5KL6A

Wilms tumor protein (wt1) q369r znf2-4 in complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
KPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl6A00
2EOFA 2YTJA 5KL4A 2EMGA 2YSPA 2EQ3A 2EMBA 2EM5A 1A1GA 2EJ4A 2EPPA 5KL3A 2GLIA 2MDGA 2EL6A 1YUIA 4R2DA 3EPHA 2WBUA 1NCSA 2NABA 4IS1C 2DLKA 2LV2A 2DGCA 2DRPA 2EL4A 3M99B 2RPCA 1JK1A 3EPJA 1YSAC 1ZU1A 2ELZA 5KL6A 2WBTA 2CSHA 2EN2A 2CTDA 2EMLA 1RMDA 1WJPA 4R2PA 4R2QA 1B69A 1A1FA 4R2SA 1X6HA 4WSGA 2YTPA 2ENCA 4R2RA 1X6FA 2DLQA 2YTIA 1A1IA 2EMWA 2EM7A 4R2EA 1UBDC 2EPUA 2DMIA 2EOZA 2EQ0A 2LT7A 2BB8A 1A1HA 2EOEA 2EM3A 2YTQA 2WBSA 2YRMA 1JK2A 4F2JC 2I13A 2EMKA 3MHHC 2EL5A 4FK5C 5KL2A 2YTDA 2YU8A 2EN6A 2M9AA 1A1JA 1BBOA 2D9HA 2EOJA 2LCEA 1ZAAC 2EMCA 2EMZA 2EOOA 2YRHA 2EMAA 2ENHA 2EOSA 1A1LA 2EOXA 2EM2A 3MHSC 1UN6B 2EMYA 1X3CA 4GZNC 2EQ1A 2JPAA 2EOYA 2JP9A 2EMHA 2EM0A 2ELYA 2YTEA 1AAYA 2EN4A 1DGCA 2EP3A 2EMFA 2YRKA 1BB8A 1LLMC 1X5WA 2EOMA 4F6MA 2ENAA 2EPCA 2MKDA 1ZR9A 2EN7A 2WCC3 1KJKA 2EN3A 2YTGA 2EPXA 1TN9A 2YTFA 1Z1BA 5KL7A 2YU5A 2EPAA 1MEYC 2LVHA 2HGHA 1P47A 2EE8A 2EM8A 2LO3A 3VHTB 2EPRA 4X9JA 3UK3C 2YTNA 2ADRA 2GHFA 2EOHA 2YSOA 2PRTA 4F6NA 2E72A 1YUJA 2J7JA 4IJDA 3EPKA 1A1KA 2YTOA 4R2CA 2EN8A 2EMXA 2A25A 4M9VC 1G2DC 2CT1A 3EPLA 5KL5A 2EOQA 2EORA 2EM4A 1TF6A 2EM9A 2EPZA 2EMIA 2VRDA 2EN1A 2R1FA 1TF3A 2MKNA 4R2AA 2EM6A 1X6EA 1G2FC 2RSIA 2EOIA 1F2IG
chains in the Genus database with same CATH superfamily
2EOFA 2N3HA 2YSPA 2EM5A 1A1GA 2EPPA 4JI2E 5KL3A 2MDGA 3BBGA 1T4NA 1XMOE 4R2DA 4DR6E 2DLKA 2LV2A 2DRPA 4F54A 1PJQA 2HJJA 1ZU1A 2NUGA 5KL6A 2CSHA 2E1MA 3ZOQB 4JI3E 3HXLA 4R2PA 4R8OA 1B69A 3JAMC 2V85A 5F3WA 2LUQA 4WXDA 4O43A 4R2RA 1X6FA 2YTIA 3F6HA 1A1IA 5A6BA 2EM7A 4DUZE 2V87A 2L6MA 5BR8E 2YWQA 3THOB 2LT7A 4M0VA 3T1YE 2BB8A 2LTSA 2VF1A 4DR3E 5IT9C 2YRMA 1JK2A 1X47A 2RSMA 4L5NC 5A6BD 3RMPA 4DR7E 2EN6A 2M9AA 2EMCA 2EMAA 2ENHA 2EOXA 5IWAE 3MHSC 5AC5A 3IWDA 2EMYA 1N3GA 2JP9A 2ELYA 4O5GA 5LLQA 2F4VE 1DGCA 4BMJA 2EP3A 2YRKA 1BB8A 2B7TA 4WFTA 2M4IA 2UXBE 2V8QB 2YU5A 3ADGA 4J8ZA 2HGHA 2LRSA 2EE8A 2LO3A 4NXNE 2EPRA 2JOBA 2ADRA 4O4KA 4DV6E 2PRTA 5A2QC 4M30A 4F6NA 1A1KA 2B3TB 2EPMX 2LMZA 4R2CA 1QNTA 1O0WA 2A25A 2EZ6A 4DR2E 1G2DC 3EPLA 3BIDA 4DMIA 1TF6A 2EM4A 2EM9A 4K0KE 1KYQA 3KZYA 1IBLE 4LF7E 2RS7A 2MC5A 1YPNA 2VE7C 1IBKE 4R2AA 4LFBE 2EM6A 1GQEA 1T4OA 3J81C 2I9IA 2YTJA 2EMBA 2EJ4A 2FTXB 2EL6A 1YUIA 3VYYA 2RS6A 4IS1C 4TUGA 2DGCA 3M99B 1JK1A 1HNXE 1YSAC 1WRJA 1EH6A 2WBTA 4BS9A 1YFHA 2CTDA 2KONA 2EMLA 2F8BA 4MLVA 2JVAA 1IBME 4GEQB 2K4VA 2ENCA 3TQMA 4YHHE 2DLQA 2L33A 1T4LB 4BC9A 2EMWA 4LF4E 3K6QA 5A6JA 4X66E 2VQEE 1X49A 2EPUA 1J5EE 2EOZA 1MGTA 2EOEA 2EM3A 1XNRE 2B9DA 2M1SA 4WSPA 2WBSA 2JWOA 1SR9A 1RC7A 1HNZE 3LMLA 2UXCE 5LMNE 1DQ3A 2I13A 2EMKA 3ECRA 5AASA 2EL5A 4X65E 5KL2A 2YTDA 2YU8A 1A1JA 1BBOA 2D9HA 4NHRA 3DF6A 2CPNA 2EOJA 3J7Yp 1I94E 2UXDE 2EOOA 1GZ6A 1IQSA 3VYXA 1YYWA 2MC6A 2NA2A 2V88A 1AAYA 4JYAE 2ODRD 2E5LE 4AQYE 1XNQE 2ENAA 2HC5A 2EPLX 4L8NA 2MKDA 3BF2A 1TN9A 1MEYC 2LVHA 1HR0E 4B3TE 2EM8A 4ZYHA 4X9JA 4DV5E 2YTNA 2JY9A 2Q8UA 1SFEA 5DNYA 5AE2A 2YSOA 4P78A 1YUJA 2J7JA 4IJDA 4F9BB 4DV4E 1YZ9A 2CT1A 2EORA 2EPOA 2VQFE 2VRDA 2EN1A 3IWCA 2L92A 1N34E 2MKNA 2R76A 4LU9A 4ZYGA 2UUAE 4GKKE 2RSIA 4DV0E 4KWYA 1QU6A 5KL4A 2EQ3A 2GLIA 2B7VA 4JI5E 1HNWE 3KZZA 3HQ1A 2EL4A 2L8TA 3EPJA 4ZYDA 1STUA 2ELZA 1ZBTA 3ADJA 4X8WA 4R2QA 4R2SA 4DV1E 1X6HA 4DKKA 4LF8E 3AV0A 2GPIA 1N32E 2KOUA 3MSWA 3J7AG 4RH8A 2FV4B 4R2EA 5CFFE 2V86A 4P7DA 3BGHA 2K7IA 4JI4E 4OX9E 2EWLA 2LJHA 4R03A 4HTGA 1FKAE 2DIXA 2LBSB 2L2NA 4N4RB 5ADZA 4DV3E 4F2JC 1YYOA 2RTXA 2L2MA 3MHHC 4FK5C 5AE3A 4KZSA 5LMUE 2H36X 2LJUA 2YT4A 2DB2A 2JXPA 2EMZA 4GKJE 5FLXC 2YRHA 5IXMB 1L4SA 1A1LA 2ZM6E 1UN6B 1X3CA 1DI2A 4GZNC 2EOYA 2RQLA 2EM0A 1UHZA 2YTEA 4WXCA 4WX9A 4WPYA 1IMUA 2LUPB 1N33E 1LLMC 4JI6E 1X5WA 2EPCA 4LFCE 1ZR9A 1KJKA 2WCC3 2EN3A 2YTFA 2EPNA 1Z1BA 1PJSA 1P47A 4OOGC 3VHTB 3UK3C 3THNA 1RQ0A 4BBYA 1BBGA 4B3SE 1WXRA 4JI1E 2EOHA 3VK6A 2L2KB 4B3ME 2HHHE 3EPKA 2EMXA 2V89A 4M9VC 2V83A 4B3RE 3HPSA 2G7HA 2JYAA 2EPZA 4F9AB 2EMIA 3LLHA 4YY3E 2JOXA 2DMYA 2R1FA 5AC4A 4F9CB 1G2FC 3L00A 4DR1E 2EOIA 1F2IG 4JI7E 4WYQB 5A6KA 2EMGA 3OMLA 4BHCA 3EPHA 2WBUA 1NCSA 2NABA 4Q28A 3OTOE 1GTKA 2RPCA 4NXME 4DR5E 3QG5C 1AH5A 2EN2A 3AUZA 5A6AA 2N3GA 1RMDA 1WJPA 1A1FA 5IV8B 3ADIA 1EH7A 4DV2E 1XMQE 4WSGA 2WZOA 2YTPA 1PJTA 1EKZA 2YZTA 3JTZA 4JI0E 4RHBB 4DR4E 4MLQA 4DUYE 2L3CA 1T38A 2LE2A 1UBDC 2UUBE 2BBGA 4LF6E 2DMIA 2EQ0A 1UILA 1YYKA 1A1HA 2N8XA 2YTQA 3J80C 3HPZA 1EH8A 4I8OA 3FIGA 2L3JA 4Q35B 4JI8E 4X62E 5T6JA 4JV5E 5LL6R 2JR1A 1X48A 3JU0A 3H09A 2LCEA 1ZAAC 1PKPA 4BCAA 3EQ1A 3HTXA 2EOSA 4DV7E 3ADLA 1ZBQA 2EM2A 3F6GA 4BC7A 3KWRA 2LTRA 2EQ1A 2JPAA 3IWBA 2EMHA 1WHQA 2EN4A 4M2ZA 1IQOA 1PDAA 2DSYA 2EMFA 4KHPE 5TSEA 2EOMA 4F6MA 4NZVA 4HEIA 2FGGA 2EN7A 2YTGA 4ZYEA 2EPXA 2IHR1 2ODRC 2EPAA 2M7QA 5KL7A 3T1HE 2UUCE 4O24A 2NUEA 2KHXA 2NUFA 1NEIA 2GHFA 5A69A 2E72A 2YTOA 2EN8A 5AE1A 2EPKX 2UU9E 4BHBA 3C4TA 1FJGE 4LF5E 5KL5A 2EOQA 1J26A 1WHNA 2MDRA 1T39A 4X64E 3C6KA 4LTYA 2YPNA 3P1XA 4TUIA 1N36E 3C6MA 1TF3A 4LFAE 4LF9E 3DJWA 1X6EA 3C4BA
chains in the Genus database with same CATH topology
2EOFA 2YTJA 5KL4A 2EMGA 2YSPA 2EQ3A 2EMBA 2EM5A 1A1GA 2EJ4A 2EPPA 5KL3A 2GLIA 2MDGA 2EL6A 1YUIA 4R2DA 3EPHA 2WBUA 1NCSA 2NABA 4IS1C 2DLKA 2LV2A 2DGCA 2DRPA 2EL4A 3M99B 2RPCA 1JK1A 3EPJA 1YSAC 1ZU1A 2ELZA 5KL6A 2WBTA 2CSHA 2EN2A 2CTDA 2EMLA 1RMDA 1WJPA 4R2PA 4R2QA 1B69A 1A1FA 4R2SA 1X6HA 4WSGA 2YTPA 2ENCA 4R2RA 1X6FA 2DLQA 2YTIA 1A1IA 2EMWA 2EM7A 4R2EA 1UBDC 2EPUA 2DMIA 2EOZA 2EQ0A 2LT7A 2BB8A 1A1HA 2EOEA 2EM3A 2YTQA 2WBSA 2YRMA 1JK2A 4F2JC 2I13A 2EMKA 3MHHC 2EL5A 4FK5C 5KL2A 2YTDA 2YU8A 2EN6A 2M9AA 1A1JA 1BBOA 2D9HA 2EOJA 2LCEA 1ZAAC 2EMCA 2EMZA 2EOOA 2YRHA 2EMAA 2ENHA 2EOSA 1A1LA 2EOXA 2EM2A 3MHSC 1UN6B 2EMYA 1X3CA 4GZNC 2EQ1A 2JPAA 2EOYA 2JP9A 2EMHA 2EM0A 2ELYA 2YTEA 1AAYA 2EN4A 1DGCA 2EP3A 2EMFA 2YRKA 1BB8A 1LLMC 1X5WA 2EOMA 4F6MA 2ENAA 2EPCA 2MKDA 1ZR9A 2EN7A 2WCC3 1KJKA 2EN3A 2YTGA 2EPXA 1TN9A 2YTFA 1Z1BA 5KL7A 2YU5A 2EPAA 1MEYC 2LVHA 2HGHA 1P47A 2EE8A 2EM8A 2LO3A 3VHTB 2EPRA 4X9JA 3UK3C 2YTNA 2ADRA 2GHFA 2EOHA 2YSOA 2PRTA 4F6NA 2E72A 1YUJA 2J7JA 4IJDA 3EPKA 1A1KA 2YTOA 4R2CA 2EN8A 2EMXA 2A25A 4M9VC 1G2DC 2CT1A 3EPLA 5KL5A 2EOQA 2EORA 2EM4A 1TF6A 2EM9A 2EPZA 2EMIA 2VRDA 2EN1A 2R1FA 1TF3A 2MKNA 4R2AA 2EM6A 1X6EA 1G2FC 2RSIA 2EOIA 1F2IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOF A;  2YTJ A;  5KL4 A;  2EMG A;  2YSP A;  2EQ3 A;  2EMB A;  2EM5 A;  1A1G A;  2EJ4 A;  2EPP A;  5KL3 A;  2GLI A;  2MDG A;  2EL6 A;  1YUI A;  4R2D A;  3EPH A;  2WBU A;  1NCS A;  2NAB A;  4IS1 C;  2DLK A;  2LV2 A;  2DGC A;  2DRP A;  2EL4 A;  3M99 B;  2RPC A;  1JK1 A;  3EPJ A;  1YSA C;  1ZU1 A;  2ELZ A;  5KL6 A;  2WBT A;  2CSH A;  2EN2 A;  2CTD A;  2EML A;  1RMD A;  1WJP A;  4R2P A;  4R2Q A;  1B69 A;  1A1F A;  4R2S A;  1X6H A;  4WSG A;  2YTP A;  2ENC A;  4R2R A;  1X6F A;  2DLQ A;  2YTI A;  1A1I A;  2EMW A;  2EM7 A;  4R2E A;  1UBD C;  2EPU A;  2DMI A;  2EOZ A;  2EQ0 A;  2LT7 A;  2BB8 A;  1A1H A;  2EOE A;  2EM3 A;  2YTQ A;  2WBS A;  2YRM A;  1JK2 A;  4F2J C;  2I13 A;  2EMK A;  3MHH C;  2EL5 A;  4FK5 C;  5KL2 A;  2YTD A;  2YU8 A;  2EN6 A;  2M9A A;  1A1J A;  1BBO A;  2D9H A;  2EOJ A;  2LCE A;  1ZAA C;  2EMC A;  2EMZ A;  2EOO A;  2YRH A;  2EMA A;  2ENH A;  2EOS A;  1A1L A;  2EOX A;  2EM2 A;  3MHS C;  1UN6 B;  2EMY A;  1X3C A;  4GZN C;  2EQ1 A;  2JPA A;  2EOY A;  2JP9 A;  2EMH A;  2EM0 A;  2ELY A;  2YTE A;  1AAY A;  2EN4 A;  1DGC A;  2EP3 A;  2EMF A;  2YRK A;  1BB8 A;  1LLM C;  1X5W A;  2EOM A;  4F6M A;  2ENA A;  2EPC A;  2MKD A;  1ZR9 A;  2EN7 A;  2WCC 3;  1KJK A;  2EN3 A;  2YTG A;  2EPX A;  1TN9 A;  2YTF A;  1Z1B A;  5KL7 A;  2YU5 A;  2EPA A;  1MEY C;  2LVH A;  2HGH A;  1P47 A;  2EE8 A;  2EM8 A;  2LO3 A;  3VHT B;  2EPR A;  4X9J A;  3UK3 C;  2YTN A;  2ADR A;  2GHF A;  2EOH A;  2YSO A;  2PRT A;  4F6N A;  2E72 A;  1YUJ A;  2J7J A;  4IJD A;  3EPK A;  1A1K A;  2YTO A;  4R2C A;  2EN8 A;  2EMX A;  2A25 A;  4M9V C;  1G2D C;  2CT1 A;  3EPL A;  5KL5 A;  2EOQ A;  2EOR A;  2EM4 A;  1TF6 A;  2EM9 A;  2EPZ A;  2EMI A;  2VRD A;  2EN1 A;  2R1F A;  1TF3 A;  2MKN A;  4R2A A;  2EM6 A;  1X6E A;  1G2F C;  2RSI A;  2EOI A;  1F2I G; 
#chains in the Genus database with same CATH topology
 2EOF A;  2N3H A;  2YSP A;  2EM5 A;  1A1G A;  2EPP A;  4JI2 E;  5KL3 A;  2MDG A;  3BBG A;  1T4N A;  1XMO E;  4R2D A;  4DR6 E;  2DLK A;  2LV2 A;  2DRP A;  4F54 A;  1PJQ A;  2HJJ A;  1ZU1 A;  2NUG A;  5KL6 A;  2CSH A;  2E1M A;  3ZOQ B;  4JI3 E;  3HXL A;  4R2P A;  4R8O A;  1B69 A;  3JAM C;  2V85 A;  5F3W A;  2LUQ A;  4WXD A;  4O43 A;  4R2R A;  1X6F A;  2YTI A;  3F6H A;  1A1I A;  5A6B A;  2EM7 A;  4DUZ E;  2V87 A;  2L6M A;  5BR8 E;  2YWQ A;  3THO B;  2LT7 A;  4M0V A;  3T1Y E;  2BB8 A;  2LTS A;  2VF1 A;  4DR3 E;  5IT9 C;  2YRM A;  1JK2 A;  1X47 A;  2RSM A;  4L5N C;  5A6B D;  3RMP A;  4DR7 E;  2EN6 A;  2M9A A;  2EMC A;  2EMA A;  2ENH A;  2EOX A;  5IWA E;  3MHS C;  5AC5 A;  3IWD A;  2EMY A;  1N3G A;  2JP9 A;  2ELY A;  4O5G A;  5LLQ A;  2F4V E;  1DGC A;  4BMJ A;  2EP3 A;  2YRK A;  1BB8 A;  2B7T A;  4WFT A;  2M4I A;  2UXB E;  2V8Q B;  2YU5 A;  3ADG A;  4J8Z A;  2HGH A;  2LRS A;  2EE8 A;  2LO3 A;  4NXN E;  2EPR A;  2JOB A;  2ADR A;  4O4K A;  4DV6 E;  2PRT A;  5A2Q C;  4M30 A;  4F6N A;  1A1K A;  2B3T B;  2EPM X;  2LMZ A;  4R2C A;  1QNT A;  1O0W A;  2A25 A;  2EZ6 A;  4DR2 E;  1G2D C;  3EPL A;  3BID A;  4DMI A;  1TF6 A;  2EM4 A;  2EM9 A;  4K0K E;  1KYQ A;  3KZY A;  1IBL E;  4LF7 E;  2RS7 A;  2MC5 A;  1YPN A;  2VE7 C;  1IBK E;  4R2A A;  4LFB E;  2EM6 A;  1GQE A;  1T4O A;  3J81 C;  2I9I A;  2YTJ A;  2EMB A;  2EJ4 A;  2FTX B;  2EL6 A;  1YUI A;  3VYY A;  2RS6 A;  4IS1 C;  4TUG A;  2DGC A;  3M99 B;  1JK1 A;  1HNX E;  1YSA C;  1WRJ A;  1EH6 A;  2WBT A;  4BS9 A;  1YFH A;  2CTD A;  2KON A;  2EML A;  2F8B A;  4MLV A;  2JVA A;  1IBM E;  4GEQ B;  2K4V A;  2ENC A;  3TQM A;  4YHH E;  2DLQ A;  2L33 A;  1T4L B;  4BC9 A;  2EMW A;  4LF4 E;  3K6Q A;  5A6J A;  4X66 E;  2VQE E;  1X49 A;  2EPU A;  1J5E E;  2EOZ A;  1MGT A;  2EOE A;  2EM3 A;  1XNR E;  2B9D A;  2M1S A;  4WSP A;  2WBS A;  2JWO A;  1SR9 A;  1RC7 A;  1HNZ E;  3LML A;  2UXC E;  5LMN E;  1DQ3 A;  2I13 A;  2EMK A;  3ECR A;  5AAS A;  2EL5 A;  4X65 E;  5KL2 A;  2YTD A;  2YU8 A;  1A1J A;  1BBO A;  2D9H A;  4NHR A;  3DF6 A;  2CPN A;  2EOJ A;  3J7Y p;  1I94 E;  2UXD E;  2EOO A;  1GZ6 A;  1IQS A;  3VYX A;  1YYW A;  2MC6 A;  2NA2 A;  2V88 A;  1AAY A;  4JYA E;  2ODR D;  2E5L E;  4AQY E;  1XNQ E;  2ENA A;  2HC5 A;  2EPL X;  4L8N A;  2MKD A;  3BF2 A;  1TN9 A;  1MEY C;  2LVH A;  1HR0 E;  4B3T E;  2EM8 A;  4ZYH A;  4X9J A;  4DV5 E;  2YTN A;  2JY9 A;  2Q8U A;  1SFE A;  5DNY A;  5AE2 A;  2YSO A;  4P78 A;  1YUJ A;  2J7J A;  4IJD A;  4F9B B;  4DV4 E;  1YZ9 A;  2CT1 A;  2EOR A;  2EPO A;  2VQF E;  2VRD A;  2EN1 A;  3IWC A;  2L92 A;  1N34 E;  2MKN A;  2R76 A;  4LU9 A;  4ZYG A;  2UUA E;  4GKK E;  2RSI A;  4DV0 E;  4KWY A;  1QU6 A;  5KL4 A;  2EQ3 A;  2GLI A;  2B7V A;  4JI5 E;  1HNW E;  3KZZ A;  3HQ1 A;  2EL4 A;  2L8T A;  3EPJ A;  4ZYD A;  1STU A;  2ELZ A;  1ZBT A;  3ADJ A;  4X8W A;  4R2Q A;  4R2S A;  4DV1 E;  1X6H A;  4DKK A;  4LF8 E;  3AV0 A;  2GPI A;  1N32 E;  2KOU A;  3MSW A;  3J7A G;  4RH8 A;  2FV4 B;  4R2E A;  5CFF E;  2V86 A;  4P7D A;  3BGH A;  2K7I A;  4JI4 E;  4OX9 E;  2EWL A;  2LJH A;  4R03 A;  4HTG A;  1FKA E;  2DIX A;  2LBS B;  2L2N A;  4N4R B;  5ADZ A;  4DV3 E;  4F2J C;  1YYO A;  2RTX A;  2L2M A;  3MHH C;  4FK5 C;  5AE3 A;  4KZS A;  5LMU E;  2H36 X;  2LJU A;  2YT4 A;  2DB2 A;  2JXP A;  2EMZ A;  4GKJ E;  5FLX C;  2YRH A;  5IXM B;  1L4S A;  1A1L A;  2ZM6 E;  1UN6 B;  1X3C A;  1DI2 A;  4GZN C;  2EOY A;  2RQL A;  2EM0 A;  1UHZ A;  2YTE A;  4WXC A;  4WX9 A;  4WPY A;  1IMU A;  2LUP B;  1N33 E;  1LLM C;  4JI6 E;  1X5W A;  2EPC A;  4LFC E;  1ZR9 A;  1KJK A;  2WCC 3;  2EN3 A;  2YTF A;  2EPN A;  1Z1B A;  1PJS A;  1P47 A;  4OOG C;  3VHT B;  3UK3 C;  3THN A;  1RQ0 A;  4BBY A;  1BBG A;  4B3S E;  1WXR A;  4JI1 E;  2EOH A;  3VK6 A;  2L2K B;  4B3M E;  2HHH E;  3EPK A;  2EMX A;  2V89 A;  4M9V C;  2V83 A;  4B3R E;  3HPS A;  2G7H A;  2JYA A;  2EPZ A;  4F9A B;  2EMI A;  3LLH A;  4YY3 E;  2JOX A;  2DMY A;  2R1F A;  5AC4 A;  4F9C B;  1G2F C;  3L00 A;  4DR1 E;  2EOI A;  1F2I G;  4JI7 E;  4WYQ B;  5A6K A;  2EMG A;  3OML A;  4BHC A;  3EPH A;  2WBU A;  1NCS A;  2NAB A;  4Q28 A;  3OTO E;  1GTK A;  2RPC A;  4NXM E;  4DR5 E;  3QG5 C;  1AH5 A;  2EN2 A;  3AUZ A;  5A6A A;  2N3G A;  1RMD A;  1WJP A;  1A1F A;  5IV8 B;  3ADI A;  1EH7 A;  4DV2 E;  1XMQ E;  4WSG A;  2WZO A;  2YTP A;  1PJT A;  1EKZ A;  2YZT A;  3JTZ A;  4JI0 E;  4RHB B;  4DR4 E;  4MLQ A;  4DUY E;  2L3C A;  1T38 A;  2LE2 A;  1UBD C;  2UUB E;  2BBG A;  4LF6 E;  2DMI A;  2EQ0 A;  1UIL A;  1YYK A;  1A1H A;  2N8X A;  2YTQ A;  3J80 C;  3HPZ A;  1EH8 A;  4I8O A;  3FIG A;  2L3J A;  4Q35 B;  4JI8 E;  4X62 E;  5T6J A;  4JV5 E;  5LL6 R;  2JR1 A;  1X48 A;  3JU0 A;  3H09 A;  2LCE A;  1ZAA C;  1PKP A;  4BCA A;  3EQ1 A;  3HTX A;  2EOS A;  4DV7 E;  3ADL A;  1ZBQ A;  2EM2 A;  3F6G A;  4BC7 A;  3KWR A;  2LTR A;  2EQ1 A;  2JPA A;  3IWB A;  2EMH A;  1WHQ A;  2EN4 A;  4M2Z A;  1IQO A;  1PDA A;  2DSY A;  2EMF A;  4KHP E;  5TSE A;  2EOM A;  4F6M A;  4NZV A;  4HEI A;  2FGG A;  2EN7 A;  2YTG A;  4ZYE A;  2EPX A;  2IHR 1;  2ODR C;  2EPA A;  2M7Q A;  5KL7 A;  3T1H E;  2UUC E;  4O24 A;  2NUE A;  2KHX A;  2NUF A;  1NEI A;  2GHF A;  5A69 A;  2E72 A;  2YTO A;  2EN8 A;  5AE1 A;  2EPK X;  2UU9 E;  4BHB A;  3C4T A;  1FJG E;  4LF5 E;  5KL5 A;  2EOQ A;  1J26 A;  1WHN A;  2MDR A;  1T39 A;  4X64 E;  3C6K A;  4LTY A;  2YPN A;  3P1X A;  4TUI A;  1N36 E;  3C6M A;  1TF3 A;  4LFA E;  4LF9 E;  3DJW A;  1X6E A;  3C4B A; 
#chains in the Genus database with same CATH homology
 2EOF A;  2YTJ A;  5KL4 A;  2EMG A;  2YSP A;  2EQ3 A;  2EMB A;  2EM5 A;  1A1G A;  2EJ4 A;  2EPP A;  5KL3 A;  2GLI A;  2MDG A;  2EL6 A;  1YUI A;  4R2D A;  3EPH A;  2WBU A;  1NCS A;  2NAB A;  4IS1 C;  2DLK A;  2LV2 A;  2DGC A;  2DRP A;  2EL4 A;  3M99 B;  2RPC A;  1JK1 A;  3EPJ A;  1YSA C;  1ZU1 A;  2ELZ A;  5KL6 A;  2WBT A;  2CSH A;  2EN2 A;  2CTD A;  2EML A;  1RMD A;  1WJP A;  4R2P A;  4R2Q A;  1B69 A;  1A1F A;  4R2S A;  1X6H A;  4WSG A;  2YTP A;  2ENC A;  4R2R A;  1X6F A;  2DLQ A;  2YTI A;  1A1I A;  2EMW A;  2EM7 A;  4R2E A;  1UBD C;  2EPU A;  2DMI A;  2EOZ A;  2EQ0 A;  2LT7 A;  2BB8 A;  1A1H A;  2EOE A;  2EM3 A;  2YTQ A;  2WBS A;  2YRM A;  1JK2 A;  4F2J C;  2I13 A;  2EMK A;  3MHH C;  2EL5 A;  4FK5 C;  5KL2 A;  2YTD A;  2YU8 A;  2EN6 A;  2M9A A;  1A1J A;  1BBO A;  2D9H A;  2EOJ A;  2LCE A;  1ZAA C;  2EMC A;  2EMZ A;  2EOO A;  2YRH A;  2EMA A;  2ENH A;  2EOS A;  1A1L A;  2EOX A;  2EM2 A;  3MHS C;  1UN6 B;  2EMY A;  1X3C A;  4GZN C;  2EQ1 A;  2JPA A;  2EOY A;  2JP9 A;  2EMH A;  2EM0 A;  2ELY A;  2YTE A;  1AAY A;  2EN4 A;  1DGC A;  2EP3 A;  2EMF A;  2YRK A;  1BB8 A;  1LLM C;  1X5W A;  2EOM A;  4F6M A;  2ENA A;  2EPC A;  2MKD A;  1ZR9 A;  2EN7 A;  2WCC 3;  1KJK A;  2EN3 A;  2YTG A;  2EPX A;  1TN9 A;  2YTF A;  1Z1B A;  5KL7 A;  2YU5 A;  2EPA A;  1MEY C;  2LVH A;  2HGH A;  1P47 A;  2EE8 A;  2EM8 A;  2LO3 A;  3VHT B;  2EPR A;  4X9J A;  3UK3 C;  2YTN A;  2ADR A;  2GHF A;  2EOH A;  2YSO A;  2PRT A;  4F6N A;  2E72 A;  1YUJ A;  2J7J A;  4IJD A;  3EPK A;  1A1K A;  2YTO A;  4R2C A;  2EN8 A;  2EMX A;  2A25 A;  4M9V C;  1G2D C;  2CT1 A;  3EPL A;  5KL5 A;  2EOQ A;  2EOR A;  2EM4 A;  1TF6 A;  2EM9 A;  2EPZ A;  2EMI A;  2VRD A;  2EN1 A;  2R1F A;  1TF3 A;  2MKN A;  4R2A A;  2EM6 A;  1X6E A;  1G2F C;  2RSI A;  2EOI A;  1F2I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...