1T4OA

Crystal structure of rnt1p dsrbd
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribonuclease III
publication title A new alpha-helical extension promotes RNA binding by the dsRBD of Rnt1p RNAse III
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 21
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1t4oA00
4KHPE 2JY9A 2DIXA 5LMUE 4DV4E 1PKPA 1HNZE 4AQYE 1WHQA 2L3CA 2N3GA 4X8WA 4OX9E 1FKAE 4K0KE 2LTRA 2LUQA 4JI1E 4JI2E 2RSMA 1HNWE 2CPNA 4JI8E 2NUEA 4LFBE 3C4BA 3LLHA 1EKZA 2L2KB 2UUBE 4DV3E 1UHZA 2NUFA 4LFCE 1YYWA 1DI2A 2UU9E 2EZ6A 3C4TA 2ZM6E 4YY3E 1ZBTA 1QU6A 4LF5E 1YYOA 2LBSB 4JI4E 2RTXA 3OTOE 4DV6E 2NA2A 4JI5E 4GKKE 2YT4A 1RQ0A 4WFTA 3VYYA 4DR7E 4DR6E 4JI7E 3J7Yp 4GKJE 2UXDE 4DKKA 4JYAE 4JI0E 3ADGA 2HHHE 1T4NA 1X48A 1J26A 5IWAE 1T4LB 4NXME 4LF7E 4X66E 1XMQE 1RC7A 4DV2E 5CFFE 1FJGE 4X64E 3T1HE 4DV7E 1N33E 3ADIA 4JV5E 2DB2A 1STUA 1N32E 4DR1E 4DR2E 2NUGA 2UXBE 4OOGC 2L2MA 1N36E 4DV5E 4DR5E 1YYKA 4X65E 4B3TE 4DR3E 4LF4E 1T4OA 1XMOE 3VYXA 4LF9E 2JVAA 1I94E 1GQEA 2RS7A 2DMYA 5BR8E 2L2NA 1X47A 4X62E 4LF6E 4M30A 1HNXE 3P1XA 4LF8E 2LUPB 2UUAE 4B3SE 4DR4E 2N3HA 1IBME 3ADJA 2LJHA 2RS6A 5LMNE 1N34E 1IBLE 4WYQB 2LRSA 2B3TB 2UXCE 4B3ME 2IHR1 2UUCE 1IBKE 4DV1E 4YHHE 1X49A 1XNQE 2KHXA 4JI3E 2L3JA 2VQEE 2MDRA 1UILA 4DV0E 4NXNE 2E5LE 3T1YE 1HR0E 2F4VE 1O0WA 4DUYE 1YZ9A 1WHNA 4JI6E 2B7TA 4M2ZA 1XNRE 2LTSA 3ADLA 4B3RE 1J5EE 2VQFE 2B7VA 4DUZE 4LFAE 3HTXA 2L33A
chains in the Genus database with same CATH superfamily
4KHPE 2B9DA 2DIXA 2JR1A 1EH7A 2LMZA 1WHQA 2L3CA 2K4VA 4P78A 4JI1E 4IS1C 2YTIA 4F9CB 2RSMA 2JPAA 1HNWE 2CPNA 4JI8E 1PJTA 1QNTA 3C4BA 3KZZA 4IJDA 1EKZA 4Q28A 1RMDA 2MDGA 2NUFA 1A1HA 1WRJA 2EN1A 2EWLA 2EZ6A 2E72A 2CTDA 5A6JA 2LVHA 2ZM6E 2L6MA 5ADZA 1LLMC 2NABA 2EOSA 2LBSB 4MLVA 2V89A 2RTXA 2ENAA 2YPNA 2I9IA 5AC5A 1SFEA 3QG5C 2NA2A 3ECRA 4JI5E 2EPRA 2YT4A 1WJPA 4DR7E 1BBOA 4J8ZA 3IWBA 4JI7E 5A6BA 2EM2A 2EM9A 2HHHE 1J26A 2EPAA 4GEQB 1P47A 4NXME 2EM7A 4DV2E 4X64E 4DV7E 4JV5E 3KWRA 2LT7A 4DR2E 2VRDA 1T39A 4F9BB 2L2MA 1N36E 2EPCA 5KL2A 2EM6A 4DR5E 1F2IG 4X65E 1A1LA 5KL3A 2YTEA 2EOXA 4BHBA 2JVAA 1GQEA 4FK5C 5BR8E 2CSHA 2H36X 2HC5A 1ZAAC 1X47A 4R2PA 3AV0A 2GHFA 4M30A 4DMIA 5A2QC 1L4SA 4LF8E 2JP9A 4WSPA 2MKNA 4B3SE 1UBDC 1AH5A 4BCAA 2LJHA 3MHSC 4O4KA 3TQMA 2EN6A 3JU0A 4X9JA 1YUJA 4BHCA 2KHXA 2YWQA 4R2EA 2L3JA 2RQLA 5A6AA 1A1IA 2N8XA 2V83A 4R2QA 1HR0E 3BIDA 1WHNA 1N3GA 1ZR9A 5T6JA 1X6EA 4M2ZA 1X6FA 2EM8A 2LTSA 1XNRE 2EMGA 1J5EE 2LO3A 5AE2A 3HQ1A 3JAMC 2EPZA 4DUZE 2L33A 1XMOE 2JY9A 3HPSA 2EPLX 2WCC3 5LMUE 4WPYA 1A1KA 2JWOA 3K6QA 2L92A 4P7DA 4X8WA 4OX9E 1A1JA 1IQOA 1FKAE 2LUQA 1IQSA 2ELZA 2CT1A 3MHHC 4LFBE 4Q35B 2EPPA 2UUBE 4DV3E 1YFHA 2EMCA 4O5GA 3THNA 1YYWA 2UU9E 2RPCA 4ZYHA 4LF5E 1MGTA 1YYOA 2EOJA 1X5WA 4KZSA 2EMKA 2R1FA 2ENCA 2EOZA 4WSGA 1RQ0A 1KYQA 2M9AA 2YRMA 1DQ3A 1NCSA 1ZU1A 2UXDE 3J7AG 4BBYA 4DKKA 1TF6A 1YUIA 1TN9A 2ODRD 3T1HE 3ADIA 1STUA 4F9AB 1G2DC 2DRPA 2ODRC 5A6KA 1GTKA 1T38A 2WBTA 4DR3E 2EL4A 2R76A 2DGCA 4LF4E 3THOB 2RS7A 4LF6E 4I8OA 3OMLA 1A1FA 4WXDA 4WXCA 5LMNE 1IBLE 1X6HA 2EPXA 2EM4A 3F6HA 2JOXA 4NHRA 2UUCE 4DV1E 4BS9A 1X49A 1XNQE 5KL5A 5DNYA 1UILA 5KL6A 4DV0E 4NXNE 2E5LE 1EH8A 5IXMB 2F4VE 4DUYE 1YZ9A 2JYAA 2VE7C 3FIGA 2VQFE 2B7VA 4LFAE 3HTXA 4DV4E 2KOUA 2LV2A 2A25A 1PKPA 1B69A 1HNZE 4AQYE 2JOBA 2EPKX 4K0KE 2DLKA 3C6KA 3IWDA 2YTPA 3VK6A 2DMIA 2YRHA 2I13A 2EL6A 3DJWA 4R2DA 4R2RA 1DI2A 3C4TA 4YY3E 2MC5A 4L5NC 1ZBTA 4RHBB 1QU6A 2WBUA 2DLQA 4NZVA 2YTOA 3OTOE 4DV6E 2EOOA 4R2CA 3EPHA 2EORA 2ADRA 2EMBA 2Q8UA 5AE3A 3VYYA 3UK3C 2K7IA 4R8OA 5AC4A 4F6NA 3J7Yp 4GKJE 1YPNA 1SR9A 2LE2A 4JI0E 2EPNA 1PJQA 3ADGA 3JTZA 2EMAA 1X48A 2YTNA 5IWAE 2EQ3A 4X66E 3AUZA 1BB8A 1FJGE 2DB2A 1G2FC 4DR1E 2HGHA 2YTQA 3H09A 4DV5E 3MSWA 2VF1A 2EOEA 4B3TE 4GZNC 2GPIA 2FTXB 3M99B 1WXRA 1T4OA 2EM3A 2HJJA 5KL4A 4ZYDA 2EOMA 3VYXA 2EE8A 1I94E 2DMYA 2EN8A 2L2NA 3J81C 2GLIA 1ZBQA 2EQ0A 2MC6A 2UUAE 2N3HA 2EQ1A 3ADJA 3BBGA 1N34E 1TF3A 2F8BA 2RSIA 2M7QA 4B3ME 1IBKE 4LTYA 2V87A 2JXPA 2VQEE 2MDRA 5LL6R 4TUGA 3F6GA 5F3WA 3T1YE 1EH6A 2E1MA 2LCEA 4M9VC 2YZTA 3BF2A 3ADLA 2EJ4A 4B3RE 4O43A 2EOYA 1JK2A 4BC9A 5A6BD 5IT9C 4ZYEA 1DGCA 2N3GA 1BBGA 2LTRA 1GZ6A 4JI2E 2V86A 4F2JC 1MEYC 2NUEA 3LLHA 3EQ1A 4HTGA 2YTFA 4KWYA 4R2SA 4L8NA 5FLXC 2L2KB 2FV4B 1UHZA 2EMWA 3ZOQB 4LFCE 2ENHA 2BB8A 2EMIA 2D9HA 2V8QB 2EMHA 2EM0A 5TSEA 3RMPA 2KONA 2EMLA 2YTDA 4JI4E 2G7HA 2EN2A 4MLQA 3EPLA 5IV8B 3J80C 4GKKE 2EOFA 2EOHA 1A1GA 4N4RB 2EMZA 4WFTA 4DR6E 3HXLA 2YTGA 2YSPA 3C6MA 1Z1BA 2MKDA 4JYAE 2L8TA 2V85A 4R2AA 2EL5A 2FGGA 3IWCA 1T4NA 4WX9A 1PDAA 2DSYA 2EN3A 2PRTA 1T4LB 4LF7E 2YU8A 1XMQE 2YSOA 1RC7A 5CFFE 3DF6A 2EMXA 5KL7A 1N32E 3HPZA 2NUGA 2UXBE 4OOGC 2BBGA 4BC7A 2EN4A 2EMFA 2EOIA 3EPKA 1YYKA 1AAYA 5AE1A 4ZYGA 4HEIA 1JK1A 2YU5A 1NEIA 2J7JA 4LF9E 3VHTB 2EPOA 2EPUA 2WBSA 2YRKA 4X62E 3EPJA 3KZYA 1HNXE 3P1XA 2LUPB 4DR4E 4O24A 2M4IA 2V88A 1IBME 2EPMX 1IMUA 2RS6A 4M0VA 4WYQB 2LRSA 2B3TB 2EP3A 4TUIA 2UXCE 2IHR1 4YHHE 2M1SA 4RH8A 5LLQA 4JI3E 1KJKA 1UN6B 1PJSA 1X3CA 2EM5A 2EN7A 4R03A 1O0WA 4F6MA 1YSAC 3LMLA 2WZOA 2EOQA 4JI6E 2B7TA 2LJUA 2ELYA 2EMYA 5AASA 3L00A 4LU9A 3BGHA 2YTJA 4F54A 1N33E 5A69A 4BMJA
chains in the Genus database with same CATH topology
4KHPE 2JY9A 3HPSA 2B9DA 2DIXA 5LMUE 4DV4E 2KOUA 4WPYA 1PKPA 2JR1A 2JWOA 1HNZE 2LMZA 4AQYE 3K6QA 1WHQA 2L92A 2K4VA 2N3GA 2JOBA 4P7DA 4X8WA 2L3CA 4NXME 4OX9E 3JAMC 4DUZE 4P78A 1FKAE 4K0KE 2LTRA 2LUQA 4JI1E 1GZ6A 4JI2E 2V86A 2RSMA 4F9CB 1HNWE 3IWDA 2CPNA 4JI8E 2NUEA 4LFBE 3VK6A 3C4BA 3LLHA 1EKZA 4Q28A 4L8NA 5FLXC 2L2KB 2FV4B 2UUBE 4DV3E 1UHZA 3ZOQB 2NUFA 4LFCE 3DJWA 1YYWA 1DI2A 2UU9E 2EWLA 2EZ6A 3C4TA 2ZM6E 2V8QB 2L6MA 5ADZA 4YY3E 2MC5A 4L5NC 1ZBTA 1QU6A 3RMPA 4LF5E 2KONA 1YYOA 2LBSB 2G7HA 2V89A 4JI4E 2RTXA 4KZSA 3OTOE 4DV6E 3J80C 2NA2A 4JI5E 4GKKE 2YT4A 1RQ0A 5AE3A 4WFTA 3VYYA 4DR7E 4DR6E 4R8OA 3HXLA 4J8ZA 3IWBA 1DQ3A 4JI7E 3J7Yp 4GKJE 2UXDE 1SR9A 2LE2A 4BBYA 4DKKA 3J7AG 2L8TA 2V85A 4JI0E 4JYAE 3ADGA 2FGGA 3IWCA 3JTZA 2HHHE 1T4NA 1X48A 1J26A 2DSYA 4GEQB 5IWAE 1T4LB 4LF7E 4X66E 2ODRD 3AUZA 1XMQE 1RC7A 4DV2E 5CFFE 1FJGE 4X64E 3DF6A 3T1HE 4DV7E 1N33E 3ADIA 4JV5E 2DB2A 1STUA 4F9AB 3KWRA 1N32E 4DR1E 3HPZA 3H09A 4DR2E 2NUGA 2ODRC 4OOGC 4BC7A 4F9BB 2UXBE 2L2MA 1N36E 4DV5E 3MSWA 4DR5E 2VF1A 1YYKA 4X65E 4B3TE 5AE1A 4DR3E 2FTXB 4LF4E 1WXRA 1T4OA 1XMOE 3VYXA 4LF9E 2JVAA 1I94E 1GQEA 2RS7A 2DMYA 5BR8E 2H36X 2L2NA 3J81C 1X47A 4X62E 4LF6E 1ZBQA 3AV0A 4M30A 4DMIA 5A2QC 1HNXE 3P1XA 4I8OA 3OMLA 4LF8E 2MC6A 2LUPB 4WSPA 2UUAE 4B3SE 4DR4E 2V88A 2M4IA 2N3HA 1IBME 4BCAA 3ADJA 2LJHA 2RS6A 4M0VA 5LMNE 1N34E 1IBLE 2F8BA 4WYQB 2LRSA 2B3TB 4TUIA 2UXCE 3F6HA 2JOXA 2M7QA 2IHR1 3JU0A 2UUCE 1IBKE 4LTYA 2V87A 2M1SA 4BS9A 1X49A 4YHHE 2KHXA 4DV1E 4JI3E 1XNQE 4B3ME 2L3JA 5DNYA 2VQEE 2MDRA 1UILA 5LL6R 4DV0E 4TUGA 2E5LE 4NXNE 2V83A 3F6GA 5F3WA 3T1YE 1HR0E 2E1MA 2F4VE 4R03A 1O0WA 4DUYE 1YZ9A 3LMLA 2WZOA 2YZTA 1WHNA 4JI6E 5T6JA 2B7TA 2VE7C 4M2ZA 1XNRE 2LTSA 3ADLA 3FIGA 4B3RE 1J5EE 5AASA 5AE2A 4LU9A 2VQFE 4F54A 2B7VA 3HQ1A 4BC9A 4LFAE 4BMJA 5IT9C 3HTXA 2L33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP E;  2JY9 A;  2DIX A;  5LMU E;  4DV4 E;  1PKP A;  1HNZ E;  4AQY E;  1WHQ A;  2L3C A;  2N3G A;  4X8W A;  4OX9 E;  1FKA E;  4K0K E;  2LTR A;  2LUQ A;  4JI1 E;  4JI2 E;  2RSM A;  1HNW E;  2CPN A;  4JI8 E;  2NUE A;  4LFB E;  3C4B A;  3LLH A;  1EKZ A;  2L2K B;  2UUB E;  4DV3 E;  1UHZ A;  2NUF A;  4LFC E;  1YYW A;  1DI2 A;  2UU9 E;  2EZ6 A;  3C4T A;  2ZM6 E;  4YY3 E;  1ZBT A;  1QU6 A;  4LF5 E;  1YYO A;  2LBS B;  4JI4 E;  2RTX A;  3OTO E;  4DV6 E;  2NA2 A;  4JI5 E;  4GKK E;  2YT4 A;  1RQ0 A;  4WFT A;  3VYY A;  4DR7 E;  4DR6 E;  4JI7 E;  3J7Y p;  4GKJ E;  2UXD E;  4DKK A;  4JYA E;  4JI0 E;  3ADG A;  2HHH E;  1T4N A;  1X48 A;  1J26 A;  5IWA E;  1T4L B;  4NXM E;  4LF7 E;  4X66 E;  1XMQ E;  1RC7 A;  4DV2 E;  5CFF E;  1FJG E;  4X64 E;  3T1H E;  4DV7 E;  1N33 E;  3ADI A;  4JV5 E;  2DB2 A;  1STU A;  1N32 E;  4DR1 E;  4DR2 E;  2NUG A;  2UXB E;  4OOG C;  2L2M A;  1N36 E;  4DV5 E;  4DR5 E;  1YYK A;  4X65 E;  4B3T E;  4DR3 E;  4LF4 E;  1T4O A;  1XMO E;  3VYX A;  4LF9 E;  2JVA A;  1I94 E;  1GQE A;  2RS7 A;  2DMY A;  5BR8 E;  2L2N A;  1X47 A;  4X62 E;  4LF6 E;  4M30 A;  1HNX E;  3P1X A;  4LF8 E;  2LUP B;  2UUA E;  4B3S E;  4DR4 E;  2N3H A;  1IBM E;  3ADJ A;  2LJH A;  2RS6 A;  5LMN E;  1N34 E;  1IBL E;  4WYQ B;  2LRS A;  2B3T B;  2UXC E;  4B3M E;  2IHR 1;  2UUC E;  1IBK E;  4DV1 E;  4YHH E;  1X49 A;  1XNQ E;  2KHX A;  4JI3 E;  2L3J A;  2VQE E;  2MDR A;  1UIL A;  4DV0 E;  4NXN E;  2E5L E;  3T1Y E;  1HR0 E;  2F4V E;  1O0W A;  4DUY E;  1YZ9 A;  1WHN A;  4JI6 E;  2B7T A;  4M2Z A;  1XNR E;  2LTS A;  3ADL A;  4B3R E;  1J5E E;  2VQF E;  2B7V A;  4DUZ E;  4LFA E;  3HTX A;  2L33 A; 
#chains in the Genus database with same CATH topology
 4KHP E;  2B9D A;  2DIX A;  2JR1 A;  1EH7 A;  2LMZ A;  1WHQ A;  2L3C A;  2K4V A;  4P78 A;  4JI1 E;  4IS1 C;  2YTI A;  4F9C B;  2RSM A;  2JPA A;  1HNW E;  2CPN A;  4JI8 E;  1PJT A;  1QNT A;  3C4B A;  3KZZ A;  4IJD A;  1EKZ A;  4Q28 A;  1RMD A;  2MDG A;  2NUF A;  1A1H A;  1WRJ A;  2EN1 A;  2EWL A;  2EZ6 A;  2E72 A;  2CTD A;  5A6J A;  2LVH A;  2ZM6 E;  2L6M A;  5ADZ A;  1LLM C;  2NAB A;  2EOS A;  2LBS B;  4MLV A;  2V89 A;  2RTX A;  2ENA A;  2YPN A;  2I9I A;  5AC5 A;  1SFE A;  3QG5 C;  2NA2 A;  3ECR A;  4JI5 E;  2EPR A;  2YT4 A;  1WJP A;  4DR7 E;  1BBO A;  4J8Z A;  3IWB A;  4JI7 E;  5A6B A;  2EM2 A;  2EM9 A;  2HHH E;  1J26 A;  2EPA A;  4GEQ B;  1P47 A;  4NXM E;  2EM7 A;  4DV2 E;  4X64 E;  4DV7 E;  4JV5 E;  3KWR A;  2LT7 A;  4DR2 E;  2VRD A;  1T39 A;  4F9B B;  2L2M A;  1N36 E;  2EPC A;  5KL2 A;  2EM6 A;  4DR5 E;  1F2I G;  4X65 E;  1A1L A;  5KL3 A;  2YTE A;  2EOX A;  4BHB A;  2JVA A;  1GQE A;  4FK5 C;  5BR8 E;  2CSH A;  2H36 X;  2HC5 A;  1ZAA C;  1X47 A;  4R2P A;  3AV0 A;  2GHF A;  4M30 A;  4DMI A;  5A2Q C;  1L4S A;  4LF8 E;  2JP9 A;  4WSP A;  2MKN A;  4B3S E;  1UBD C;  1AH5 A;  4BCA A;  2LJH A;  3MHS C;  4O4K A;  3TQM A;  2EN6 A;  3JU0 A;  4X9J A;  1YUJ A;  4BHC A;  2KHX A;  2YWQ A;  4R2E A;  2L3J A;  2RQL A;  5A6A A;  1A1I A;  2N8X A;  2V83 A;  4R2Q A;  1HR0 E;  3BID A;  1WHN A;  1N3G A;  1ZR9 A;  5T6J A;  1X6E A;  4M2Z A;  1X6F A;  2EM8 A;  2LTS A;  1XNR E;  2EMG A;  1J5E E;  2LO3 A;  5AE2 A;  3HQ1 A;  3JAM C;  2EPZ A;  4DUZ E;  2L33 A;  1XMO E;  2JY9 A;  3HPS A;  2EPL X;  2WCC 3;  5LMU E;  4WPY A;  1A1K A;  2JWO A;  3K6Q A;  2L92 A;  4P7D A;  4X8W A;  4OX9 E;  1A1J A;  1IQO A;  1FKA E;  2LUQ A;  1IQS A;  2ELZ A;  2CT1 A;  3MHH C;  4LFB E;  4Q35 B;  2EPP A;  2UUB E;  4DV3 E;  1YFH A;  2EMC A;  4O5G A;  3THN A;  1YYW A;  2UU9 E;  2RPC A;  4ZYH A;  4LF5 E;  1MGT A;  1YYO A;  2EOJ A;  1X5W A;  4KZS A;  2EMK A;  2R1F A;  2ENC A;  2EOZ A;  4WSG A;  1RQ0 A;  1KYQ A;  2M9A A;  2YRM A;  1DQ3 A;  1NCS A;  1ZU1 A;  2UXD E;  3J7A G;  4BBY A;  4DKK A;  1TF6 A;  1YUI A;  1TN9 A;  2ODR D;  3T1H E;  3ADI A;  1STU A;  4F9A B;  1G2D C;  2DRP A;  2ODR C;  5A6K A;  1GTK A;  1T38 A;  2WBT A;  4DR3 E;  2EL4 A;  2R76 A;  2DGC A;  4LF4 E;  3THO B;  2RS7 A;  4LF6 E;  4I8O A;  3OML A;  1A1F A;  4WXD A;  4WXC A;  5LMN E;  1IBL E;  1X6H A;  2EPX A;  2EM4 A;  3F6H A;  2JOX A;  4NHR A;  2UUC E;  4DV1 E;  4BS9 A;  1X49 A;  1XNQ E;  5KL5 A;  5DNY A;  1UIL A;  5KL6 A;  4DV0 E;  4NXN E;  2E5L E;  1EH8 A;  5IXM B;  2F4V E;  4DUY E;  1YZ9 A;  2JYA A;  2VE7 C;  3FIG A;  2VQF E;  2B7V A;  4LFA E;  3HTX A;  4DV4 E;  2KOU A;  2LV2 A;  2A25 A;  1PKP A;  1B69 A;  1HNZ E;  4AQY E;  2JOB A;  2EPK X;  4K0K E;  2DLK A;  3C6K A;  3IWD A;  2YTP A;  3VK6 A;  2DMI A;  2YRH A;  2I13 A;  2EL6 A;  3DJW A;  4R2D A;  4R2R A;  1DI2 A;  3C4T A;  4YY3 E;  2MC5 A;  4L5N C;  1ZBT A;  4RHB B;  1QU6 A;  2WBU A;  2DLQ A;  4NZV A;  2YTO A;  3OTO E;  4DV6 E;  2EOO A;  4R2C A;  3EPH A;  2EOR A;  2ADR A;  2EMB A;  2Q8U A;  5AE3 A;  3VYY A;  3UK3 C;  2K7I A;  4R8O A;  5AC4 A;  4F6N A;  3J7Y p;  4GKJ E;  1YPN A;  1SR9 A;  2LE2 A;  4JI0 E;  2EPN A;  1PJQ A;  3ADG A;  3JTZ A;  2EMA A;  1X48 A;  2YTN A;  5IWA E;  2EQ3 A;  4X66 E;  3AUZ A;  1BB8 A;  1FJG E;  2DB2 A;  1G2F C;  4DR1 E;  2HGH A;  2YTQ A;  3H09 A;  4DV5 E;  3MSW A;  2VF1 A;  2EOE A;  4B3T E;  4GZN C;  2GPI A;  2FTX B;  3M99 B;  1WXR A;  1T4O A;  2EM3 A;  2HJJ A;  5KL4 A;  4ZYD A;  2EOM A;  3VYX A;  2EE8 A;  1I94 E;  2DMY A;  2EN8 A;  2L2N A;  3J81 C;  2GLI A;  1ZBQ A;  2EQ0 A;  2MC6 A;  2UUA E;  2N3H A;  2EQ1 A;  3ADJ A;  3BBG A;  1N34 E;  1TF3 A;  2F8B A;  2RSI A;  2M7Q A;  4B3M E;  1IBK E;  4LTY A;  2V87 A;  2JXP A;  2VQE E;  2MDR A;  5LL6 R;  4TUG A;  3F6G A;  5F3W A;  3T1Y E;  1EH6 A;  2E1M A;  2LCE A;  4M9V C;  2YZT A;  3BF2 A;  3ADL A;  2EJ4 A;  4B3R E;  4O43 A;  2EOY A;  1JK2 A;  4BC9 A;  5A6B D;  5IT9 C;  4ZYE A;  1DGC A;  2N3G A;  1BBG A;  2LTR A;  1GZ6 A;  4JI2 E;  2V86 A;  4F2J C;  1MEY C;  2NUE A;  3LLH A;  3EQ1 A;  4HTG A;  2YTF A;  4KWY A;  4R2S A;  4L8N A;  5FLX C;  2L2K B;  2FV4 B;  1UHZ A;  2EMW A;  3ZOQ B;  4LFC E;  2ENH A;  2BB8 A;  2EMI A;  2D9H A;  2V8Q B;  2EMH A;  2EM0 A;  5TSE A;  3RMP A;  2KON A;  2EML A;  2YTD A;  4JI4 E;  2G7H A;  2EN2 A;  4MLQ A;  3EPL A;  5IV8 B;  3J80 C;  4GKK E;  2EOF A;  2EOH A;  1A1G A;  4N4R B;  2EMZ A;  4WFT A;  4DR6 E;  3HXL A;  2YTG A;  2YSP A;  3C6M A;  1Z1B A;  2MKD A;  4JYA E;  2L8T A;  2V85 A;  4R2A A;  2EL5 A;  2FGG A;  3IWC A;  1T4N A;  4WX9 A;  1PDA A;  2DSY A;  2EN3 A;  2PRT A;  1T4L B;  4LF7 E;  2YU8 A;  1XMQ E;  2YSO A;  1RC7 A;  5CFF E;  3DF6 A;  2EMX A;  5KL7 A;  1N32 E;  3HPZ A;  2NUG A;  2UXB E;  4OOG C;  2BBG A;  4BC7 A;  2EN4 A;  2EMF A;  2EOI A;  3EPK A;  1YYK A;  1AAY A;  5AE1 A;  4ZYG A;  4HEI A;  1JK1 A;  2YU5 A;  1NEI A;  2J7J A;  4LF9 E;  3VHT B;  2EPO A;  2EPU A;  2WBS A;  2YRK A;  4X62 E;  3EPJ A;  3KZY A;  1HNX E;  3P1X A;  2LUP B;  4DR4 E;  4O24 A;  2M4I A;  2V88 A;  1IBM E;  2EPM X;  1IMU A;  2RS6 A;  4M0V A;  4WYQ B;  2LRS A;  2B3T B;  2EP3 A;  4TUI A;  2UXC E;  2IHR 1;  4YHH E;  2M1S A;  4RH8 A;  5LLQ A;  4JI3 E;  1KJK A;  1UN6 B;  1PJS A;  1X3C A;  2EM5 A;  2EN7 A;  4R03 A;  1O0W A;  4F6M A;  1YSA C;  3LML A;  2WZO A;  2EOQ A;  4JI6 E;  2B7T A;  2LJU A;  2ELY A;  2EMY A;  5AAS A;  3L00 A;  4LU9 A;  3BGH A;  2YTJ A;  4F54 A;  1N33 E;  5A69 A;  4BMJ A; 
#chains in the Genus database with same CATH homology
 4KHP E;  2JY9 A;  3HPS A;  2B9D A;  2DIX A;  5LMU E;  4DV4 E;  2KOU A;  4WPY A;  1PKP A;  2JR1 A;  2JWO A;  1HNZ E;  2LMZ A;  4AQY E;  3K6Q A;  1WHQ A;  2L92 A;  2K4V A;  2N3G A;  2JOB A;  4P7D A;  4X8W A;  2L3C A;  4NXM E;  4OX9 E;  3JAM C;  4DUZ E;  4P78 A;  1FKA E;  4K0K E;  2LTR A;  2LUQ A;  4JI1 E;  1GZ6 A;  4JI2 E;  2V86 A;  2RSM A;  4F9C B;  1HNW E;  3IWD A;  2CPN A;  4JI8 E;  2NUE A;  4LFB E;  3VK6 A;  3C4B A;  3LLH A;  1EKZ A;  4Q28 A;  4L8N A;  5FLX C;  2L2K B;  2FV4 B;  2UUB E;  4DV3 E;  1UHZ A;  3ZOQ B;  2NUF A;  4LFC E;  3DJW A;  1YYW A;  1DI2 A;  2UU9 E;  2EWL A;  2EZ6 A;  3C4T A;  2ZM6 E;  2V8Q B;  2L6M A;  5ADZ A;  4YY3 E;  2MC5 A;  4L5N C;  1ZBT A;  1QU6 A;  3RMP A;  4LF5 E;  2KON A;  1YYO A;  2LBS B;  2G7H A;  2V89 A;  4JI4 E;  2RTX A;  4KZS A;  3OTO E;  4DV6 E;  3J80 C;  2NA2 A;  4JI5 E;  4GKK E;  2YT4 A;  1RQ0 A;  5AE3 A;  4WFT A;  3VYY A;  4DR7 E;  4DR6 E;  4R8O A;  3HXL A;  4J8Z A;  3IWB A;  1DQ3 A;  4JI7 E;  3J7Y p;  4GKJ E;  2UXD E;  1SR9 A;  2LE2 A;  4BBY A;  4DKK A;  3J7A G;  2L8T A;  2V85 A;  4JI0 E;  4JYA E;  3ADG A;  2FGG A;  3IWC A;  3JTZ A;  2HHH E;  1T4N A;  1X48 A;  1J26 A;  2DSY A;  4GEQ B;  5IWA E;  1T4L B;  4LF7 E;  4X66 E;  2ODR D;  3AUZ A;  1XMQ E;  1RC7 A;  4DV2 E;  5CFF E;  1FJG E;  4X64 E;  3DF6 A;  3T1H E;  4DV7 E;  1N33 E;  3ADI A;  4JV5 E;  2DB2 A;  1STU A;  4F9A B;  3KWR A;  1N32 E;  4DR1 E;  3HPZ A;  3H09 A;  4DR2 E;  2NUG A;  2ODR C;  4OOG C;  4BC7 A;  4F9B B;  2UXB E;  2L2M A;  1N36 E;  4DV5 E;  3MSW A;  4DR5 E;  2VF1 A;  1YYK A;  4X65 E;  4B3T E;  5AE1 A;  4DR3 E;  2FTX B;  4LF4 E;  1WXR A;  1T4O A;  1XMO E;  3VYX A;  4LF9 E;  2JVA A;  1I94 E;  1GQE A;  2RS7 A;  2DMY A;  5BR8 E;  2H36 X;  2L2N A;  3J81 C;  1X47 A;  4X62 E;  4LF6 E;  1ZBQ A;  3AV0 A;  4M30 A;  4DMI A;  5A2Q C;  1HNX E;  3P1X A;  4I8O A;  3OML A;  4LF8 E;  2MC6 A;  2LUP B;  4WSP A;  2UUA E;  4B3S E;  4DR4 E;  2V88 A;  2M4I A;  2N3H A;  1IBM E;  4BCA A;  3ADJ A;  2LJH A;  2RS6 A;  4M0V A;  5LMN E;  1N34 E;  1IBL E;  2F8B A;  4WYQ B;  2LRS A;  2B3T B;  4TUI A;  2UXC E;  3F6H A;  2JOX A;  2M7Q A;  2IHR 1;  3JU0 A;  2UUC E;  1IBK E;  4LTY A;  2V87 A;  2M1S A;  4BS9 A;  1X49 A;  4YHH E;  2KHX A;  4DV1 E;  4JI3 E;  1XNQ E;  4B3M E;  2L3J A;  5DNY A;  2VQE E;  2MDR A;  1UIL A;  5LL6 R;  4DV0 E;  4TUG A;  2E5L E;  4NXN E;  2V83 A;  3F6G A;  5F3W A;  3T1Y E;  1HR0 E;  2E1M A;  2F4V E;  4R03 A;  1O0W A;  4DUY E;  1YZ9 A;  3LML A;  2WZO A;  2YZT A;  1WHN A;  4JI6 E;  5T6J A;  2B7T A;  2VE7 C;  4M2Z A;  1XNR E;  2LTS A;  3ADL A;  3FIG A;  4B3R E;  1J5E E;  5AAS A;  5AE2 A;  4LU9 A;  2VQF E;  4F54 A;  2B7V A;  3HQ1 A;  4BC9 A;  4LFA E;  4BMJ A;  5IT9 C;  3HTX A;  2L33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...