1T4OA

Crystal structure of rnt1p dsrbd
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ribonuclease III
total genus 21
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4oA00
1UHZA 2L2KB 4JI8E 4LFAE 4DV3E 2LBSB 4YY3E 1IBLE 4DV4E 4DR1E 4JI2E 2LUPB 1T4OA 1YYKA 4B3RE 1O0WA 1EKZA 1N34E 4LF6E 4JI4E 2B7VA 2LJHA 2KHXA 2NUFA 2DB2A 4DV2E 4WFTA 5BR8E 4JI1E 2F4VE 4DR3E 2YT4A 4NXNE 4DR7E 4LFBE 4M2ZA 2UU9E 2LTSA 1PKPA 4B3SE 4GKKE 3T1YE 4DKKA 3LLHA 2RTXA 2N3HA 2L33A 2L2MA 2DMYA 2IHR1 2VQEE 2RSMA 4B3TE 4LF5E 4JV5E 4KHPE 4LF9E 4LF7E 2RS6A 1IBME 1XNRE 4DV0E 2B3TB 1YYWA 4AQYE 4JYAE 1FJGE 4DV7E 2ZM6E 2UXDE 2UUBE 3ADGA 3J7Yp 4LF4E 3T1HE 1IBKE 2DIXA 4DV1E 2HHHE 3ADLA 4YHHE 1RC7A 2MDRA 1X49A 3HTXA 5IWAE 4M30A 4GKJE 3C4BA 1GQEA 1HNWE 4DR6E 4X66E 1N33E 1WHQA 4JI3E 1UILA 3C4TA 2L3CA 2L3JA 2UUAE 3VYXA 1X47A 4DR4E 1QU6A 1ZBTA 4JI5E 3VYYA 4LF8E 4OX9E 4OOGC 1I94E 2NA2A 2VQFE 4DR2E 4X65E 1J26A 1HR0E 1XMQE 2L2NA 4JI6E 4JI0E 2UXCE 1STUA 1WHNA 1XMOE 2UUCE 1XNQE 4K0KE 2EZ6A 4DR5E 4B3ME 2B7TA 4WYQB 1N36E 4DV5E 2LRSA 2UXBE 1HNZE 2RS7A 3ADIA 2NUEA 5CFFE 2JY9A 4X64E 1N32E 3OTOE 4X62E 1RQ0A 2JVAA 1YYOA 1DI2A 1YZ9A 1FKAE 1HNXE 4DUYE 4DV6E 1T4NA 2LUQA 2E5LE 4JI7E 5LMUE 2N3GA 1X48A 1T4LB 3ADJA 3P1XA 2NUGA 5LMNE 2CPNA 4LFCE 1J5EE 4X8WA 4NXME 2LTRA 4DUZE
chains in the Genus database with same CATH superfamily
1UHZA 2LBSB 4YY3E 4BC7A 3AUZA 2BB8A 3KWRA 4DR1E 1IQOA 4HEIA 4R2AA 2LT7A 2YZTA 1JK1A 2YTGA 2EQ1A 1TF3A 2DGCA 2B7VA 2LJHA 1WXRA 2KHXA 4MLVA 1X6FA 2ENCA 4DR7E 5IV8B 2EM5A 1A1HA 2LTSA 2WZOA 2EOFA 1PKPA 4GKKE 2VRDA 2WCC3 2JOBA 3LLHA 2RTXA 4F54A 2YTEA 4O5GA 2EM4A 2R76A 3DF6A 5AE2A 1QNTA 4LF5E 2EL4A 2ELZA 2JXPA 1AH5A 1XNRE 3IWCA 1YYWA 3F6HA 1GTKA 4WSPA 3J7Yp 4LF4E 2YU8A 2BBGA 1A1GA 2HHHE 2JR1A 3LMLA 1X49A 1L4SA 3HTXA 2YTPA 2RQLA 4M30A 1GQEA 3HPZA 4X66E 1WHQA 3DJWA 2L3JA 3BBGA 2EQ3A 3JTZA 2EOSA 1ZU1A 1A1IA 2YU5A 1GZ6A 3MHHC 1X3CA 1QU6A 4OX9E 2EPPA 2EPNA 5TSEA 1EH6A 1XMQE 2JPAA 4JI6E 2EM3A 2WBUA 2EM7A 2UXCE 4IJDA 2ODRD 1WHNA 1XMOE 2L92A 4K0KE 2EZ6A 4BMJA 2MKNA 2B7TA 3ECRA 2PRTA 4GZNC 2RS7A 1KJKA 2EORA 5CFFE 2JY9A 2DLKA 1DGCA 5A6JA 2EN3A 3JU0A 5AC4A 4TUIA 5KL5A 1YUJA 2EMXA 2KOUA 4DUYE 1NCSA 4DV6E 4JI7E 4WX9A 5LMUE 1X48A 4L5NC 1A1FA 3ADJA 2LCEA 2V86A 4O43A 4LFCE 2F8BA 4X8WA 1PDAA 4KZSA 1YFHA 2K4VA 4JI8E 4LFAE 2EM9A 3EQ1A 3MHSC 4DV4E 2EMIA 2GLIA 1T4OA 4B3RE 1O0WA 4R2SA 3C6MA 4JI1E 4DR3E 2YT4A 1F2IG 4NXNE 1G2FC 4LFBE 2RPCA 2UU9E 2YTOA 4B3SE 3JAMC 3T1YE 5DNYA 4DKKA 2I13A 2N3HA 2DMYA 2EL6A 3IWDA 4R2DA 2YTNA 1AAYA 4B3TE 2YRMA 4P7DA 2V83A 2EN7A 3EPJA 1WRJA 3QG5C 4LF7E 2EMAA 4AQYE 1FJGE 2EL5A 2ZM6E 4DV7E 2UUBE 3ADGA 3T1HE 2EM6A 2R1FA 4L8NA 2V85A 1EH8A 2LJUA 2V89A 4R2QA 2EMCA 5IWAE 4I8OA 4GKJE 2EPRA 3C4BA 5FLXC 3J80C 2EOQA 2GHFA 2B9DA 1T38A 2YRKA 5KL6A 4LF8E 4R03A 1PJTA 4J8ZA 2WBSA 4DR2E 1J26A 1HR0E 1PJQA 2KONA 2FTXB 2FGGA 1YSAC 2EN2A 4B3ME 3ADIA 2NABA 3UK3C 2DSYA 3L00A 2YTFA 4FK5C 2JVAA 1YZ9A 4BHBA 2EOIA 2YTJA 1IMUA 2EN1A 2DRPA 1NEIA 1T4LB 1BBOA 4ZYEA 2CPNA 1J5EE 4NXME 2LTRA 4DUZE 2J7JA 3HQ1A 4ZYHA 2L8TA 1UN6B 1UBDC 2EMLA 5KL7A 1DQ3A 2MC6A 4JI2E 4F9BB 2EOHA 1YYKA 2M7QA 1EKZA 4Q28A 1N34E 4LF6E 4JI4E 2EMKA 4O24A 3RMPA 1SR9A 4R2PA 4DV2E 4WFTA 5BR8E 3EPLA 2MDGA 4M2ZA 2ELYA 2EWLA 4LU9A 1MEYC 5A2QC 2V88A 5KL4A 2L33A 2ENHA 4NZVA 2IHR1 5IXMB 1YPNA 4JV5E 2K7IA 1N3GA 2LE2A 2EPLX 2MKDA 1IBME 2WBTA 4WSGA 2B3TB 4WXCA 4WXDA 3J81C 1JK2A 2EPCA 3BGHA 2Q8UA 4M0VA 4ZYGA 5AASA 3ADLA 4YHHE 3OMLA 4F6MA 1RC7A 2V8QB 1SFEA 1EH7A 1WJPA 2EJ4A 1X5WA 2YTQA 3AV0A 2RSIA 3VK6A 4DR6E 1N33E 2YSPA 4F9CB 1UILA 2EN8A 2UUAE 5LLQA 4X9JA 4GEQB 1PJSA 4BCAA 2EOYA 2D9HA 1ZBTA 2EMZA 5IT9C 2EN6A 2EQ0A 5AE1A 5A6BD 1A1LA 2L2NA 2EOXA 2EPOA 2FV4B 4IS1C 4R2EA 1STUA 3THOB 1TN9A 3KZZA 4RH8A 2YWQA 1G2DC 1XNQE 2EOEA 4BBYA 1N36E 5AC5A 3EPKA 4DV5E 2LRSA 2EM8A 1HNZE 2ADRA 2NUEA 2EPKX 5T6JA 3FIGA 1N32E 2EPZA 3OTOE 3THNA 5A6AA 1ZR9A 2EMFA 2G7HA 1RMDA 2EMYA 1T39A 4BS9A 4F6NA 4BC9A 1YYOA 2EOJA 2E1MA 4TUGA 2M1SA 1FKAE 3K6QA 3C6KA 2HC5A 1T4NA 2LUQA 4P78A 3HXLA 2EOOA 3KZYA 2NUGA 2EP3A 5LMNE 1ZAAC 2N3GA 4RHBB 2L2KB 3ZOQB 2EPUA 4DV3E 2H36X 1IBLE 2HGHA 1LLMC 1KYQA 5A69A 2LUPB 2EMBA 1B69A 4MLQA 2YTIA 1X6HA 1Z1BA 2NUFA 2YSOA 2DB2A 2F4VE 2ENAA 4R2CA 3BIDA 5KL3A 2YTDA 2EM2A 5F3WA 3TQMA 4R2RA 2ODRC 3H09A 3J7AG 1A1KA 2CTDA 2L2MA 2EOMA 1IQSA 2VQEE 2RSMA 2VE7C 5ADZA 3F6GA 4KHPE 5A6BA 5AE3A 4LF9E 2DMIA 5KL2A 1TF6A 2RS6A 4DV0E 4F2JC 4JYAE 2LMZA 2UXDE 2JWOA 1P47A 2V87A 1IBKE 2DIXA 2VF1A 1ZBQA 4DV1E 5A6KA 2EPXA 4M9VC 5LL6R 2MDRA 4NHRA 1BBGA 4WPYA 1HNWE 2N8XA 2A25A 1A1JA 4JI3E 2EN4A 3C4TA 2HJJA 2L3CA 2EMHA 3VYXA 2MC5A 2YRHA 1X47A 3M99B 2EOZA 4DR4E 2CT1A 2EPMX 4ZYDA 4JI5E 3VYYA 4OOGC 2I9IA 2JYAA 2NA2A 1I94E 1X6EA 2VQFE 4LTYA 4X65E 4N4RB 1YUIA 1BB8A 2LVHA 4JI0E 2EMWA 3MSWA 4O4KA 4F9AB 1MGTA 2UUCE 2LV2A 4DR5E 3EPHA 2YPNA 2CSHA 4WYQB 2UXBE 2EM0A 2JP9A 4X64E 2LO3A 2DLQA 3HPSA 4X62E 2JOXA 1RQ0A 3IWBA 3BF2A 2EE8A 2EMGA 2E72A 2GPIA 4HTGA 1DI2A 1HNXE 2L6MA 4Q35B 2EPAA 2E5LE 2M9AA 4R8OA 4BHCA 4DMIA 3P1XA 2M4IA 3VHTB 4KWYA
chains in the Genus database with same CATH topology
3HQ1A 1UHZA 2K4VA 2L8TA 4JI8E 3ZOQB 2L2KB 4LFAE 4DV3E 2LBSB 2H36X 4YY3E 4BC7A 3AUZA 4DUZE 1IBLE 3KWRA 4DV4E 1DQ3A 2MC6A 4DR1E 4JI2E 4F9BB 2LUPB 1T4OA 1YYKA 2YZTA 2M7QA 4B3RE 1O0WA 1EKZA 4Q28A 1N34E 4LF6E 4JI4E 3RMPA 2B7VA 1SR9A 2LJHA 2KHXA 1WXRA 2DB2A 2NUFA 4NXME 4DV2E 4WFTA 5BR8E 4JI1E 2F4VE 4DR3E 2YT4A 4NXNE 4DR7E 5F3WA 4LFBE 4M2ZA 2UU9E 2EWLA 2LTSA 2WZOA 4LU9A 1PKPA 4B3SE 3JAMC 4GKKE 3T1YE 2ODRC 3H09A 5DNYA 4DKKA 2JOBA 3LLHA 2RTXA 4F54A 5A2QC 2V88A 3J7AG 2N3HA 2L33A 2L2MA 2DMYA 3IWDA 2IHR1 2VQEE 2RSMA 2VE7C 5ADZA 3DF6A 4B3TE 3F6GA 4P7DA 2V83A 5AE2A 4LF5E 4JV5E 4KHPE 2LE2A 5AE3A 4LF9E 4LF7E 2RS6A 1IBME 1XNRE 3IWCA 4DV0E 2B3TB 1YYWA 4AQYE 4JYAE 3J81C 1FJGE 2LMZA 2ZM6E 4DV7E 2UXDE 2UUBE 3F6HA 2JWOA 3ADGA 2V87A 4M0VA 5AASA 4WSPA 3J7Yp 3T1HE 4LF4E 1IBKE 2DIXA 2VF1A 1ZBQA 4L8NA 4DV1E 2HHHE 2V85A 3ADLA 4YHHE 2JR1A 2V89A 3LMLA 3OMLA 5LL6R 2V8QB 2MDRA 1X49A 1RC7A 3HTXA 4WPYA 5IWAE 3AV0A 4I8OA 4M30A 4GKJE 3C4BA 1GQEA 3VK6A 1HNWE 5FLXC 3J80C 4DR6E 3HPZA 4X66E 1N33E 1WHQA 4F9CB 4JI3E 1UILA 3DJWA 3C4TA 2L3CA 2L3JA 3JTZA 2UUAE 3VYXA 4GEQB 2MC5A 1GZ6A 1X47A 4BCAA 4DR4E 2B9DA 1QU6A 1ZBTA 5IT9C 3VYYA 4JI5E 4LF8E 4R03A 4OX9E 4OOGC 5AE1A 1I94E 2NA2A 4J8ZA 2VQFE 4LTYA 4X65E 4DR2E 1HR0E 1XMQE 1J26A 2L2NA 4JI6E 2FV4B 4JI0E 2UXCE 2KONA 2ODRD 1STUA 3MSWA 1WHNA 1XMOE 4F9AB 2FTXB 2L92A 2UUCE 2FGGA 1XNQE 4K0KE 2EZ6A 4BMJA 4BBYA 4DR5E 4B3ME 2B7TA 4WYQB 1N36E 4DV5E 2LRSA 2UXBE 1HNZE 2RS7A 3ADIA 2NUEA 5CFFE 2JY9A 4X64E 2DSYA 5T6JA 3FIGA 1N32E 3OTOE 3HPSA 3JU0A 4X62E 2JOXA 1RQ0A 2G7HA 3IWBA 4BS9A 4TUIA 2JVAA 4BC9A 1YYOA 2E1MA 1DI2A 4TUGA 4KZSA 2M1SA 1FKAE 3K6QA 1YZ9A 1HNXE 2KOUA 2L6MA 4DUYE 4DV6E 1T4NA 2LUQA 2E5LE 4P78A 4R8OA 3HXLA 4JI7E 5LMUE 1X48A 4L5NC 1T4LB 4DMIA 3ADJA 3P1XA 2NUGA 2V86A 5LMNE 2CPNA 2M4IA 2F8BA 1J5EE 4X8WA 4LFCE 2LTRA 2N3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHZ A;  2L2K B;  4JI8 E;  4LFA E;  4DV3 E;  2LBS B;  4YY3 E;  1IBL E;  4DV4 E;  4DR1 E;  4JI2 E;  2LUP B;  1T4O A;  1YYK A;  4B3R E;  1O0W A;  1EKZ A;  1N34 E;  4LF6 E;  4JI4 E;  2B7V A;  2LJH A;  2KHX A;  2NUF A;  2DB2 A;  4DV2 E;  4WFT A;  5BR8 E;  4JI1 E;  2F4V E;  4DR3 E;  2YT4 A;  4NXN E;  4DR7 E;  4LFB E;  4M2Z A;  2UU9 E;  2LTS A;  1PKP A;  4B3S E;  4GKK E;  3T1Y E;  4DKK A;  3LLH A;  2RTX A;  2N3H A;  2L33 A;  2L2M A;  2DMY A;  2IHR 1;  2VQE E;  2RSM A;  4B3T E;  4LF5 E;  4JV5 E;  4KHP E;  4LF9 E;  4LF7 E;  2RS6 A;  1IBM E;  1XNR E;  4DV0 E;  2B3T B;  1YYW A;  4AQY E;  4JYA E;  1FJG E;  4DV7 E;  2ZM6 E;  2UXD E;  2UUB E;  3ADG A;  3J7Y p;  4LF4 E;  3T1H E;  1IBK E;  2DIX A;  4DV1 E;  2HHH E;  3ADL A;  4YHH E;  1RC7 A;  2MDR A;  1X49 A;  3HTX A;  5IWA E;  4M30 A;  4GKJ E;  3C4B A;  1GQE A;  1HNW E;  4DR6 E;  4X66 E;  1N33 E;  1WHQ A;  4JI3 E;  1UIL A;  3C4T A;  2L3C A;  2L3J A;  2UUA E;  3VYX A;  1X47 A;  4DR4 E;  1QU6 A;  1ZBT A;  4JI5 E;  3VYY A;  4LF8 E;  4OX9 E;  4OOG C;  1I94 E;  2NA2 A;  2VQF E;  4DR2 E;  4X65 E;  1J26 A;  1HR0 E;  1XMQ E;  2L2N A;  4JI6 E;  4JI0 E;  2UXC E;  1STU A;  1WHN A;  1XMO E;  2UUC E;  1XNQ E;  4K0K E;  2EZ6 A;  4DR5 E;  4B3M E;  2B7T A;  4WYQ B;  1N36 E;  4DV5 E;  2LRS A;  2UXB E;  1HNZ E;  2RS7 A;  3ADI A;  2NUE A;  5CFF E;  2JY9 A;  4X64 E;  1N32 E;  3OTO E;  4X62 E;  1RQ0 A;  2JVA A;  1YYO A;  1DI2 A;  1YZ9 A;  1FKA E;  1HNX E;  4DUY E;  4DV6 E;  1T4N A;  2LUQ A;  2E5L E;  4JI7 E;  5LMU E;  2N3G A;  1X48 A;  1T4L B;  3ADJ A;  3P1X A;  2NUG A;  5LMN E;  2CPN A;  4LFC E;  1J5E E;  4X8W A;  4NXM E;  2LTR A;  4DUZ E; 
#chains in the Genus database with same CATH topology
 1UHZ A;  2LBS B;  4YY3 E;  4BC7 A;  3AUZ A;  2BB8 A;  3KWR A;  4DR1 E;  1IQO A;  4HEI A;  4R2A A;  2LT7 A;  2YZT A;  1JK1 A;  2YTG A;  2EQ1 A;  1TF3 A;  2DGC A;  2B7V A;  2LJH A;  1WXR A;  2KHX A;  4MLV A;  1X6F A;  2ENC A;  4DR7 E;  5IV8 B;  2EM5 A;  1A1H A;  2LTS A;  2WZO A;  2EOF A;  1PKP A;  4GKK E;  2VRD A;  2WCC 3;  2JOB A;  3LLH A;  2RTX A;  4F54 A;  2YTE A;  4O5G A;  2EM4 A;  2R76 A;  3DF6 A;  5AE2 A;  1QNT A;  4LF5 E;  2EL4 A;  2ELZ A;  2JXP A;  1AH5 A;  1XNR E;  3IWC A;  1YYW A;  3F6H A;  1GTK A;  4WSP A;  3J7Y p;  4LF4 E;  2YU8 A;  2BBG A;  1A1G A;  2HHH E;  2JR1 A;  3LML A;  1X49 A;  1L4S A;  3HTX A;  2YTP A;  2RQL A;  4M30 A;  1GQE A;  3HPZ A;  4X66 E;  1WHQ A;  3DJW A;  2L3J A;  3BBG A;  2EQ3 A;  3JTZ A;  2EOS A;  1ZU1 A;  1A1I A;  2YU5 A;  1GZ6 A;  3MHH C;  1X3C A;  1QU6 A;  4OX9 E;  2EPP A;  2EPN A;  5TSE A;  1EH6 A;  1XMQ E;  2JPA A;  4JI6 E;  2EM3 A;  2WBU A;  2EM7 A;  2UXC E;  4IJD A;  2ODR D;  1WHN A;  1XMO E;  2L92 A;  4K0K E;  2EZ6 A;  4BMJ A;  2MKN A;  2B7T A;  3ECR A;  2PRT A;  4GZN C;  2RS7 A;  1KJK A;  2EOR A;  5CFF E;  2JY9 A;  2DLK A;  1DGC A;  5A6J A;  2EN3 A;  3JU0 A;  5AC4 A;  4TUI A;  5KL5 A;  1YUJ A;  2EMX A;  2KOU A;  4DUY E;  1NCS A;  4DV6 E;  4JI7 E;  4WX9 A;  5LMU E;  1X48 A;  4L5N C;  1A1F A;  3ADJ A;  2LCE A;  2V86 A;  4O43 A;  4LFC E;  2F8B A;  4X8W A;  1PDA A;  4KZS A;  1YFH A;  2K4V A;  4JI8 E;  4LFA E;  2EM9 A;  3EQ1 A;  3MHS C;  4DV4 E;  2EMI A;  2GLI A;  1T4O A;  4B3R E;  1O0W A;  4R2S A;  3C6M A;  4JI1 E;  4DR3 E;  2YT4 A;  1F2I G;  4NXN E;  1G2F C;  4LFB E;  2RPC A;  2UU9 E;  2YTO A;  4B3S E;  3JAM C;  3T1Y E;  5DNY A;  4DKK A;  2I13 A;  2N3H A;  2DMY A;  2EL6 A;  3IWD A;  4R2D A;  2YTN A;  1AAY A;  4B3T E;  2YRM A;  4P7D A;  2V83 A;  2EN7 A;  3EPJ A;  1WRJ A;  3QG5 C;  4LF7 E;  2EMA A;  4AQY E;  1FJG E;  2EL5 A;  2ZM6 E;  4DV7 E;  2UUB E;  3ADG A;  3T1H E;  2EM6 A;  2R1F A;  4L8N A;  2V85 A;  1EH8 A;  2LJU A;  2V89 A;  4R2Q A;  2EMC A;  5IWA E;  4I8O A;  4GKJ E;  2EPR A;  3C4B A;  5FLX C;  3J80 C;  2EOQ A;  2GHF A;  2B9D A;  1T38 A;  2YRK A;  5KL6 A;  4LF8 E;  4R03 A;  1PJT A;  4J8Z A;  2WBS A;  4DR2 E;  1J26 A;  1HR0 E;  1PJQ A;  2KON A;  2FTX B;  2FGG A;  1YSA C;  2EN2 A;  4B3M E;  3ADI A;  2NAB A;  3UK3 C;  2DSY A;  3L00 A;  2YTF A;  4FK5 C;  2JVA A;  1YZ9 A;  4BHB A;  2EOI A;  2YTJ A;  1IMU A;  2EN1 A;  2DRP A;  1NEI A;  1T4L B;  1BBO A;  4ZYE A;  2CPN A;  1J5E E;  4NXM E;  2LTR A;  4DUZ E;  2J7J A;  3HQ1 A;  4ZYH A;  2L8T A;  1UN6 B;  1UBD C;  2EML A;  5KL7 A;  1DQ3 A;  2MC6 A;  4JI2 E;  4F9B B;  2EOH A;  1YYK A;  2M7Q A;  1EKZ A;  4Q28 A;  1N34 E;  4LF6 E;  4JI4 E;  2EMK A;  4O24 A;  3RMP A;  1SR9 A;  4R2P A;  4DV2 E;  4WFT A;  5BR8 E;  3EPL A;  2MDG A;  4M2Z A;  2ELY A;  2EWL A;  4LU9 A;  1MEY C;  5A2Q C;  2V88 A;  5KL4 A;  2L33 A;  2ENH A;  4NZV A;  2IHR 1;  5IXM B;  1YPN A;  4JV5 E;  2K7I A;  1N3G A;  2LE2 A;  2EPL X;  2MKD A;  1IBM E;  2WBT A;  4WSG A;  2B3T B;  4WXC A;  4WXD A;  3J81 C;  1JK2 A;  2EPC A;  3BGH A;  2Q8U A;  4M0V A;  4ZYG A;  5AAS A;  3ADL A;  4YHH E;  3OML A;  4F6M A;  1RC7 A;  2V8Q B;  1SFE A;  1EH7 A;  1WJP A;  2EJ4 A;  1X5W A;  2YTQ A;  3AV0 A;  2RSI A;  3VK6 A;  4DR6 E;  1N33 E;  2YSP A;  4F9C B;  1UIL A;  2EN8 A;  2UUA E;  5LLQ A;  4X9J A;  4GEQ B;  1PJS A;  4BCA A;  2EOY A;  2D9H A;  1ZBT A;  2EMZ A;  5IT9 C;  2EN6 A;  2EQ0 A;  5AE1 A;  5A6B D;  1A1L A;  2L2N A;  2EOX A;  2EPO A;  2FV4 B;  4IS1 C;  4R2E A;  1STU A;  3THO B;  1TN9 A;  3KZZ A;  4RH8 A;  2YWQ A;  1G2D C;  1XNQ E;  2EOE A;  4BBY A;  1N36 E;  5AC5 A;  3EPK A;  4DV5 E;  2LRS A;  2EM8 A;  1HNZ E;  2ADR A;  2NUE A;  2EPK X;  5T6J A;  3FIG A;  1N32 E;  2EPZ A;  3OTO E;  3THN A;  5A6A A;  1ZR9 A;  2EMF A;  2G7H A;  1RMD A;  2EMY A;  1T39 A;  4BS9 A;  4F6N A;  4BC9 A;  1YYO A;  2EOJ A;  2E1M A;  4TUG A;  2M1S A;  1FKA E;  3K6Q A;  3C6K A;  2HC5 A;  1T4N A;  2LUQ A;  4P78 A;  3HXL A;  2EOO A;  3KZY A;  2NUG A;  2EP3 A;  5LMN E;  1ZAA C;  2N3G A;  4RHB B;  2L2K B;  3ZOQ B;  2EPU A;  4DV3 E;  2H36 X;  1IBL E;  2HGH A;  1LLM C;  1KYQ A;  5A69 A;  2LUP B;  2EMB A;  1B69 A;  4MLQ A;  2YTI A;  1X6H A;  1Z1B A;  2NUF A;  2YSO A;  2DB2 A;  2F4V E;  2ENA A;  4R2C A;  3BID A;  5KL3 A;  2YTD A;  2EM2 A;  5F3W A;  3TQM A;  4R2R A;  2ODR C;  3H09 A;  3J7A G;  1A1K A;  2CTD A;  2L2M A;  2EOM A;  1IQS A;  2VQE E;  2RSM A;  2VE7 C;  5ADZ A;  3F6G A;  4KHP E;  5A6B A;  5AE3 A;  4LF9 E;  2DMI A;  5KL2 A;  1TF6 A;  2RS6 A;  4DV0 E;  4F2J C;  4JYA E;  2LMZ A;  2UXD E;  2JWO A;  1P47 A;  2V87 A;  1IBK E;  2DIX A;  2VF1 A;  1ZBQ A;  4DV1 E;  5A6K A;  2EPX A;  4M9V C;  5LL6 R;  2MDR A;  4NHR A;  1BBG A;  4WPY A;  1HNW E;  2N8X A;  2A25 A;  1A1J A;  4JI3 E;  2EN4 A;  3C4T A;  2HJJ A;  2L3C A;  2EMH A;  3VYX A;  2MC5 A;  2YRH A;  1X47 A;  3M99 B;  2EOZ A;  4DR4 E;  2CT1 A;  2EPM X;  4ZYD A;  4JI5 E;  3VYY A;  4OOG C;  2I9I A;  2JYA A;  2NA2 A;  1I94 E;  1X6E A;  2VQF E;  4LTY A;  4X65 E;  4N4R B;  1YUI A;  1BB8 A;  2LVH A;  4JI0 E;  2EMW A;  3MSW A;  4O4K A;  4F9A B;  1MGT A;  2UUC E;  2LV2 A;  4DR5 E;  3EPH A;  2YPN A;  2CSH A;  4WYQ B;  2UXB E;  2EM0 A;  2JP9 A;  4X64 E;  2LO3 A;  2DLQ A;  3HPS A;  4X62 E;  2JOX A;  1RQ0 A;  3IWB A;  3BF2 A;  2EE8 A;  2EMG A;  2E72 A;  2GPI A;  4HTG A;  1DI2 A;  1HNX E;  2L6M A;  4Q35 B;  2EPA A;  2E5L E;  2M9A A;  4R8O A;  4BHC A;  4DMI A;  3P1X A;  2M4I A;  3VHT B;  4KWY A; 
#chains in the Genus database with same CATH homology
 3HQ1 A;  1UHZ A;  2K4V A;  2L8T A;  4JI8 E;  3ZOQ B;  2L2K B;  4LFA E;  4DV3 E;  2LBS B;  2H36 X;  4YY3 E;  4BC7 A;  3AUZ A;  4DUZ E;  1IBL E;  3KWR A;  4DV4 E;  1DQ3 A;  2MC6 A;  4DR1 E;  4JI2 E;  4F9B B;  2LUP B;  1T4O A;  1YYK A;  2YZT A;  2M7Q A;  4B3R E;  1O0W A;  1EKZ A;  4Q28 A;  1N34 E;  4LF6 E;  4JI4 E;  3RMP A;  2B7V A;  1SR9 A;  2LJH A;  2KHX A;  1WXR A;  2DB2 A;  2NUF A;  4NXM E;  4DV2 E;  4WFT A;  5BR8 E;  4JI1 E;  2F4V E;  4DR3 E;  2YT4 A;  4NXN E;  4DR7 E;  5F3W A;  4LFB E;  4M2Z A;  2UU9 E;  2EWL A;  2LTS A;  2WZO A;  4LU9 A;  1PKP A;  4B3S E;  3JAM C;  4GKK E;  3T1Y E;  2ODR C;  3H09 A;  5DNY A;  4DKK A;  2JOB A;  3LLH A;  2RTX A;  4F54 A;  5A2Q C;  2V88 A;  3J7A G;  2N3H A;  2L33 A;  2L2M A;  2DMY A;  3IWD A;  2IHR 1;  2VQE E;  2RSM A;  2VE7 C;  5ADZ A;  3DF6 A;  4B3T E;  3F6G A;  4P7D A;  2V83 A;  5AE2 A;  4LF5 E;  4JV5 E;  4KHP E;  2LE2 A;  5AE3 A;  4LF9 E;  4LF7 E;  2RS6 A;  1IBM E;  1XNR E;  3IWC A;  4DV0 E;  2B3T B;  1YYW A;  4AQY E;  4JYA E;  3J81 C;  1FJG E;  2LMZ A;  2ZM6 E;  4DV7 E;  2UXD E;  2UUB E;  3F6H A;  2JWO A;  3ADG A;  2V87 A;  4M0V A;  5AAS A;  4WSP A;  3J7Y p;  3T1H E;  4LF4 E;  1IBK E;  2DIX A;  2VF1 A;  1ZBQ A;  4L8N A;  4DV1 E;  2HHH E;  2V85 A;  3ADL A;  4YHH E;  2JR1 A;  2V89 A;  3LML A;  3OML A;  5LL6 R;  2V8Q B;  2MDR A;  1X49 A;  1RC7 A;  3HTX A;  4WPY A;  5IWA E;  3AV0 A;  4I8O A;  4M30 A;  4GKJ E;  3C4B A;  1GQE A;  3VK6 A;  1HNW E;  5FLX C;  3J80 C;  4DR6 E;  3HPZ A;  4X66 E;  1N33 E;  1WHQ A;  4F9C B;  4JI3 E;  1UIL A;  3DJW A;  3C4T A;  2L3C A;  2L3J A;  3JTZ A;  2UUA E;  3VYX A;  4GEQ B;  2MC5 A;  1GZ6 A;  1X47 A;  4BCA A;  4DR4 E;  2B9D A;  1QU6 A;  1ZBT A;  5IT9 C;  3VYY A;  4JI5 E;  4LF8 E;  4R03 A;  4OX9 E;  4OOG C;  5AE1 A;  1I94 E;  2NA2 A;  4J8Z A;  2VQF E;  4LTY A;  4X65 E;  4DR2 E;  1HR0 E;  1XMQ E;  1J26 A;  2L2N A;  4JI6 E;  2FV4 B;  4JI0 E;  2UXC E;  2KON A;  2ODR D;  1STU A;  3MSW A;  1WHN A;  1XMO E;  4F9A B;  2FTX B;  2L92 A;  2UUC E;  2FGG A;  1XNQ E;  4K0K E;  2EZ6 A;  4BMJ A;  4BBY A;  4DR5 E;  4B3M E;  2B7T A;  4WYQ B;  1N36 E;  4DV5 E;  2LRS A;  2UXB E;  1HNZ E;  2RS7 A;  3ADI A;  2NUE A;  5CFF E;  2JY9 A;  4X64 E;  2DSY A;  5T6J A;  3FIG A;  1N32 E;  3OTO E;  3HPS A;  3JU0 A;  4X62 E;  2JOX A;  1RQ0 A;  2G7H A;  3IWB A;  4BS9 A;  4TUI A;  2JVA A;  4BC9 A;  1YYO A;  2E1M A;  1DI2 A;  4TUG A;  4KZS A;  2M1S A;  1FKA E;  3K6Q A;  1YZ9 A;  1HNX E;  2KOU A;  2L6M A;  4DUY E;  4DV6 E;  1T4N A;  2LUQ A;  2E5L E;  4P78 A;  4R8O A;  3HXL A;  4JI7 E;  5LMU E;  1X48 A;  4L5N C;  1T4L B;  4DMI A;  3ADJ A;  3P1X A;  2NUG A;  2V86 A;  5LMN E;  2CPN A;  2M4I A;  2F8B A;  1J5E E;  4X8W A;  4LFC E;  2LTR A;  2N3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...