1T4OA

Crystal structure of rnt1p dsrbd
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ribonuclease III
publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4oA00
4M2ZA 1T4OA 3C4TA 2NUEA 2LJHA 4OOGC 4NXME 4DR4E 1XNRE 1XMOE 4DV3E 4LFAE 2EZ6A 1ZBTA 2ZM6E 1N34E 1DI2A 2L2MA 4LF4E 4OX9E 2JY9A 4X64E 2UXCE 4DR2E 2DB2A 5LMNE 1XNQE 1WHNA 1RC7A 1T4NA 4JI1E 1HNZE 4DR5E 4DR3E 2RTXA 1I94E 2B3TB 2IHR1 4DR1E 2DMYA 1YYWA 4GKJE 1J5EE 2RS6A 4YHHE 5CFFE 1O0WA 3ADLA 4KHPE 2LRSA 4DUZE 2UUBE 4B3SE 1STUA 2E5LE 4DV2E 4DV4E 5LMUE 1PKPA 2RS7A 4X65E 4JI5E 4JI3E 4B3TE 2B7VA 2NA2A 4JI2E 2VQFE 3ADJA 4K0KE 2DIXA 4LF8E 2L2NA 4DR6E 2L2KB 4DV1E 2L33A 3T1HE 4JI7E 4LFCE 4B3ME 1YYOA 2MDRA 1YZ9A 2YT4A 2VQEE 1N36E 4JV5E 1EKZA 4DR7E 3C4BA 4DV7E 2NUGA 4GKKE 2UXBE 4YY3E 3LLHA 1GQEA 2LUQA 3J7Yp 4DUYE 2F4VE 1QU6A 4NXNE 1UHZA 1YYKA 2LTSA 4X8WA 1WHQA 1T4LB 1RQ0A 1UILA 5BR8E 1IBLE 1X48A 3VYYA 4X66E 2N3GA 4X62E 2L3JA 1FJGE 4JYAE 4LF9E 4LF7E 3HTXA 2B7TA 2LBSB 1HNWE 1IBME 1X49A 3P1XA 4WFTA 1X47A 4DV5E 2LUPB 4AQYE 1HR0E 1J26A 2UUCE 4LF6E 4JI6E 2UXDE 2UUAE 3VYXA 2HHHE 4DV0E 3ADIA 4LFBE 1N32E 3ADGA 1IBKE 1XMQE 4JI0E 4LF5E 2NUFA 1N33E 4JI8E 2N3HA 2LTRA 4M30A 4DV6E 4JI4E 1FKAE 3OTOE 4DKKA 2JVAA 4WYQB 2CPNA 3T1YE 2KHXA 2UU9E 2RSMA 2L3CA 1HNXE 4B3RE 5IWAE
chains in the Genus database with same CATH superfamily
1T4OA 4NZVA 3C4TA 2NUEA 2LJHA 4OOGC 4DR4E 2LO3A 3MHSC 4WSPA 4LFAE 3L00A 4O5GA 2WBSA 4HTGA 4O4KA 2EPCA 2JY9A 1UN6B 1X6EA 4F9AB 5KL7A 1WXRA 4JI1E 4DR5E 4B3RE 4DR3E 2RTXA 1X3CA 2IHR1 2L6MA 3HXLA 4DR1E 1YYWA 2HC5A 2EPOA 2EMZA 2EN7A 1ZR9A 4KHPE 2EN1A 1MGTA 2EM9A 1A1FA 1NEIA 4BCAA 2EMAA 2EM7A 5DNYA 1A1IA 2DGCA 4F2JC 4X9JA 4X65E 1EH8A 2MC5A 4K0KE 2DIXA 5AC4A 4ZYEA 4DR6E 5A2QC 2L2KB 4TUIA 4DV1E 5LLQA 2RQLA 4B3ME 4WPYA 2EOZA 5F3WA 1GTKA 2YT4A 2VQEE 2EN6A 2EOXA 3EPJA 1N36E 2LMZA 2DRPA 2F4VE 2ODRC 2LT7A 1YYKA 2LTSA 5AC5A 1UILA 4F6NA 2LJUA 2EL4A 2EQ1A 3K6QA 4R8OA 4GEQB 2BB8A 3HTXA 1QNTA 2G7HA 1N3GA 2EM0A 4R2EA 2JR1A 3AUZA 2MKDA 4WFTA 4DV5E 2LUPB 1G2DC 2UUCE 3VHTB 2YTEA 3JTZA 2GLIA 4ZYGA 3EPHA 1N32E 2RSIA 4JI0E 2ODRD 2EMGA 2LVHA 4M0VA 2YSOA 1GZ6A 4F9BB 2EMHA 2EWLA 2YU8A 5IT9C 4R2RA 2JWOA 3QG5C 1FKAE 2YTGA 4LU9A 4DKKA 2R1FA 4WYQB 4F54A 3F6GA 2YRHA 2EOEA 1UBDC 2GPIA 2YSPA 2EOHA 1XNRE 2EZ6A 1DI2A 2HJJA 4KWYA 4BHCA 4DR2E 2HGHA 1ZBQA 4R2QA 1XNQE 1WHNA 3BF2A 2M7QA 2M9AA 4RH8A 5AASA 2EOFA 1PJTA 3JAMC 2V86A 1IQOA 5AE2A 4GKJE 1J5EE 2CT1A 2RS6A 4YHHE 2LRSA 1F2IG 2UUBE 3MSWA 2DLQA 4DV2E 4BC9A 5KL6A 5AE3A 4B3TE 3RMPA 4JI2E 3ADJA 4WXDA 2EPNA 3ECRA 4LF8E 3IWDA 2L2NA 1YSAC 4Q35B 2M1SA 1WJPA 4MLVA 2L33A 4BC7A 2ELZA 1YZ9A 5A6KA 4R2CA 2EOMA 2EMKA 4BBYA 2I13A 4GKKE 1DQ3A 4DV7E 1YUIA 2RPCA 2NUGA 1Z1BA 2UXBE 2CTDA 1TN9A 4YY3E 2LUQA 3J7Yp 5A69A 1A1GA 4X8WA 1EH7A 1WHQA 5BR8E 3IWCA 1IBLE 2EPZA 2N8XA 3VYYA 4F6MA 2EOYA 1YPNA 2ADRA 4X62E 2L3JA 4LF9E 4LF7E 2VF1A 2EM8A 1HNWE 2V89A 1IBME 3KWRA 3OMLA 2YWQA 4AQYE 2YRMA 2FTXB 1X6HA 1WRJA 4LF6E 4JI6E 2UUAE 1X6FA 2HHHE 2EPUA 2YTJA 1B69A 1IBKE 1XMQE 3ZOQB 5A6AA 4R2SA 3HPSA 3DF6A 2EL5A 4O24A 4JI8E 2N3HA 3M99B 4M30A 2L92A 2EQ3A 2LV2A 3EQ1A 4FK5C 2JVAA 2NABA 3T1YE 2EM3A 1YFHA 3F6HA 1JK2A 2EM2A 4KZSA 2EMCA 1A1KA 1N34E 1IMUA 3FIGA 2EPXA 2YTPA 2EOSA 2V85A 2VE7C 1TF6A 3BGHA 4R03A 5FLXC 1HNZE 3TQMA 4M9VC 2F8BA 4P7DA 1SFEA 5ADZA 1I94E 2B3TB 1A1HA 2WZOA 5CFFE 5KL2A 3ADLA 1X5WA 2K4VA 3IWBA 4DUZE 4WX9A 2EM5A 2LE2A 2KONA 5LMUE 3J7AG 1PKPA 4DMIA 2H36X 2LCEA 2RS7A 2EPLX 4R2AA 5KL3A 2EMLA 4JI5E 4HEIA 2B7VA 2NA2A 2VQFE 1EH6A 2YTOA 4ZYDA 3HQ1A 4R2DA 2EN4A 1DGCA 1A1JA 3T1HE 4JI7E 1YYOA 2EN2A 3KZYA 2MC6A 2BBGA 5IXMB 4JV5E 2WBUA 1EKZA 2DLKA 3C6MA 3LLHA 2WCC3 3J80C 2L8TA 1QU6A 5IV8B 4IS1C 1T4LB 1PJSA 3H09A 4ZYHA 4R2PA 2EMXA 2V83A 2EJ4A 3AV0A 4TUGA 2PRTA 4X66E 5TSEA 2N3GA 1JK1A 3DJWA 4JYAE 4L8NA 2ELYA 2EPKX 1KYQA 2I9IA 2JOXA 1G2FC 1X49A 3P1XA 1X47A 2YPNA 1AH5A 2EMFA 3BIDA 1HR0E 2VRDA 2EMYA 2EOIA 1PDAA 2JP9A 2EMBA 2D9HA 2A25A 5KL4A 2DSYA 1RMDA 2YRKA 4RHBB 2NUFA 1MEYC 4WXCA 3C6KA 2EM6A 2YTDA 2EQ0A 2EP3A 2V87A 5A6BD 2CSHA 2LTRA 1A1LA 4JI4E 3OTOE 4GZNC 4IJDA 1LLMC 2CPNA 2UU9E 2KHXA 2RSMA 5IWAE 4M2ZA 5T6JA 4NXME 2ENAA 1XMOE 2EORA 2ENCA 2K7IA 4DV3E 1ZBTA 3THOB 2ZM6E 4NHRA 5A6JA 2L2MA 4N4RB 2EOOA 4LF4E 4OX9E 4X64E 2UXCE 2DB2A 5LMNE 2YTNA 1RC7A 2DMIA 2EN3A 1T4NA 1TF3A 3EPKA 3KZZA 1IQSA 1NCSA 2V8QB 3MHHC 2DMYA 4O43A 1BBOA 2E1MA 4P78A 1O0WA 2YZTA 1ZAAC 4B3SE 1STUA 2E5LE 4DV4E 3THNA 2J7JA 4I8OA 1T38A 3BBGA 3HPZA 4JI3E 1YUJA 2EE8A 1P47A 3LMLA 3J81C 4MLQA 4BS9A 2EPRA 4LFCE 1SR9A 1T39A 2MDRA 4BHBA 4L5NC 2MKNA 2JPAA 4WSGA 1KJKA 2B9DA 4DR7E 3C4BA 4Q28A 2EMIA 1GQEA 2M4IA 4DUYE 2FV4B 4NXNE 1UHZA 2EPAA 1RQ0A 5LL6R 2JYAA 1X48A 2GHFA 3EPLA 2KOUA 2EPMX 1FJGE 5KL5A 2JOBA 5A6BA 2B7TA 2JXPA 2LBSB 4LTYA 1AAYA 3JU0A 2EM4A 2WBTA 2EL6A 1J26A 2FGGA 3UK3C 2UXDE 2ENHA 3VK6A 3VYXA 2E72A 4DV0E 3ADIA 4LFBE 1BB8A 3ADGA 4LF5E 1L4SA 1N33E 2EMWA 2YTFA 2Q8UA 1ZU1A 2MDGA 4F9CB 4J8ZA 1BBGA 2EN8A 2EOJA 1PJQA 2V88A 4DV6E 4BMJA 2YTIA 2EOQA 2YU5A 2YTQA 2EPPA 2R76A 2L3CA 1HNXE 5AE1A
chains in the Genus database with same CATH topology
4M2ZA 3F6HA 1T4OA 3C4TA 5T6JA 4KZSA 2NUEA 2LJHA 4OOGC 4NXME 4DR4E 1XNRE 1XMOE 4WSPA 4DV3E 4LFAE 2EZ6A 1ZBTA 2ZM6E 1N34E 1DI2A 2L2MA 3FIGA 4LF4E 4OX9E 2JY9A 4X64E 2UXCE 4DR2E 2DB2A 1ZBQA 2V85A 5LMNE 1XNQE 1WHNA 2VE7C 4F9AB 1RC7A 4R03A 5FLXC 1I94E 2M7QA 1T4NA 1WXRA 4JI1E 1HNZE 4DR5E 4DR3E 2F8BA 2RTXA 4P7DA 5AASA 5ADZA 2B3TB 2IHR1 2L6MA 2V86A 2V8QB 2DMYA 3HXLA 3JAMC 5AE2A 4DR1E 2E1MA 4P78A 1YYWA 4GKJE 1J5EE 2RS6A 2WZOA 5CFFE 1O0WA 2YZTA 4YHHE 2LRSA 2K4VA 4DUZE 3IWBA 3ADLA 4KHPE 4BCAA 2UUBE 4B3SE 1STUA 2LE2A 3MSWA 2E5LE 4DV2E 4BC9A 2KONA 5DNYA 5LMUE 4DV4E 3J7AG 4I8OA 1PKPA 4DMIA 2H36X 2RS7A 4X65E 3HPZA 4JI5E 5AE3A 4JI3E 4B3TE 2MC5A 3RMPA 2B7VA 2NA2A 4JI2E 2VQFE 3ADJA 3LMLA 4K0KE 2DIXA 4LF8E 3IWDA 3J81C 3HQ1A 2L2NA 4DR6E 5A2QC 2L2KB 4BS9A 2M1SA 4TUIA 2L33A 4BC7A 1SR9A 4JI7E 4DV1E 3T1HE 4B3ME 4LFCE 1YYOA 4WPYA 2MDRA 4L5NC 5F3WA 1YZ9A 2MC6A 2B9DA 2YT4A 2VQEE 1N36E 4BBYA 1EKZA 4JV5E 4DR7E 3C4BA 1DQ3A 4DV7E 4Q28A 2NUGA 4GKKE 2UXBE 2LMZA 4YY3E 3LLHA 1GQEA 2LUQA 2M4IA 3J7Yp 4DUYE 2F4VE 2ODRC 2L8TA 3J80C 1QU6A 2FV4B 4NXNE 1UHZA 1YYKA 2LTSA 4X8WA 1WHQA 1T4LB 1RQ0A 3H09A 1UILA 5LL6R 5BR8E 3IWCA 1IBLE 1X48A 3VYYA 2V83A 3AV0A 4TUGA 2KOUA 4X66E 3K6QA 2N3GA 4R8OA 4X62E 2L3JA 3DJWA 4LF9E 1FJGE 4LF7E 4JYAE 4GEQB 2JOBA 4L8NA 5IWAE 2VF1A 3HTXA 2G7HA 2B7TA 2LBSB 2V89A 2JOXA 1HNWE 4LTYA 3KWRA 1IBME 3OMLA 3JU0A 2JR1A 3AUZA 1X49A 3P1XA 1X47A 4WFTA 4DV5E 2LUPB 4AQYE 1HR0E 2FTXB 1J26A 2UUCE 4LF6E 2FGGA 3JTZA 4JI6E 2UXDE 2UUAE 3VK6A 3VYXA 2HHHE 4DV0E 3ADIA 4LFBE 1N32E 3ADGA 1IBKE 2DSYA 1XMQE 4JI0E 2ODRD 4LF5E 3ZOQB 2NUFA 1N33E 3HPSA 4F9CB 4M0VA 3DF6A 1GZ6A 4JI8E 4J8ZA 4F9BB 2EWLA 2N3HA 2V87A 2LTRA 4M30A 2V88A 5IT9C 2L92A 4DV6E 4BMJA 2JWOA 3OTOE 1FKAE 4JI4E 4LU9A 4DKKA 2JVAA 4WYQB 2CPNA 4F54A 2KHXA 3F6GA 2RSMA 3T1YE 2UU9E 2L3CA 1HNXE 4B3RE 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2Z A;  1T4O A;  3C4T A;  2NUE A;  2LJH A;  4OOG C;  4NXM E;  4DR4 E;  1XNR E;  1XMO E;  4DV3 E;  4LFA E;  2EZ6 A;  1ZBT A;  2ZM6 E;  1N34 E;  1DI2 A;  2L2M A;  4LF4 E;  4OX9 E;  2JY9 A;  4X64 E;  2UXC E;  4DR2 E;  2DB2 A;  5LMN E;  1XNQ E;  1WHN A;  1RC7 A;  1T4N A;  4JI1 E;  1HNZ E;  4DR5 E;  4DR3 E;  2RTX A;  1I94 E;  2B3T B;  2IHR 1;  4DR1 E;  2DMY A;  1YYW A;  4GKJ E;  1J5E E;  2RS6 A;  4YHH E;  5CFF E;  1O0W A;  3ADL A;  4KHP E;  2LRS A;  4DUZ E;  2UUB E;  4B3S E;  1STU A;  2E5L E;  4DV2 E;  4DV4 E;  5LMU E;  1PKP A;  2RS7 A;  4X65 E;  4JI5 E;  4JI3 E;  4B3T E;  2B7V A;  2NA2 A;  4JI2 E;  2VQF E;  3ADJ A;  4K0K E;  2DIX A;  4LF8 E;  2L2N A;  4DR6 E;  2L2K B;  4DV1 E;  2L33 A;  3T1H E;  4JI7 E;  4LFC E;  4B3M E;  1YYO A;  2MDR A;  1YZ9 A;  2YT4 A;  2VQE E;  1N36 E;  4JV5 E;  1EKZ A;  4DR7 E;  3C4B A;  4DV7 E;  2NUG A;  4GKK E;  2UXB E;  4YY3 E;  3LLH A;  1GQE A;  2LUQ A;  3J7Y p;  4DUY E;  2F4V E;  1QU6 A;  4NXN E;  1UHZ A;  1YYK A;  2LTS A;  4X8W A;  1WHQ A;  1T4L B;  1RQ0 A;  1UIL A;  5BR8 E;  1IBL E;  1X48 A;  3VYY A;  4X66 E;  2N3G A;  4X62 E;  2L3J A;  1FJG E;  4JYA E;  4LF9 E;  4LF7 E;  3HTX A;  2B7T A;  2LBS B;  1HNW E;  1IBM E;  1X49 A;  3P1X A;  4WFT A;  1X47 A;  4DV5 E;  2LUP B;  4AQY E;  1HR0 E;  1J26 A;  2UUC E;  4LF6 E;  4JI6 E;  2UXD E;  2UUA E;  3VYX A;  2HHH E;  4DV0 E;  3ADI A;  4LFB E;  1N32 E;  3ADG A;  1IBK E;  1XMQ E;  4JI0 E;  4LF5 E;  2NUF A;  1N33 E;  4JI8 E;  2N3H A;  2LTR A;  4M30 A;  4DV6 E;  4JI4 E;  1FKA E;  3OTO E;  4DKK A;  2JVA A;  4WYQ B;  2CPN A;  3T1Y E;  2KHX A;  2UU9 E;  2RSM A;  2L3C A;  1HNX E;  4B3R E;  5IWA E; 
#chains in the Genus database with same CATH topology
 1T4O A;  4NZV A;  3C4T A;  2NUE A;  2LJH A;  4OOG C;  4DR4 E;  2LO3 A;  3MHS C;  4WSP A;  4LFA E;  3L00 A;  4O5G A;  2WBS A;  4HTG A;  4O4K A;  2EPC A;  2JY9 A;  1UN6 B;  1X6E A;  4F9A B;  5KL7 A;  1WXR A;  4JI1 E;  4DR5 E;  4B3R E;  4DR3 E;  2RTX A;  1X3C A;  2IHR 1;  2L6M A;  3HXL A;  4DR1 E;  1YYW A;  2HC5 A;  2EPO A;  2EMZ A;  2EN7 A;  1ZR9 A;  4KHP E;  2EN1 A;  1MGT A;  2EM9 A;  1A1F A;  1NEI A;  4BCA A;  2EMA A;  2EM7 A;  5DNY A;  1A1I A;  2DGC A;  4F2J C;  4X9J A;  4X65 E;  1EH8 A;  2MC5 A;  4K0K E;  2DIX A;  5AC4 A;  4ZYE A;  4DR6 E;  5A2Q C;  2L2K B;  4TUI A;  4DV1 E;  5LLQ A;  2RQL A;  4B3M E;  4WPY A;  2EOZ A;  5F3W A;  1GTK A;  2YT4 A;  2VQE E;  2EN6 A;  2EOX A;  3EPJ A;  1N36 E;  2LMZ A;  2DRP A;  2F4V E;  2ODR C;  2LT7 A;  1YYK A;  2LTS A;  5AC5 A;  1UIL A;  4F6N A;  2LJU A;  2EL4 A;  2EQ1 A;  3K6Q A;  4R8O A;  4GEQ B;  2BB8 A;  3HTX A;  1QNT A;  2G7H A;  1N3G A;  2EM0 A;  4R2E A;  2JR1 A;  3AUZ A;  2MKD A;  4WFT A;  4DV5 E;  2LUP B;  1G2D C;  2UUC E;  3VHT B;  2YTE A;  3JTZ A;  2GLI A;  4ZYG A;  3EPH A;  1N32 E;  2RSI A;  4JI0 E;  2ODR D;  2EMG A;  2LVH A;  4M0V A;  2YSO A;  1GZ6 A;  4F9B B;  2EMH A;  2EWL A;  2YU8 A;  5IT9 C;  4R2R A;  2JWO A;  3QG5 C;  1FKA E;  2YTG A;  4LU9 A;  4DKK A;  2R1F A;  4WYQ B;  4F54 A;  3F6G A;  2YRH A;  2EOE A;  1UBD C;  2GPI A;  2YSP A;  2EOH A;  1XNR E;  2EZ6 A;  1DI2 A;  2HJJ A;  4KWY A;  4BHC A;  4DR2 E;  2HGH A;  1ZBQ A;  4R2Q A;  1XNQ E;  1WHN A;  3BF2 A;  2M7Q A;  2M9A A;  4RH8 A;  5AAS A;  2EOF A;  1PJT A;  3JAM C;  2V86 A;  1IQO A;  5AE2 A;  4GKJ E;  1J5E E;  2CT1 A;  2RS6 A;  4YHH E;  2LRS A;  1F2I G;  2UUB E;  3MSW A;  2DLQ A;  4DV2 E;  4BC9 A;  5KL6 A;  5AE3 A;  4B3T E;  3RMP A;  4JI2 E;  3ADJ A;  4WXD A;  2EPN A;  3ECR A;  4LF8 E;  3IWD A;  2L2N A;  1YSA C;  4Q35 B;  2M1S A;  1WJP A;  4MLV A;  2L33 A;  4BC7 A;  2ELZ A;  1YZ9 A;  5A6K A;  4R2C A;  2EOM A;  2EMK A;  4BBY A;  2I13 A;  4GKK E;  1DQ3 A;  4DV7 E;  1YUI A;  2RPC A;  2NUG A;  1Z1B A;  2UXB E;  2CTD A;  1TN9 A;  4YY3 E;  2LUQ A;  3J7Y p;  5A69 A;  1A1G A;  4X8W A;  1EH7 A;  1WHQ A;  5BR8 E;  3IWC A;  1IBL E;  2EPZ A;  2N8X A;  3VYY A;  4F6M A;  2EOY A;  1YPN A;  2ADR A;  4X62 E;  2L3J A;  4LF9 E;  4LF7 E;  2VF1 A;  2EM8 A;  1HNW E;  2V89 A;  1IBM E;  3KWR A;  3OML A;  2YWQ A;  4AQY E;  2YRM A;  2FTX B;  1X6H A;  1WRJ A;  4LF6 E;  4JI6 E;  2UUA E;  1X6F A;  2HHH E;  2EPU A;  2YTJ A;  1B69 A;  1IBK E;  1XMQ E;  3ZOQ B;  5A6A A;  4R2S A;  3HPS A;  3DF6 A;  2EL5 A;  4O24 A;  4JI8 E;  2N3H A;  3M99 B;  4M30 A;  2L92 A;  2EQ3 A;  2LV2 A;  3EQ1 A;  4FK5 C;  2JVA A;  2NAB A;  3T1Y E;  2EM3 A;  1YFH A;  3F6H A;  1JK2 A;  2EM2 A;  4KZS A;  2EMC A;  1A1K A;  1N34 E;  1IMU A;  3FIG A;  2EPX A;  2YTP A;  2EOS A;  2V85 A;  2VE7 C;  1TF6 A;  3BGH A;  4R03 A;  5FLX C;  1HNZ E;  3TQM A;  4M9V C;  2F8B A;  4P7D A;  1SFE A;  5ADZ A;  1I94 E;  2B3T B;  1A1H A;  2WZO A;  5CFF E;  5KL2 A;  3ADL A;  1X5W A;  2K4V A;  3IWB A;  4DUZ E;  4WX9 A;  2EM5 A;  2LE2 A;  2KON A;  5LMU E;  3J7A G;  1PKP A;  4DMI A;  2H36 X;  2LCE A;  2RS7 A;  2EPL X;  4R2A A;  5KL3 A;  2EML A;  4JI5 E;  4HEI A;  2B7V A;  2NA2 A;  2VQF E;  1EH6 A;  2YTO A;  4ZYD A;  3HQ1 A;  4R2D A;  2EN4 A;  1DGC A;  1A1J A;  3T1H E;  4JI7 E;  1YYO A;  2EN2 A;  3KZY A;  2MC6 A;  2BBG A;  5IXM B;  4JV5 E;  2WBU A;  1EKZ A;  2DLK A;  3C6M A;  3LLH A;  2WCC 3;  3J80 C;  2L8T A;  1QU6 A;  5IV8 B;  4IS1 C;  1T4L B;  1PJS A;  3H09 A;  4ZYH A;  4R2P A;  2EMX A;  2V83 A;  2EJ4 A;  3AV0 A;  4TUG A;  2PRT A;  4X66 E;  5TSE A;  2N3G A;  1JK1 A;  3DJW A;  4JYA E;  4L8N A;  2ELY A;  2EPK X;  1KYQ A;  2I9I A;  2JOX A;  1G2F C;  1X49 A;  3P1X A;  1X47 A;  2YPN A;  1AH5 A;  2EMF A;  3BID A;  1HR0 E;  2VRD A;  2EMY A;  2EOI A;  1PDA A;  2JP9 A;  2EMB A;  2D9H A;  2A25 A;  5KL4 A;  2DSY A;  1RMD A;  2YRK A;  4RHB B;  2NUF A;  1MEY C;  4WXC A;  3C6K A;  2EM6 A;  2YTD A;  2EQ0 A;  2EP3 A;  2V87 A;  5A6B D;  2CSH A;  2LTR A;  1A1L A;  4JI4 E;  3OTO E;  4GZN C;  4IJD A;  1LLM C;  2CPN A;  2UU9 E;  2KHX A;  2RSM A;  5IWA E;  4M2Z A;  5T6J A;  4NXM E;  2ENA A;  1XMO E;  2EOR A;  2ENC A;  2K7I A;  4DV3 E;  1ZBT A;  3THO B;  2ZM6 E;  4NHR A;  5A6J A;  2L2M A;  4N4R B;  2EOO A;  4LF4 E;  4OX9 E;  4X64 E;  2UXC E;  2DB2 A;  5LMN E;  2YTN A;  1RC7 A;  2DMI A;  2EN3 A;  1T4N A;  1TF3 A;  3EPK A;  3KZZ A;  1IQS A;  1NCS A;  2V8Q B;  3MHH C;  2DMY A;  4O43 A;  1BBO A;  2E1M A;  4P78 A;  1O0W A;  2YZT A;  1ZAA C;  4B3S E;  1STU A;  2E5L E;  4DV4 E;  3THN A;  2J7J A;  4I8O A;  1T38 A;  3BBG A;  3HPZ A;  4JI3 E;  1YUJ A;  2EE8 A;  1P47 A;  3LML A;  3J81 C;  4MLQ A;  4BS9 A;  2EPR A;  4LFC E;  1SR9 A;  1T39 A;  2MDR A;  4BHB A;  4L5N C;  2MKN A;  2JPA A;  4WSG A;  1KJK A;  2B9D A;  4DR7 E;  3C4B A;  4Q28 A;  2EMI A;  1GQE A;  2M4I A;  4DUY E;  2FV4 B;  4NXN E;  1UHZ A;  2EPA A;  1RQ0 A;  5LL6 R;  2JYA A;  1X48 A;  2GHF A;  3EPL A;  2KOU A;  2EPM X;  1FJG E;  5KL5 A;  2JOB A;  5A6B A;  2B7T A;  2JXP A;  2LBS B;  4LTY A;  1AAY A;  3JU0 A;  2EM4 A;  2WBT A;  2EL6 A;  1J26 A;  2FGG A;  3UK3 C;  2UXD E;  2ENH A;  3VK6 A;  3VYX A;  2E72 A;  4DV0 E;  3ADI A;  4LFB E;  1BB8 A;  3ADG A;  4LF5 E;  1L4S A;  1N33 E;  2EMW A;  2YTF A;  2Q8U A;  1ZU1 A;  2MDG A;  4F9C B;  4J8Z A;  1BBG A;  2EN8 A;  2EOJ A;  1PJQ A;  2V88 A;  4DV6 E;  4BMJ A;  2YTI A;  2EOQ A;  2YU5 A;  2YTQ A;  2EPP A;  2R76 A;  2L3C A;  1HNX E;  5AE1 A; 
#chains in the Genus database with same CATH homology
 4M2Z A;  3F6H A;  1T4O A;  3C4T A;  5T6J A;  4KZS A;  2NUE A;  2LJH A;  4OOG C;  4NXM E;  4DR4 E;  1XNR E;  1XMO E;  4WSP A;  4DV3 E;  4LFA E;  2EZ6 A;  1ZBT A;  2ZM6 E;  1N34 E;  1DI2 A;  2L2M A;  3FIG A;  4LF4 E;  4OX9 E;  2JY9 A;  4X64 E;  2UXC E;  4DR2 E;  2DB2 A;  1ZBQ A;  2V85 A;  5LMN E;  1XNQ E;  1WHN A;  2VE7 C;  4F9A B;  1RC7 A;  4R03 A;  5FLX C;  1I94 E;  2M7Q A;  1T4N A;  1WXR A;  4JI1 E;  1HNZ E;  4DR5 E;  4DR3 E;  2F8B A;  2RTX A;  4P7D A;  5AAS A;  5ADZ A;  2B3T B;  2IHR 1;  2L6M A;  2V86 A;  2V8Q B;  2DMY A;  3HXL A;  3JAM C;  5AE2 A;  4DR1 E;  2E1M A;  4P78 A;  1YYW A;  4GKJ E;  1J5E E;  2RS6 A;  2WZO A;  5CFF E;  1O0W A;  2YZT A;  4YHH E;  2LRS A;  2K4V A;  4DUZ E;  3IWB A;  3ADL A;  4KHP E;  4BCA A;  2UUB E;  4B3S E;  1STU A;  2LE2 A;  3MSW A;  2E5L E;  4DV2 E;  4BC9 A;  2KON A;  5DNY A;  5LMU E;  4DV4 E;  3J7A G;  4I8O A;  1PKP A;  4DMI A;  2H36 X;  2RS7 A;  4X65 E;  3HPZ A;  4JI5 E;  5AE3 A;  4JI3 E;  4B3T E;  2MC5 A;  3RMP A;  2B7V A;  2NA2 A;  4JI2 E;  2VQF E;  3ADJ A;  3LML A;  4K0K E;  2DIX A;  4LF8 E;  3IWD A;  3J81 C;  3HQ1 A;  2L2N A;  4DR6 E;  5A2Q C;  2L2K B;  4BS9 A;  2M1S A;  4TUI A;  2L33 A;  4BC7 A;  1SR9 A;  4JI7 E;  4DV1 E;  3T1H E;  4B3M E;  4LFC E;  1YYO A;  4WPY A;  2MDR A;  4L5N C;  5F3W A;  1YZ9 A;  2MC6 A;  2B9D A;  2YT4 A;  2VQE E;  1N36 E;  4BBY A;  1EKZ A;  4JV5 E;  4DR7 E;  3C4B A;  1DQ3 A;  4DV7 E;  4Q28 A;  2NUG A;  4GKK E;  2UXB E;  2LMZ A;  4YY3 E;  3LLH A;  1GQE A;  2LUQ A;  2M4I A;  3J7Y p;  4DUY E;  2F4V E;  2ODR C;  2L8T A;  3J80 C;  1QU6 A;  2FV4 B;  4NXN E;  1UHZ A;  1YYK A;  2LTS A;  4X8W A;  1WHQ A;  1T4L B;  1RQ0 A;  3H09 A;  1UIL A;  5LL6 R;  5BR8 E;  3IWC A;  1IBL E;  1X48 A;  3VYY A;  2V83 A;  3AV0 A;  4TUG A;  2KOU A;  4X66 E;  3K6Q A;  2N3G A;  4R8O A;  4X62 E;  2L3J A;  3DJW A;  4LF9 E;  1FJG E;  4LF7 E;  4JYA E;  4GEQ B;  2JOB A;  4L8N A;  5IWA E;  2VF1 A;  3HTX A;  2G7H A;  2B7T A;  2LBS B;  2V89 A;  2JOX A;  1HNW E;  4LTY A;  3KWR A;  1IBM E;  3OML A;  3JU0 A;  2JR1 A;  3AUZ A;  1X49 A;  3P1X A;  1X47 A;  4WFT A;  4DV5 E;  2LUP B;  4AQY E;  1HR0 E;  2FTX B;  1J26 A;  2UUC E;  4LF6 E;  2FGG A;  3JTZ A;  4JI6 E;  2UXD E;  2UUA E;  3VK6 A;  3VYX A;  2HHH E;  4DV0 E;  3ADI A;  4LFB E;  1N32 E;  3ADG A;  1IBK E;  2DSY A;  1XMQ E;  4JI0 E;  2ODR D;  4LF5 E;  3ZOQ B;  2NUF A;  1N33 E;  3HPS A;  4F9C B;  4M0V A;  3DF6 A;  1GZ6 A;  4JI8 E;  4J8Z A;  4F9B B;  2EWL A;  2N3H A;  2V87 A;  2LTR A;  4M30 A;  2V88 A;  5IT9 C;  2L92 A;  4DV6 E;  4BMJ A;  2JWO A;  3OTO E;  1FKA E;  4JI4 E;  4LU9 A;  4DKK A;  2JVA A;  4WYQ B;  2CPN A;  4F54 A;  2KHX A;  3F6G A;  2RSM A;  3T1Y E;  2UU9 E;  2L3C A;  1HNX E;  4B3R E;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...