 3MSWA 4R8OA
chains in the Genus database with same CATH superfamily
3KWRA 5KL3A 2EOQA 3KZZA 1WXRA 4R2RA 2DIXA 2JR1A 4LFBE 4F6NA 2LV2A 1UN6B 4IS1C 2M9AA 5BR8E 1WHQA 4NXNE 4OOGC 2EM3A 5KL2A 4DR1E 4DV0E 4B3SE 2EM7A 2JP9A 1BB8A 4JI1E 2FV4B 3HPZA 2EL4A 3MHSC 4JI3E 1N33E 2NUEA 4M9VC 1A1LA 3JTZA 2EM4A 4LF6E 2M7QA 5LMUE 2RPCA 2ENCA 4KHPE 3AUZA 1X47A 4WSPA 2KOUA 3VK6A 5A69A 5A6BD 4DV4E 2EMGA 2CSHA 3K6QA 3EPKA 3IWBA 2YTPA 2EPZA 2HJJA 5AE3A 2DSYA 3OMLA 1EH8A 1AH5A 1SR9A 2GPIA 2LBSB 4F9AB 2D9HA 3IWCA 1YYOA 2EOHA 2L6MA 3EPJA 2B9DA 1XMOE 2B7TA 1I94E 4DR7E 4F6MA 3AV0A 2NUGA 1ZBTA 2V88A 2EMZA 1STUA 2HC5A 2EN1A 1X6HA 2YTDA 3THOB 5ADZA 1A1GA 1DQ3A 2EOXA 1SFEA 2EMKA 4YHHE 2L2NA 2EMIA 5KL7A 2EN2A 3M99B 2L3CA 4LFCE 4IJDA 2YTFA 2L2MA 5A6BA 4X64E 2ELZA 3ZOQB 2JYAA 2LJUA 1TN9A 1DI2A 3LMLA 5A6KA 2VQEE 2EZ6A 5AE2A 2KONA 5LL6R 2F4VE 4R2EA 4HEIA 2EJ4A 5IWAE 1TF6A 2EPNA 2EPRA 2UXDE 2LE2A 4LF5E 2EN8A 2EM5A 3THNA 1BBGA 1B69A 2L33A 2EMAA 2WBTA 2JOBA 2YRHA 2LTRA 4YY3E 1XMQE 4DV7E 2E1MA 2WCC3 2MKDA 3DJWA 3RMPA 4ZYDA 2LRSA 3HTXA 1HNWE 2YTJA 2YTOA 1N32E 2YWQA 2RSIA 4DUYE 2ENAA 1RC7A 2UXCE 2KHXA 4JI0E 4JI8E 1A1FA 2WBSA 2EOIA 2EL6A 2LUPB 1YPNA 4K0KE 3ADGA 3HQ1A 4Q28A 2NA2A 2EMCA 4LF7E 2EORA 2YU5A 4KZSA 4NHRA 1GZ6A 2EPXA 4JI4E 2DMYA 2I9IA 2JOXA 4ZYGA 1L4SA 2B7VA 4OX9E 4LF8E 3DF6A 2K7IA 4BHCA 4I8OA 1G2DC 4WXDA 4DMIA 1YSAC 3J7Yp 4TUGA 3F6HA 5KL4A 4DV3E 2M4IA 5AASA 3KZYA 1UHZA 3HXLA 4DKKA 3UK3C 4RHBB 2WZOA 2EM6A 4DV5E 1T38A 3VYYA 1IQOA 2V83A 1YFHA 2DMIA 3F6GA 4L5NC 5KL5A 3LLHA 1HNXE 4DR2E 3MHHC 2ELYA 2EMHA 1RQ0A 2LCEA 1X49A 4B3TE 4BHBA 4O4KA 2V87A 4J8ZA 1N34E 1LLMC 4WX9A 1EH6A 4O5GA 2EWLA 1HR0E 4GEQB 4DR4E 2N3HA 2MDGA 4BMJA 2VQFE 2EOMA 2EQ1A 1XNQE 4ZYEA 1YUIA 2MKNA 1JK2A 4O24A 4TUIA 2EMBA 2UXBE 4BCAA 3H09A 2EOFA 3EPLA 4R2PA 3JAMC 2H36X 2JY9A 5IT9C 4M30A 2FGGA 1KYQA 2EMLA 1YZ9A 4JYAE 4KWYA 2NABA 2EN6A 4BS9A 1MEYC 5A6JA 1X6FA 1PDAA 2DRPA 2EOZA 2EOEA 2EPOA 4R2CA 2R1FA 4WFTA 2EN3A 2CPNA 1GTKA 4LU9A 4R03A 2MC5A 1DGCA 1QNTA 2LTSA 2RTXA 4L8NA 4JI6E 1T4NA 2EMXA 2LT7A 2YPNA 4DR5E 2YTEA 4P7DA 2EPCA 1X3CA 3J7AG 2EPKX 1A1KA 2MDRA 4M2ZA 3ADLA 2YU8A 1P47A 1WJPA 2EOYA 1J5EE 4R2AA 2JXPA 3IWDA 1TF3A 1Z1BA 1PKPA 5AE1A 4LF4E 2DGCA 3VHTB 2ODRC 2JWOA 2DLQA 2V8QB 2UUCE 2EOJA 4JI7E 2F8BA 1JK1A 5LLQA 4BC9A 5F3WA 4MLVA 4NXME 2LVHA 1A1JA 4R2SA 2CT1A 2V89A 2YTNA 3BIDA 4F2JC 4DR6E 5CFFE 2LUQA 4WXCA 2Q8UA 2EQ3A 2L3JA 5FLXC 2GHFA 1T39A 2YRMA 1EH7A 2EMWA 2B3TB 2EM9A 2VRDA 2BB8A 4X8WA 4X66E 1A1IA 2EN4A 1G2FC 2UUBE 5AC5A 1YYKA 2YTQA 4BBYA 1FKAE 1WHNA 1N3GA 1X5WA 2EM0A 1T4OA 3ADIA 2VF1A 1PJSA 3VYXA 1X48A 3ECRA 2EMFA 2EN7A 4FK5C 4X62E 4R2DA 2IHR1 2RS7A 4DV1E 3C6KA 3BF2A 1UBDC 3J81C 3OTOE 1IBLE 1PJTA 2PRTA 2DB2A 2G7HA 1T4LB 2A25A 4HTGA 5KL6A 2VE7C 2YTGA 2N3GA 1AAYA 4WPYA 2CTDA 2JPAA 2EE8A 1QU6A 2EOSA 2ODRD 2YT4A 4P78A 2EQ0A 1BBOA 4NZVA 1J26A 2RSMA 2I13A 3QG5C 4DUZE 2EPMX 2R76A 1F2IG 2LMZA 1IMUA 4LTYA 4O43A 4N4RB 2L2KB 5LMNE 4M0VA 3C4BA 1KJKA 2UU9E 4WSGA 4LFAE 3EQ1A 2L92A 2JVAA 1MGTA 2HHHE 1IQSA 4AQYE 2EPUA 2M1SA 2HGHA 1IBKE 1NEIA 2RS6A 2FTXB 5T6JA 4Q35B 2WBUA 4GZNC 1EKZA 1UILA 1NCSA 5AC4A 3HPSA 1ZBQA 4B3RE 3T1YE 1ZR9A 2YSOA 5IXMB 4BC7A 1ZAAC 1YYWA 3ADJA 2N8XA 1WRJA 2ENHA 2UUAE 1RMDA 3MSWA 4WYQB 4GKKE 2J7JA 5A2QC 1XNRE 2YZTA 2NUFA 1FJGE 2E72A 2LJHA 3J80C 2EMYA 2EM8A 3FIGA 4B3ME 2EPAA 2K4VA 2L8TA 2GLIA 3EPHA 2YRKA 3P1XA 3C6MA 3BBGA 4F9BB 2EL5A 4LF9E 2V86A 4RH8A 4DR3E 3BGHA 4GKJE 5IV8B 1HNZE 3T1HE 4DV6E 1A1HA 4JI2E 2V85A 4JV5E 4F54A 1O0WA 1ZU1A 4ZYHA 4DV2E 5DNYA 2BBGA 2ADRA 3TQMA 4X65E 1X6EA 3JU0A 2YTIA 2LO3A 2EOOA 2YSPA 1GQEA 4JI5E 2E5LE 2EM2A 5TSEA 4F9CB 4R8OA 3L00A 1YUJA 2EPLX 1IBME 5A6AA 3C4TA 1PJQA 2MC6A 2EP3A 2EPPA 4MLQA 4R2QA 4X9JA 2DLKA 2RQLA 2ZM6E 1N36E
chains in the Genus database with same CATH topology
2LTRA 4YY3E 4BS9A 4DUZE 3KWRA 1XMQE 4DV7E 2E1MA 1WXRA 2DIXA 2JR1A 2LMZA 4LTYA 4LFBE 3DJWA 2L2KB 3RMPA 5LMNE 5BR8E 4WFTA 4M0VA 2LRSA 3C4BA 2CPNA 1WHQA 4R03A 4LU9A 3HTXA 1HNWE 2UU9E 4NXNE 4OOGC 1N32E 2MC5A 4DR1E 4DV0E 4LFAE 4B3SE 2LTSA 2L92A 4DUYE 2RTXA 2FV4B 3HPZA 4L8NA 2JVAA 1RC7A 4JI1E 1T4NA 4JI6E 2UXCE 2KHXA 4JI0E 2HHHE 4DR5E 4JI8E 4JI3E 1N33E 4P7DA 2NUEA 3J7AG 4AQYE 4M2ZA 2LUPB 2MDRA 2M1SA 3JTZA 4LF6E 3ADLA 2M7QA 4K0KE 1J5EE 5LMUE 3ADGA 3HQ1A 4Q28A 2NA2A 1IBKE 3IWDA 2RS6A 4KHPE 2FTXB 4LF7E 5T6JA 1PKPA 3AUZA 1X47A 4KZSA 4WSPA 5AE1A 4LF4E 2KOUA 1EKZA 1GZ6A 3VK6A 1UILA 4DV4E 2ODRC 3HPSA 1ZBQA 2JWOA 4JI4E 2DMYA 2JOXA 2V8QB 3T1YE 4B3RE 2UUCE 2B7VA 3K6QA 4JI7E 4OX9E 2F8BA 3IWBA 4LF8E 3DF6A 4BC9A 5F3WA 4I8OA 4BC7A 5AE3A 4NXME 2DSYA 3OMLA 4DMIA 1YYWA 3J7Yp 4TUGA 2V89A 3ADJA 3F6HA 1SR9A 2LBSB 4F9AB 4DV3E 4DR6E 5CFFE 2M4IA 5AASA 3IWCA 2LUQA 1UHZA 3HXLA 1YYOA 2L6MA 2UUAE 4DKKA 2B9DA 3MSWA 2WZOA 4WYQB 4GKKE 1XMOE 2B7TA 2L3JA 1I94E 4DR7E 5A2QC 1XNRE 2YZTA 2NUFA 5FLXC 4DV5E 3VYYA 3AV0A 1FJGE 2V83A 2NUGA 2LJHA 1ZBTA 3J80C 3F6GA 3FIGA 2V88A 2B3TB 4L5NC 2K4VA 4B3ME 3LLHA 2L8TA 1STUA 4DR2E 1HNXE 4X8WA 1RQ0A 4X66E 3P1XA 5ADZA 1X49A 1DQ3A 4F9BB 2UUBE 4YHHE 4B3TE 4LF9E 2V86A 2L2NA 4DR3E 2V87A 4J8ZA 1YYKA 4GKJE 1HNZE 4BBYA 3T1HE 4DV6E 1FKAE 4JI2E 1N34E 2L3CA 2V85A 1WHNA 4LFCE 4JV5E 4F54A 2EWLA 1T4OA 1HR0E 3ADIA 1O0WA 2L2MA 2VF1A 4GEQB 4X64E 4DV2E 3VYXA 5DNYA 3ZOQB 4DR4E 1X48A 4X62E 2N3HA 2IHR1 4X65E 2VQFE 2RS7A 4BMJA 4DV1E 3JU0A 1XNQE 1DI2A 3LMLA 1GQEA 4JI5E 4TUIA 2UXBE 4BCAA 2VQEE 2E5LE 3J81C 2EZ6A 3H09A 4F9CB 3OTOE 4R8OA 5AE2A 2KONA 5LL6R 1IBLE 1IBME 2F4VE 5IWAE 3C4TA 3JAMC 2DB2A 2G7HA 1T4LB 2MC6A 2UXDE 2H36X 2VE7C 2N3GA 4WPYA 2JY9A 2LE2A 4LF5E 1QU6A 5IT9C 2ODRD 1J26A 2YT4A 4P78A 4M30A 2FGGA 2L33A 2ZM6E 1YZ9A 2RSMA 4JYAE 1N36E 2JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R03 A;  3MSW A;  4R8O A; 
#chains in the Genus database with same CATH topology
 3KWR A;  5KL3 A;  2EOQ A;  3KZZ A;  1WXR A;  4R2R A;  2DIX A;  2JR1 A;  4LFB E;  4F6N A;  2LV2 A;  1UN6 B;  4IS1 C;  2M9A A;  5BR8 E;  1WHQ A;  4NXN E;  4OOG C;  2EM3 A;  5KL2 A;  4DR1 E;  4DV0 E;  4B3S E;  2EM7 A;  2JP9 A;  1BB8 A;  4JI1 E;  2FV4 B;  3HPZ A;  2EL4 A;  3MHS C;  4JI3 E;  1N33 E;  2NUE A;  4M9V C;  1A1L A;  3JTZ A;  2EM4 A;  4LF6 E;  2M7Q A;  5LMU E;  2RPC A;  2ENC A;  4KHP E;  3AUZ A;  1X47 A;  4WSP A;  2KOU A;  3VK6 A;  5A69 A;  5A6B D;  4DV4 E;  2EMG A;  2CSH A;  3K6Q A;  3EPK A;  3IWB A;  2YTP A;  2EPZ A;  2HJJ A;  5AE3 A;  2DSY A;  3OML A;  1EH8 A;  1AH5 A;  1SR9 A;  2GPI A;  2LBS B;  4F9A B;  2D9H A;  3IWC A;  1YYO A;  2EOH A;  2L6M A;  3EPJ A;  2B9D A;  1XMO E;  2B7T A;  1I94 E;  4DR7 E;  4F6M A;  3AV0 A;  2NUG A;  1ZBT A;  2V88 A;  2EMZ A;  1STU A;  2HC5 A;  2EN1 A;  1X6H A;  2YTD A;  3THO B;  5ADZ A;  1A1G A;  1DQ3 A;  2EOX A;  1SFE A;  2EMK A;  4YHH E;  2L2N A;  2EMI A;  5KL7 A;  2EN2 A;  3M99 B;  2L3C A;  4LFC E;  4IJD A;  2YTF A;  2L2M A;  5A6B A;  4X64 E;  2ELZ A;  3ZOQ B;  2JYA A;  2LJU A;  1TN9 A;  1DI2 A;  3LML A;  5A6K A;  2VQE E;  2EZ6 A;  5AE2 A;  2KON A;  5LL6 R;  2F4V E;  4R2E A;  4HEI A;  2EJ4 A;  5IWA E;  1TF6 A;  2EPN A;  2EPR A;  2UXD E;  2LE2 A;  4LF5 E;  2EN8 A;  2EM5 A;  3THN A;  1BBG A;  1B69 A;  2L33 A;  2EMA A;  2WBT A;  2JOB A;  2YRH A;  2LTR A;  4YY3 E;  1XMQ E;  4DV7 E;  2E1M A;  2WCC 3;  2MKD A;  3DJW A;  3RMP A;  4ZYD A;  2LRS A;  3HTX A;  1HNW E;  2YTJ A;  2YTO A;  1N32 E;  2YWQ A;  2RSI A;  4DUY E;  2ENA A;  1RC7 A;  2UXC E;  2KHX A;  4JI0 E;  4JI8 E;  1A1F A;  2WBS A;  2EOI A;  2EL6 A;  2LUP B;  1YPN A;  4K0K E;  3ADG A;  3HQ1 A;  4Q28 A;  2NA2 A;  2EMC A;  4LF7 E;  2EOR A;  2YU5 A;  4KZS A;  4NHR A;  1GZ6 A;  2EPX A;  4JI4 E;  2DMY A;  2I9I A;  2JOX A;  4ZYG A;  1L4S A;  2B7V A;  4OX9 E;  4LF8 E;  3DF6 A;  2K7I A;  4BHC A;  4I8O A;  1G2D C;  4WXD A;  4DMI A;  1YSA C;  3J7Y p;  4TUG A;  3F6H A;  5KL4 A;  4DV3 E;  2M4I A;  5AAS A;  3KZY A;  1UHZ A;  3HXL A;  4DKK A;  3UK3 C;  4RHB B;  2WZO A;  2EM6 A;  4DV5 E;  1T38 A;  3VYY A;  1IQO A;  2V83 A;  1YFH A;  2DMI A;  3F6G A;  4L5N C;  5KL5 A;  3LLH A;  1HNX E;  4DR2 E;  3MHH C;  2ELY A;  2EMH A;  1RQ0 A;  2LCE A;  1X49 A;  4B3T E;  4BHB A;  4O4K A;  2V87 A;  4J8Z A;  1N34 E;  1LLM C;  4WX9 A;  1EH6 A;  4O5G A;  2EWL A;  1HR0 E;  4GEQ B;  4DR4 E;  2N3H A;  2MDG A;  4BMJ A;  2VQF E;  2EOM A;  2EQ1 A;  1XNQ E;  4ZYE A;  1YUI A;  2MKN A;  1JK2 A;  4O24 A;  4TUI A;  2EMB A;  2UXB E;  4BCA A;  3H09 A;  2EOF A;  3EPL A;  4R2P A;  3JAM C;  2H36 X;  2JY9 A;  5IT9 C;  4M30 A;  2FGG A;  1KYQ A;  2EML A;  1YZ9 A;  4JYA E;  4KWY A;  2NAB A;  2EN6 A;  4BS9 A;  1MEY C;  5A6J A;  1X6F A;  1PDA A;  2DRP A;  2EOZ A;  2EOE A;  2EPO A;  4R2C A;  2R1F A;  4WFT A;  2EN3 A;  2CPN A;  1GTK A;  4LU9 A;  4R03 A;  2MC5 A;  1DGC A;  1QNT A;  2LTS A;  2RTX A;  4L8N A;  4JI6 E;  1T4N A;  2EMX A;  2LT7 A;  2YPN A;  4DR5 E;  2YTE A;  4P7D A;  2EPC A;  1X3C A;  3J7A G;  2EPK X;  1A1K A;  2MDR A;  4M2Z A;  3ADL A;  2YU8 A;  1P47 A;  1WJP A;  2EOY A;  1J5E E;  4R2A A;  2JXP A;  3IWD A;  1TF3 A;  1Z1B A;  1PKP A;  5AE1 A;  4LF4 E;  2DGC A;  3VHT B;  2ODR C;  2JWO A;  2DLQ A;  2V8Q B;  2UUC E;  2EOJ A;  4JI7 E;  2F8B A;  1JK1 A;  5LLQ A;  4BC9 A;  5F3W A;  4MLV A;  4NXM E;  2LVH A;  1A1J A;  4R2S A;  2CT1 A;  2V89 A;  2YTN A;  3BID A;  4F2J C;  4DR6 E;  5CFF E;  2LUQ A;  4WXC A;  2Q8U A;  2EQ3 A;  2L3J A;  5FLX C;  2GHF A;  1T39 A;  2YRM A;  1EH7 A;  2EMW A;  2B3T B;  2EM9 A;  2VRD A;  2BB8 A;  4X8W A;  4X66 E;  1A1I A;  2EN4 A;  1G2F C;  2UUB E;  5AC5 A;  1YYK A;  2YTQ A;  4BBY A;  1FKA E;  1WHN A;  1N3G A;  1X5W A;  2EM0 A;  1T4O A;  3ADI A;  2VF1 A;  1PJS A;  3VYX A;  1X48 A;  3ECR A;  2EMF A;  2EN7 A;  4FK5 C;  4X62 E;  4R2D A;  2IHR 1;  2RS7 A;  4DV1 E;  3C6K A;  3BF2 A;  1UBD C;  3J81 C;  3OTO E;  1IBL E;  1PJT A;  2PRT A;  2DB2 A;  2G7H A;  1T4L B;  2A25 A;  4HTG A;  5KL6 A;  2VE7 C;  2YTG A;  2N3G A;  1AAY A;  4WPY A;  2CTD A;  2JPA A;  2EE8 A;  1QU6 A;  2EOS A;  2ODR D;  2YT4 A;  4P78 A;  2EQ0 A;  1BBO A;  4NZV A;  1J26 A;  2RSM A;  2I13 A;  3QG5 C;  4DUZ E;  2EPM X;  2R76 A;  1F2I G;  2LMZ A;  1IMU A;  4LTY A;  4O43 A;  4N4R B;  2L2K B;  5LMN E;  4M0V A;  3C4B A;  1KJK A;  2UU9 E;  4WSG A;  4LFA E;  3EQ1 A;  2L92 A;  2JVA A;  1MGT A;  2HHH E;  1IQS A;  4AQY E;  2EPU A;  2M1S A;  2HGH A;  1IBK E;  1NEI A;  2RS6 A;  2FTX B;  5T6J A;  4Q35 B;  2WBU A;  4GZN C;  1EKZ A;  1UIL A;  1NCS A;  5AC4 A;  3HPS A;  1ZBQ A;  4B3R E;  3T1Y E;  1ZR9 A;  2YSO A;  5IXM B;  4BC7 A;  1ZAA C;  1YYW A;  3ADJ A;  2N8X A;  1WRJ A;  2ENH A;  2UUA E;  1RMD A;  3MSW A;  4WYQ B;  4GKK E;  2J7J A;  5A2Q C;  1XNR E;  2YZT A;  2NUF A;  1FJG E;  2E72 A;  2LJH A;  3J80 C;  2EMY A;  2EM8 A;  3FIG A;  4B3M E;  2EPA A;  2K4V A;  2L8T A;  2GLI A;  3EPH A;  2YRK A;  3P1X A;  3C6M A;  3BBG A;  4F9B B;  2EL5 A;  4LF9 E;  2V86 A;  4RH8 A;  4DR3 E;  3BGH A;  4GKJ E;  5IV8 B;  1HNZ E;  3T1H E;  4DV6 E;  1A1H A;  4JI2 E;  2V85 A;  4JV5 E;  4F54 A;  1O0W A;  1ZU1 A;  4ZYH A;  4DV2 E;  5DNY A;  2BBG A;  2ADR A;  3TQM A;  4X65 E;  1X6E A;  3JU0 A;  2YTI A;  2LO3 A;  2EOO A;  2YSP A;  1GQE A;  4JI5 E;  2E5L E;  2EM2 A;  5TSE A;  4F9C B;  4R8O A;  3L00 A;  1YUJ A;  2EPL X;  1IBM E;  5A6A A;  3C4T A;  1PJQ A;  2MC6 A;  2EP3 A;  2EPP A;  4MLQ A;  4R2Q A;  4X9J A;  2DLK A;  2RQL A;  2ZM6 E;  1N36 E; 
#chains in the Genus database with same CATH homology
 2LTR A;  4YY3 E;  4BS9 A;  4DUZ E;  3KWR A;  1XMQ E;  4DV7 E;  2E1M A;  1WXR A;  2DIX A;  2JR1 A;  2LMZ A;  4LTY A;  4LFB E;  3DJW A;  2L2K B;  3RMP A;  5LMN E;  5BR8 E;  4WFT A;  4M0V A;  2LRS A;  3C4B A;  2CPN A;  1WHQ A;  4R03 A;  4LU9 A;  3HTX A;  1HNW E;  2UU9 E;  4NXN E;  4OOG C;  1N32 E;  2MC5 A;  4DR1 E;  4DV0 E;  4LFA E;  4B3S E;  2LTS A;  2L92 A;  4DUY E;  2RTX A;  2FV4 B;  3HPZ A;  4L8N A;  2JVA A;  1RC7 A;  4JI1 E;  1T4N A;  4JI6 E;  2UXC E;  2KHX A;  4JI0 E;  2HHH E;  4DR5 E;  4JI8 E;  4JI3 E;  1N33 E;  4P7D A;  2NUE A;  3J7A G;  4AQY E;  4M2Z A;  2LUP B;  2MDR A;  2M1S A;  3JTZ A;  4LF6 E;  3ADL A;  2M7Q A;  4K0K E;  1J5E E;  5LMU E;  3ADG A;  3HQ1 A;  4Q28 A;  2NA2 A;  1IBK E;  3IWD A;  2RS6 A;  4KHP E;  2FTX B;  4LF7 E;  5T6J A;  1PKP A;  3AUZ A;  1X47 A;  4KZS A;  4WSP A;  5AE1 A;  4LF4 E;  2KOU A;  1EKZ A;  1GZ6 A;  3VK6 A;  1UIL A;  4DV4 E;  2ODR C;  3HPS A;  1ZBQ A;  2JWO A;  4JI4 E;  2DMY A;  2JOX A;  2V8Q B;  3T1Y E;  4B3R E;  2UUC E;  2B7V A;  3K6Q A;  4JI7 E;  4OX9 E;  2F8B A;  3IWB A;  4LF8 E;  3DF6 A;  4BC9 A;  5F3W A;  4I8O A;  4BC7 A;  5AE3 A;  4NXM E;  2DSY A;  3OML A;  4DMI A;  1YYW A;  3J7Y p;  4TUG A;  2V89 A;  3ADJ A;  3F6H A;  1SR9 A;  2LBS B;  4F9A B;  4DV3 E;  4DR6 E;  5CFF E;  2M4I A;  5AAS A;  3IWC A;  2LUQ A;  1UHZ A;  3HXL A;  1YYO A;  2L6M A;  2UUA E;  4DKK A;  2B9D A;  3MSW A;  2WZO A;  4WYQ B;  4GKK E;  1XMO E;  2B7T A;  2L3J A;  1I94 E;  4DR7 E;  5A2Q C;  1XNR E;  2YZT A;  2NUF A;  5FLX C;  4DV5 E;  3VYY A;  3AV0 A;  1FJG E;  2V83 A;  2NUG A;  2LJH A;  1ZBT A;  3J80 C;  3F6G A;  3FIG A;  2V88 A;  2B3T B;  4L5N C;  2K4V A;  4B3M E;  3LLH A;  2L8T A;  1STU A;  4DR2 E;  1HNX E;  4X8W A;  1RQ0 A;  4X66 E;  3P1X A;  5ADZ A;  1X49 A;  1DQ3 A;  4F9B B;  2UUB E;  4YHH E;  4B3T E;  4LF9 E;  2V86 A;  2L2N A;  4DR3 E;  2V87 A;  4J8Z A;  1YYK A;  4GKJ E;  1HNZ E;  4BBY A;  3T1H E;  4DV6 E;  1FKA E;  4JI2 E;  1N34 E;  2L3C A;  2V85 A;  1WHN A;  4LFC E;  4JV5 E;  4F54 A;  2EWL A;  1T4O A;  1HR0 E;  3ADI A;  1O0W A;  2L2M A;  2VF1 A;  4GEQ B;  4X64 E;  4DV2 E;  3VYX A;  5DNY A;  3ZOQ B;  4DR4 E;  1X48 A;  4X62 E;  2N3H A;  2IHR 1;  4X65 E;  2VQF E;  2RS7 A;  4BMJ A;  4DV1 E;  3JU0 A;  1XNQ E;  1DI2 A;  3LML A;  1GQE A;  4JI5 E;  4TUI A;  2UXB E;  4BCA A;  2VQE E;  2E5L E;  3J81 C;  2EZ6 A;  3H09 A;  4F9C B;  3OTO E;  4R8O A;  5AE2 A;  2KON A;  5LL6 R;  1IBL E;  1IBM E;  2F4V E;  5IWA E;  3C4T A;  3JAM C;  2DB2 A;  2G7H A;  1T4L B;  2MC6 A;  2UXD E;  2H36 X;  2VE7 C;  2N3G A;  4WPY A;  2JY9 A;  2LE2 A;  4LF5 E;  1QU6 A;  5IT9 C;  2ODR D;  1J26 A;  2YT4 A;  4P78 A;  4M30 A;  2FGG A;  2L33 A;  2ZM6 E;  1YZ9 A;  2RSM A;  4JYA E;  1N36 E;  2JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...