5KL6A

Wilms tumor protein (wt1) q369r znf2-4 in complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
87
structure length
87
Chain Sequence
KPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wilms tumor protein
publication title Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 5kl6A00
2EPCA 2EN6A 2EN7A 4F6MA 3VHTB 1F2IG 1YSAC 4X9JA 2WBTA 3MHHC 1ZAAC 2EL5A 1ZR9A 2A25A 1TF3A 2EOHA 2RSIA 2YTGA 1A1GA 2EMAA 1JK2A 2EQ1A 2YRKA 2EQ3A 3EPKA 3EPLA 2EMZA 2YRMA 1TF6A 2YTQA 2MKDA 2EMBA 1X6FA 1WJPA 2EMKA 1G2FC 2EPRA 2YTJA 2ADRA 2EM4A 2EM5A 2YU5A 4IS1C 1UN6B 1BBOA 2EMLA 2EMHA 2EN1A 2EORA 2YTIA 1A1KA 1A1FA 3UK3C 2WCC3 2LCEA 2EOXA 2PRTA 2CT1A 1MEYC 2EOSA 1A1HA 2EP3A 2VRDA 2NABA 2YU8A 2EM2A 2EL4A 4R2RA 4R2SA 1B69A 2EPAA 2EQ0A 2EN8A 1UBDC 2GLIA 2EJ4A 1KJKA 4R2CA 1NCSA 2EPXA 1P47A 2ENCA 1X5WA 2LO3A 4R2EA 4IJDA 5KL6A 1YUJA 4F2JC 1AAYA 1ZU1A 2DGCA 2I13A 4F6NA 2EPPA 2EOFA 2EPUA 5KL7A 4R2PA 2E72A 1TN9A 2EN4A 2ELZA 2EM0A 2R1FA 2YSPA 4FK5C 1YUIA 2EMFA 2YTNA 2J7JA 2EM7A 2EOYA 5KL5A 2EOZA 3M99B 2YTOA 3EPHA 1RMDA 1X3CA 2YTDA 2M9AA 5KL3A 2ENAA 2EOMA 4R2QA 2YTPA 4R2DA 2MDGA 2EMWA 5KL2A 2HGHA 2EMGA 3EPJA 3MHSC 2ENHA 4WSGA 2EM9A 2DLQA 1X6HA 2ELYA 2DRPA 2EM3A 2YSOA 5KL4A 2MKNA 2YTFA 1A1IA 2D9HA 2EN3A 2DLKA 2EMCA 2EOOA 4R2AA 4M9VC 2YRHA 2JP9A 2DMIA 2EN2A 2EMYA 4GZNC 1JK1A 2EL6A 2LV2A 2WBUA 2EMXA 1Z1BA 1LLMC 2EM8A 2EE8A 2WBSA 2EOJA 1BB8A 1A1LA 1G2DC 2JPAA 2EOEA 1DGCA 2EM6A 2LVHA 2EPZA 2BB8A 2GHFA 1X6EA 1A1JA 2EOIA 2RPCA 2CSHA 2CTDA 2YTEA 2EMIA 2EOQA 2LT7A
chains in the Genus database with same CATH superfamily
2L3CA 2DMYA 2EN6A 1YSAC 3HTXA 4DV0E 4BMJA 4GKJE 2EL5A 1T38A 1TF3A 2EOHA 3LMLA 1X47A 2F8BA 1FKAE 1YYWA 2EQ3A 4LF7E 4LFBE 4F9AB 4WSPA 2MKDA 2EMBA 1X6FA 2EMKA 1IQSA 5BR8E 2EM5A 4IS1C 1RC7A 2N3GA 4X62E 2EMHA 2EORA 4P78A 3J7AG 1A1KA 3OMLA 2CT1A 2UU9E 5AC4A 4WX9A 2EOSA 2M4IA 3K6QA 1A1HA 2NABA 4JI8E 2EL4A 4R2SA 1J26A 2EPAA 3HPSA 3AV0A 2EQ0A 1WXRA 2EN8A 1KJKA 2MC6A 4R2CA 5IT9C 1X5WA 1FJGE 2JY9A 2DGCA 3L00A 2LE2A 2EPPA 4O5GA 4BHBA 2B7TA 2EN4A 4JI3E 1MGTA 1YYOA 2EM7A 2LTSA 2LTRA 1X3CA 2M9AA 4F54A 2EOMA 3THOB 2YTPA 4R2DA 4YY3E 2MDGA 1DQ3A 2EMGA 1YPNA 3DF6A 3MHSC 2ENHA 4DR4E 2JXPA 4JI1E 4WPYA 2EM9A 2DLQA 4RHBB 2EPLX 1X6HA 2K4VA 5TSEA 4R8OA 2YTFA 2D9HA 2DLKA 2EMCA 2EWLA 4R2AA 4M9VC 1HNWE 4DR1E 2YRHA 4WYQB 4DUZE 4LF4E 2HHHE 4RH8A 1PJSA 3VK6A 2EPKX 2N8XA 2EOEA 2I9IA 5A6JA 2EM6A 2LVHA 2UUAE 4JI4E 4B3RE 1SR9A 2GHFA 5CFFE 1XMQE 4L8NA 3VYXA 2R76A 3P1XA 2EM4A 2M1SA 2EOQA 5KL5A 2DB2A 1T4NA 2V85A 4DUYE 2YZTA 3MHHC 4X8WA 2A25A 2LRSA 4TUGA 2RSIA 1JK2A 3BF2A 3EPLA 1TF6A 2YTQA 1HNXE 1G2FC 4DV4E 1RQ0A 1UN6B 2G7HA 4F9BB 4ZYEA 2EMLA 2EN1A 3KZYA 2VQFE 1IMUA 2ODRC 1T4OA 1X49A 3C6MA 2L2NA 2LCEA 2EOXA 1HR0E 4GKKE 1EH7A 4KWYA 1NEIA 4AQYE 1MEYC 2V88A 2VRDA 2YU8A 1EKZA 4DV7E 4R2RA 4LTYA 2CPNA 4WXDA 1B69A 1GZ6A 2Q8UA 3EQ1A 3J80C 2EJ4A 2JOXA 3RMPA 2LMZA 2YWQA 3KWRA 3JTZA 4K0KE 1EH8A 5KL6A 5LLQA 4JI2E 1YUJA 4F2JC 1ZU1A 2NA2A 4F6NA 4DR3E 2L33A 3BBGA 2RQLA 2ELZA 4JI7E 2EM0A 2MC5A 1YUIA 2EMFA 2EPMX 3M99B 2YTDA 1PJQA 4R2QA 1T4LB 3J7Yp 3C6KA 2HGHA 1UHZA 3EPJA 2GPIA 2FTXB 4LF9E 2ELYA 2DRPA 2BBGA 4JI0E 1O0WA 2LJHA 3KZZA 2L92A 2ODRD 2EOOA 3JU0A 3T1HE 2LBSB 2JVAA 5A2QC 4HTGA 2L8TA 2EN2A 2UXBE 1YZ9A 3ADIA 2EL6A 1Z1BA 1LLMC 5ADZA 2JR1A 2UUBE 3ECRA 2H36X 2HJJA 2WBSA 1BB8A 1A1LA 5AE3A 2EZ6A 1IQOA 4DMIA 1DGCA 3F6HA 5A6AA 2HC5A 1X6EA 2K7IA 5LL6R 2YTGA 4R2EA 4BCAA 1WRJA 2LT7A 4JV5E 2YT4A 2EN7A 4O43A 4F6MA 1F2IG 3ZOQB 2WBTA 1ZR9A 4P7DA 2E1MA 2NUGA 5IWAE 4NXNE 1YFHA 2KONA 3FIGA 1YYKA 4HEIA 4L5NC 2KHXA 4M0VA 3EPKA 2UXCE 1L4SA 2YRMA 3ADGA 1N3GA 3IWCA 2VF1A 2V83A 2FGGA 2ADRA 1IBME 2YU5A 3F6GA 1BBOA 4LF8E 3T1YE 4JYAE 4KHPE 2YTIA 2JYAA 3UK3C 4LFAE 3C4BA 1PKPA 2IHR1 1N36E 2B3TB 2EP3A 2EM2A 4LU9A 4ZYGA 4X64E 2FV4B 2GLIA 4LF5E 1NCSA 3H09A 1P47A 2ENCA 2UUCE 2V86A 2LO3A 4ZYHA 4IJDA 2EPNA 1AAYA 5KL7A 4MLVA 2E72A 4JI5E 1XNQE 1GQEA 4MLQA 2YSPA 4KZSA 2J7JA 3EPHA 4DV6E 4B3SE 1RMDA 1KYQA 2E5LE 4OX9E 2EMWA 4NZVA 4M30A 4BC9A 2UXDE 2RSMA 2EPOA 2JOBA 3IWDA 1HNZE 4WSGA 3JAMC 2DIXA 3DJWA 2ZM6E 4DR2E 1XMOE 2YSOA 4BBYA 3OTOE 5KL4A 1A1IA 2EN3A 2LUPB 1SFEA 2JP9A 2DMIA 2LUQA 4O4KA 2EMYA 4Q35B 1ZBQA 1X48A 5A6KA 4ZYDA 1JK1A 2LV2A 2L6MA 3C4TA 5A6BD 4GEQB 5T6JA 4YHHE 2V87A 2EOJA 2NUFA 4OOGC 4X65E 2V8QB 2L2KB 5LMUE 4DV5E 2L3JA 2JPAA 1IBLE 1T39A 1WHNA 2EOIA 2RPCA 2YTEA 2EMIA 1A1FA 4Q28A 2KOUA 2RS7A 2EPCA 3VHTB 5AE1A 4DR6E 4X9JA 4B3ME 1ZAAC 3ADJA 4LF6E 5F3WA 1A1GA 2VE7C 2EMAA 2RS6A 2EQ1A 2YRKA 2WZOA 5DNYA 5FLXC 2EMZA 1XNRE 5AC5A 1N32E 1EH6A 4R03A 1WJPA 4WFTA 4NXME 2EPRA 4DV2E 1IBKE 2DSYA 2YTJA 4N4RB 1AH5A 5A69A 5LMNE 2B9DA 4NHRA 2WCC3 3VYYA 4BC7A 4DKKA 2PRTA 3QG5C 4DV1E 4O24A 4TUIA 2LJUA 5AE2A 5A6BA 3TQMA 4B3TE 3HQ1A 1I94E 1UBDC 1N33E 2JWOA 3IWBA 2EPXA 4JI6E 1DI2A 3HPZA 5AASA 2N3HA 1PDAA 2I13A 1BBGA 2EOFA 1N34E 1ZBTA 2EPUA 1STUA 2B7VA 1TN9A 1PJTA 2R1FA 4M2ZA 4FK5C 4J8ZA 3AUZA 2YTNA 4X66E 2EOYA 2EOZA 2YTOA 3BGHA 2VQEE 5KL3A 2ENAA 4BS9A 4I8OA 4WXCA 5KL2A 3LLHA 2RTXA 1QNTA 2F4VE 3HXLA 1UILA 2M7QA 1J5EE 3BIDA 3THNA 2EM3A 2MKNA 4BHCA 1GTKA 4F9CB 2MDRA 2V89A 1WHQA 4GZNC 3J81C 2WBUA 2EMXA 1QU6A 2EM8A 3ADLA 2L2MA 2EE8A 5IV8B 1G2DC 2YPNA 5IXMB 4DV3E 3MSWA 2EPZA 2BB8A 2NUEA 1A1JA 4DR5E 4LFCE 4DR7E 2CSHA 2CTDA 4R2PA
chains in the Genus database with same CATH topology
2EPCA 2EN6A 2EN7A 4F6MA 3VHTB 1F2IG 1YSAC 4X9JA 2WBTA 3MHHC 1ZAAC 2EL5A 1ZR9A 2A25A 1TF3A 2EOHA 2RSIA 2YTGA 1A1GA 2EMAA 1JK2A 2EQ1A 2YRKA 2EQ3A 3EPKA 3EPLA 2EMZA 2YRMA 1TF6A 2YTQA 2MKDA 2EMBA 1X6FA 1WJPA 2EMKA 1G2FC 2EPRA 2YTJA 2ADRA 2EM4A 2EM5A 2YU5A 4IS1C 1UN6B 1BBOA 2EMLA 2EMHA 2EN1A 2EORA 2YTIA 1A1KA 1A1FA 3UK3C 2WCC3 2LCEA 2EOXA 2PRTA 2CT1A 1MEYC 2EOSA 1A1HA 2EP3A 2VRDA 2NABA 2YU8A 2EM2A 2EL4A 4R2RA 4R2SA 1B69A 2EPAA 2EQ0A 2EN8A 1UBDC 2GLIA 2EJ4A 1KJKA 4R2CA 1NCSA 2EPXA 1P47A 2ENCA 1X5WA 2LO3A 4R2EA 4IJDA 5KL6A 1YUJA 4F2JC 1AAYA 1ZU1A 2DGCA 2I13A 4F6NA 2EPPA 2EOFA 2EPUA 5KL7A 4R2PA 2E72A 1TN9A 2EN4A 2ELZA 2EM0A 2R1FA 2YSPA 4FK5C 1YUIA 2EMFA 2YTNA 2J7JA 2EM7A 2EOYA 5KL5A 2EOZA 3M99B 2YTOA 3EPHA 1RMDA 1X3CA 2YTDA 2M9AA 5KL3A 2ENAA 2EOMA 4R2QA 2YTPA 4R2DA 2MDGA 2EMWA 5KL2A 2HGHA 2EMGA 3EPJA 3MHSC 2ENHA 4WSGA 2EM9A 2DLQA 1X6HA 2ELYA 2DRPA 2EM3A 2YSOA 5KL4A 2MKNA 2YTFA 1A1IA 2D9HA 2EN3A 2DLKA 2EMCA 2EOOA 4R2AA 4M9VC 2YRHA 2JP9A 2DMIA 2EN2A 2EMYA 4GZNC 1JK1A 2EL6A 2LV2A 2WBUA 2EMXA 1Z1BA 1LLMC 2EM8A 2EE8A 2WBSA 2EOJA 1BB8A 1A1LA 1G2DC 2JPAA 2EOEA 1DGCA 2EM6A 2LVHA 2EPZA 2BB8A 2GHFA 1X6EA 1A1JA 2EOIA 2RPCA 2CSHA 2CTDA 2YTEA 2EMIA 2EOQA 2LT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPC A;  2EN6 A;  2EN7 A;  4F6M A;  3VHT B;  1F2I G;  1YSA C;  4X9J A;  2WBT A;  3MHH C;  1ZAA C;  2EL5 A;  1ZR9 A;  2A25 A;  1TF3 A;  2EOH A;  2RSI A;  2YTG A;  1A1G A;  2EMA A;  1JK2 A;  2EQ1 A;  2YRK A;  2EQ3 A;  3EPK A;  3EPL A;  2EMZ A;  2YRM A;  1TF6 A;  2YTQ A;  2MKD A;  2EMB A;  1X6F A;  1WJP A;  2EMK A;  1G2F C;  2EPR A;  2YTJ A;  2ADR A;  2EM4 A;  2EM5 A;  2YU5 A;  4IS1 C;  1UN6 B;  1BBO A;  2EML A;  2EMH A;  2EN1 A;  2EOR A;  2YTI A;  1A1K A;  1A1F A;  3UK3 C;  2WCC 3;  2LCE A;  2EOX A;  2PRT A;  2CT1 A;  1MEY C;  2EOS A;  1A1H A;  2EP3 A;  2VRD A;  2NAB A;  2YU8 A;  2EM2 A;  2EL4 A;  4R2R A;  4R2S A;  1B69 A;  2EPA A;  2EQ0 A;  2EN8 A;  1UBD C;  2GLI A;  2EJ4 A;  1KJK A;  4R2C A;  1NCS A;  2EPX A;  1P47 A;  2ENC A;  1X5W A;  2LO3 A;  4R2E A;  4IJD A;  5KL6 A;  1YUJ A;  4F2J C;  1AAY A;  1ZU1 A;  2DGC A;  2I13 A;  4F6N A;  2EPP A;  2EOF A;  2EPU A;  5KL7 A;  4R2P A;  2E72 A;  1TN9 A;  2EN4 A;  2ELZ A;  2EM0 A;  2R1F A;  2YSP A;  4FK5 C;  1YUI A;  2EMF A;  2YTN A;  2J7J A;  2EM7 A;  2EOY A;  5KL5 A;  2EOZ A;  3M99 B;  2YTO A;  3EPH A;  1RMD A;  1X3C A;  2YTD A;  2M9A A;  5KL3 A;  2ENA A;  2EOM A;  4R2Q A;  2YTP A;  4R2D A;  2MDG A;  2EMW A;  5KL2 A;  2HGH A;  2EMG A;  3EPJ A;  3MHS C;  2ENH A;  4WSG A;  2EM9 A;  2DLQ A;  1X6H A;  2ELY A;  2DRP A;  2EM3 A;  2YSO A;  5KL4 A;  2MKN A;  2YTF A;  1A1I A;  2D9H A;  2EN3 A;  2DLK A;  2EMC A;  2EOO A;  4R2A A;  4M9V C;  2YRH A;  2JP9 A;  2DMI A;  2EN2 A;  2EMY A;  4GZN C;  1JK1 A;  2EL6 A;  2LV2 A;  2WBU A;  2EMX A;  1Z1B A;  1LLM C;  2EM8 A;  2EE8 A;  2WBS A;  2EOJ A;  1BB8 A;  1A1L A;  1G2D C;  2JPA A;  2EOE A;  1DGC A;  2EM6 A;  2LVH A;  2EPZ A;  2BB8 A;  2GHF A;  1X6E A;  1A1J A;  2EOI A;  2RPC A;  2CSH A;  2CTD A;  2YTE A;  2EMI A;  2EOQ A;  2LT7 A; 
#chains in the Genus database with same CATH topology
 2L3C A;  2DMY A;  2EN6 A;  1YSA C;  3HTX A;  4DV0 E;  4BMJ A;  4GKJ E;  2EL5 A;  1T38 A;  1TF3 A;  2EOH A;  3LML A;  1X47 A;  2F8B A;  1FKA E;  1YYW A;  2EQ3 A;  4LF7 E;  4LFB E;  4F9A B;  4WSP A;  2MKD A;  2EMB A;  1X6F A;  2EMK A;  1IQS A;  5BR8 E;  2EM5 A;  4IS1 C;  1RC7 A;  2N3G A;  4X62 E;  2EMH A;  2EOR A;  4P78 A;  3J7A G;  1A1K A;  3OML A;  2CT1 A;  2UU9 E;  5AC4 A;  4WX9 A;  2EOS A;  2M4I A;  3K6Q A;  1A1H A;  2NAB A;  4JI8 E;  2EL4 A;  4R2S A;  1J26 A;  2EPA A;  3HPS A;  3AV0 A;  2EQ0 A;  1WXR A;  2EN8 A;  1KJK A;  2MC6 A;  4R2C A;  5IT9 C;  1X5W A;  1FJG E;  2JY9 A;  2DGC A;  3L00 A;  2LE2 A;  2EPP A;  4O5G A;  4BHB A;  2B7T A;  2EN4 A;  4JI3 E;  1MGT A;  1YYO A;  2EM7 A;  2LTS A;  2LTR A;  1X3C A;  2M9A A;  4F54 A;  2EOM A;  3THO B;  2YTP A;  4R2D A;  4YY3 E;  2MDG A;  1DQ3 A;  2EMG A;  1YPN A;  3DF6 A;  3MHS C;  2ENH A;  4DR4 E;  2JXP A;  4JI1 E;  4WPY A;  2EM9 A;  2DLQ A;  4RHB B;  2EPL X;  1X6H A;  2K4V A;  5TSE A;  4R8O A;  2YTF A;  2D9H A;  2DLK A;  2EMC A;  2EWL A;  4R2A A;  4M9V C;  1HNW E;  4DR1 E;  2YRH A;  4WYQ B;  4DUZ E;  4LF4 E;  2HHH E;  4RH8 A;  1PJS A;  3VK6 A;  2EPK X;  2N8X A;  2EOE A;  2I9I A;  5A6J A;  2EM6 A;  2LVH A;  2UUA E;  4JI4 E;  4B3R E;  1SR9 A;  2GHF A;  5CFF E;  1XMQ E;  4L8N A;  3VYX A;  2R76 A;  3P1X A;  2EM4 A;  2M1S A;  2EOQ A;  5KL5 A;  2DB2 A;  1T4N A;  2V85 A;  4DUY E;  2YZT A;  3MHH C;  4X8W A;  2A25 A;  2LRS A;  4TUG A;  2RSI A;  1JK2 A;  3BF2 A;  3EPL A;  1TF6 A;  2YTQ A;  1HNX E;  1G2F C;  4DV4 E;  1RQ0 A;  1UN6 B;  2G7H A;  4F9B B;  4ZYE A;  2EML A;  2EN1 A;  3KZY A;  2VQF E;  1IMU A;  2ODR C;  1T4O A;  1X49 A;  3C6M A;  2L2N A;  2LCE A;  2EOX A;  1HR0 E;  4GKK E;  1EH7 A;  4KWY A;  1NEI A;  4AQY E;  1MEY C;  2V88 A;  2VRD A;  2YU8 A;  1EKZ A;  4DV7 E;  4R2R A;  4LTY A;  2CPN A;  4WXD A;  1B69 A;  1GZ6 A;  2Q8U A;  3EQ1 A;  3J80 C;  2EJ4 A;  2JOX A;  3RMP A;  2LMZ A;  2YWQ A;  3KWR A;  3JTZ A;  4K0K E;  1EH8 A;  5KL6 A;  5LLQ A;  4JI2 E;  1YUJ A;  4F2J C;  1ZU1 A;  2NA2 A;  4F6N A;  4DR3 E;  2L33 A;  3BBG A;  2RQL A;  2ELZ A;  4JI7 E;  2EM0 A;  2MC5 A;  1YUI A;  2EMF A;  2EPM X;  3M99 B;  2YTD A;  1PJQ A;  4R2Q A;  1T4L B;  3J7Y p;  3C6K A;  2HGH A;  1UHZ A;  3EPJ A;  2GPI A;  2FTX B;  4LF9 E;  2ELY A;  2DRP A;  2BBG A;  4JI0 E;  1O0W A;  2LJH A;  3KZZ A;  2L92 A;  2ODR D;  2EOO A;  3JU0 A;  3T1H E;  2LBS B;  2JVA A;  5A2Q C;  4HTG A;  2L8T A;  2EN2 A;  2UXB E;  1YZ9 A;  3ADI A;  2EL6 A;  1Z1B A;  1LLM C;  5ADZ A;  2JR1 A;  2UUB E;  3ECR A;  2H36 X;  2HJJ A;  2WBS A;  1BB8 A;  1A1L A;  5AE3 A;  2EZ6 A;  1IQO A;  4DMI A;  1DGC A;  3F6H A;  5A6A A;  2HC5 A;  1X6E A;  2K7I A;  5LL6 R;  2YTG A;  4R2E A;  4BCA A;  1WRJ A;  2LT7 A;  4JV5 E;  2YT4 A;  2EN7 A;  4O43 A;  4F6M A;  1F2I G;  3ZOQ B;  2WBT A;  1ZR9 A;  4P7D A;  2E1M A;  2NUG A;  5IWA E;  4NXN E;  1YFH A;  2KON A;  3FIG A;  1YYK A;  4HEI A;  4L5N C;  2KHX A;  4M0V A;  3EPK A;  2UXC E;  1L4S A;  2YRM A;  3ADG A;  1N3G A;  3IWC A;  2VF1 A;  2V83 A;  2FGG A;  2ADR A;  1IBM E;  2YU5 A;  3F6G A;  1BBO A;  4LF8 E;  3T1Y E;  4JYA E;  4KHP E;  2YTI A;  2JYA A;  3UK3 C;  4LFA E;  3C4B A;  1PKP A;  2IHR 1;  1N36 E;  2B3T B;  2EP3 A;  2EM2 A;  4LU9 A;  4ZYG A;  4X64 E;  2FV4 B;  2GLI A;  4LF5 E;  1NCS A;  3H09 A;  1P47 A;  2ENC A;  2UUC E;  2V86 A;  2LO3 A;  4ZYH A;  4IJD A;  2EPN A;  1AAY A;  5KL7 A;  4MLV A;  2E72 A;  4JI5 E;  1XNQ E;  1GQE A;  4MLQ A;  2YSP A;  4KZS A;  2J7J A;  3EPH A;  4DV6 E;  4B3S E;  1RMD A;  1KYQ A;  2E5L E;  4OX9 E;  2EMW A;  4NZV A;  4M30 A;  4BC9 A;  2UXD E;  2RSM A;  2EPO A;  2JOB A;  3IWD A;  1HNZ E;  4WSG A;  3JAM C;  2DIX A;  3DJW A;  2ZM6 E;  4DR2 E;  1XMO E;  2YSO A;  4BBY A;  3OTO E;  5KL4 A;  1A1I A;  2EN3 A;  2LUP B;  1SFE A;  2JP9 A;  2DMI A;  2LUQ A;  4O4K A;  2EMY A;  4Q35 B;  1ZBQ A;  1X48 A;  5A6K A;  4ZYD A;  1JK1 A;  2LV2 A;  2L6M A;  3C4T A;  5A6B D;  4GEQ B;  5T6J A;  4YHH E;  2V87 A;  2EOJ A;  2NUF A;  4OOG C;  4X65 E;  2V8Q B;  2L2K B;  5LMU E;  4DV5 E;  2L3J A;  2JPA A;  1IBL E;  1T39 A;  1WHN A;  2EOI A;  2RPC A;  2YTE A;  2EMI A;  1A1F A;  4Q28 A;  2KOU A;  2RS7 A;  2EPC A;  3VHT B;  5AE1 A;  4DR6 E;  4X9J A;  4B3M E;  1ZAA C;  3ADJ A;  4LF6 E;  5F3W A;  1A1G A;  2VE7 C;  2EMA A;  2RS6 A;  2EQ1 A;  2YRK A;  2WZO A;  5DNY A;  5FLX C;  2EMZ A;  1XNR E;  5AC5 A;  1N32 E;  1EH6 A;  4R03 A;  1WJP A;  4WFT A;  4NXM E;  2EPR A;  4DV2 E;  1IBK E;  2DSY A;  2YTJ A;  4N4R B;  1AH5 A;  5A69 A;  5LMN E;  2B9D A;  4NHR A;  2WCC 3;  3VYY A;  4BC7 A;  4DKK A;  2PRT A;  3QG5 C;  4DV1 E;  4O24 A;  4TUI A;  2LJU A;  5AE2 A;  5A6B A;  3TQM A;  4B3T E;  3HQ1 A;  1I94 E;  1UBD C;  1N33 E;  2JWO A;  3IWB A;  2EPX A;  4JI6 E;  1DI2 A;  3HPZ A;  5AAS A;  2N3H A;  1PDA A;  2I13 A;  1BBG A;  2EOF A;  1N34 E;  1ZBT A;  2EPU A;  1STU A;  2B7V A;  1TN9 A;  1PJT A;  2R1F A;  4M2Z A;  4FK5 C;  4J8Z A;  3AUZ A;  2YTN A;  4X66 E;  2EOY A;  2EOZ A;  2YTO A;  3BGH A;  2VQE E;  5KL3 A;  2ENA A;  4BS9 A;  4I8O A;  4WXC A;  5KL2 A;  3LLH A;  2RTX A;  1QNT A;  2F4V E;  3HXL A;  1UIL A;  2M7Q A;  1J5E E;  3BID A;  3THN A;  2EM3 A;  2MKN A;  4BHC A;  1GTK A;  4F9C B;  2MDR A;  2V89 A;  1WHQ A;  4GZN C;  3J81 C;  2WBU A;  2EMX A;  1QU6 A;  2EM8 A;  3ADL A;  2L2M A;  2EE8 A;  5IV8 B;  1G2D C;  2YPN A;  5IXM B;  4DV3 E;  3MSW A;  2EPZ A;  2BB8 A;  2NUE A;  1A1J A;  4DR5 E;  4LFC E;  4DR7 E;  2CSH A;  2CTD A;  4R2P A; 
#chains in the Genus database with same CATH homology
 2EPC A;  2EN6 A;  2EN7 A;  4F6M A;  3VHT B;  1F2I G;  1YSA C;  4X9J A;  2WBT A;  3MHH C;  1ZAA C;  2EL5 A;  1ZR9 A;  2A25 A;  1TF3 A;  2EOH A;  2RSI A;  2YTG A;  1A1G A;  2EMA A;  1JK2 A;  2EQ1 A;  2YRK A;  2EQ3 A;  3EPK A;  3EPL A;  2EMZ A;  2YRM A;  1TF6 A;  2YTQ A;  2MKD A;  2EMB A;  1X6F A;  1WJP A;  2EMK A;  1G2F C;  2EPR A;  2YTJ A;  2ADR A;  2EM4 A;  2EM5 A;  2YU5 A;  4IS1 C;  1UN6 B;  1BBO A;  2EML A;  2EMH A;  2EN1 A;  2EOR A;  2YTI A;  1A1K A;  1A1F A;  3UK3 C;  2WCC 3;  2LCE A;  2EOX A;  2PRT A;  2CT1 A;  1MEY C;  2EOS A;  1A1H A;  2EP3 A;  2VRD A;  2NAB A;  2YU8 A;  2EM2 A;  2EL4 A;  4R2R A;  4R2S A;  1B69 A;  2EPA A;  2EQ0 A;  2EN8 A;  1UBD C;  2GLI A;  2EJ4 A;  1KJK A;  4R2C A;  1NCS A;  2EPX A;  1P47 A;  2ENC A;  1X5W A;  2LO3 A;  4R2E A;  4IJD A;  5KL6 A;  1YUJ A;  4F2J C;  1AAY A;  1ZU1 A;  2DGC A;  2I13 A;  4F6N A;  2EPP A;  2EOF A;  2EPU A;  5KL7 A;  4R2P A;  2E72 A;  1TN9 A;  2EN4 A;  2ELZ A;  2EM0 A;  2R1F A;  2YSP A;  4FK5 C;  1YUI A;  2EMF A;  2YTN A;  2J7J A;  2EM7 A;  2EOY A;  5KL5 A;  2EOZ A;  3M99 B;  2YTO A;  3EPH A;  1RMD A;  1X3C A;  2YTD A;  2M9A A;  5KL3 A;  2ENA A;  2EOM A;  4R2Q A;  2YTP A;  4R2D A;  2MDG A;  2EMW A;  5KL2 A;  2HGH A;  2EMG A;  3EPJ A;  3MHS C;  2ENH A;  4WSG A;  2EM9 A;  2DLQ A;  1X6H A;  2ELY A;  2DRP A;  2EM3 A;  2YSO A;  5KL4 A;  2MKN A;  2YTF A;  1A1I A;  2D9H A;  2EN3 A;  2DLK A;  2EMC A;  2EOO A;  4R2A A;  4M9V C;  2YRH A;  2JP9 A;  2DMI A;  2EN2 A;  2EMY A;  4GZN C;  1JK1 A;  2EL6 A;  2LV2 A;  2WBU A;  2EMX A;  1Z1B A;  1LLM C;  2EM8 A;  2EE8 A;  2WBS A;  2EOJ A;  1BB8 A;  1A1L A;  1G2D C;  2JPA A;  2EOE A;  1DGC A;  2EM6 A;  2LVH A;  2EPZ A;  2BB8 A;  2GHF A;  1X6E A;  1A1J A;  2EOI A;  2RPC A;  2CSH A;  2CTD A;  2YTE A;  2EMI A;  2EOQ A;  2LT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...