1G2DC

Structure of a cys2his2 zinc finger/tata box complex (clone #2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGEKPFACDICGRKFATLHTRDRHTKIHLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3'
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC03
2EMWA 2EL4A 2LO3A 4M9VC 2D9HA 2EOMA 2LCEA 2MKDA 2EPZA 1ZR9A 2WBUA 2EMHA 2EOIA 2EPAA 2ENCA 2EN3A 2EN8A 2YTEA 4R2CA 2LVHA 2EM9A 1G2DC 3EPHA 1RMDA 2JP9A 1A1LA 2YTIA 1UN6B 2I13A 2ELZA 1NCSA 4R2DA 2EOEA 1A1HA 2YTFA 2DGCA 1A1GA 2ENHA 2WBSA 1JK1A 2EN6A 2R1FA 5KL4A 2LT7A 4F6MA 2EOJA 2RPCA 1BB8A 2MDGA 1AAYA 2EOXA 2YSPA 1TF6A 3EPJA 1YSAC 2EQ3A 2GHFA 2EM0A 1A1KA 2CT1A 1LLMC 2EMCA 3MHSC 4R2SA 1BBOA 2DMIA 2EM5A 2EPRA 3MHHC 2JPAA 1Z1BA 2CSHA 2EMZA 2J7JA 1X6HA 1KJKA 2EQ0A 1X3CA 1X6EA 2EL6A 2EORA 2EOOA 2EN2A 2YTJA 2EMKA 2YTOA 4FK5C 4R2EA 2M9AA 1TN9A 2EMFA 2EM6A 2YTDA 1ZU1A 2EM7A 2EMXA 2YTPA 1UBDC 1A1FA 2GLIA 1YUJA 1X6FA 4F6NA 2EOHA 5KL7A 1A1IA 2EMGA 1ZAAC 2YTGA 2EPUA 1G2FC 4R2QA 1P47A 2RSIA 2EP3A 4X9JA 2EMAA 1YUIA 2EOZA 4R2PA 2A25A 4R2AA 2ELYA 3EPKA 4WSGA 2YRMA 3EPLA 2DRPA 2EN7A 2YTQA 2HGHA 2E72A 3VHTB 2MKNA 2EMIA 2YRKA 4R2RA 1A1JA 1B69A 2EPCA 2EN4A 3M99B 2EL5A 2WCC3 2EE8A 2EM4A 5KL6A 1MEYC 2PRTA 4F2JC 2EN1A 2ADRA 2EOSA 1DGCA 4IS1C 5KL5A 1WJPA 2YRHA 2EM8A 2EOFA 1JK2A 2YU8A 4IJDA 2WBTA 1X5WA 2EMLA 2EOYA 2EQ1A 2YSOA 2EMYA 2YTNA 5KL3A 5KL2A 2NABA 3UK3C 2EMBA 2EM2A 2ENAA 1F2IG 2EOQA 2DLQA 2YU5A 2DLKA 2EPXA 2EJ4A 2LV2A 2VRDA 1TF3A 2BB8A 2EPPA 2CTDA 2EM3A 4GZNC
chains in the Genus database with same CATH superfamily
1AH5A 4DV0E 2BBGA 4M9VC 2D9HA 2EOMA 2LCEA 4Q28A 2HC5A 2MKDA 1ZR9A 2EOIA 2EPAA 2ENCA 2EN3A 4OOGC 4F9AB 1X48A 2N3HA 3BBGA 4WYQB 1UN6B 1T38A 3IWDA 4R2DA 2EOEA 5A2QC 3ADGA 3T1YE 5A6AA 1HNZE 2UXCE 3H09A 1JK1A 1HR0E 2EN6A 2FV4B 3F6GA 1X47A 2RPCA 2YSPA 1SFEA 1YSAC 1PKPA 4DV6E 2EPMX 2FGGA 2UUBE 1FKAE 4RH8A 2CT1A 1LLMC 4DR6E 3MHSC 1BBOA 3P1XA 4WXCA 1O0WA 2JPAA 1Z1BA 5ADZA 2VE7C 4DV5E 4GKJE 4L8NA 1X3CA 3VYXA 1I94E 3JU0A 4R8OA 4DMIA 2YTOA 4FK5C 2M9AA 4NZVA 4YHHE 1T4NA 4F6NA 4DUYE 2JWOA 2L3JA 1EH8A 4KWYA 2EPUA 4LFAE 2Q8UA 2RSIA 2EP3A 3DJWA 3HPSA 2EMAA 2LMZA 1YUIA 4X8WA 1YFHA 4BC7A 3T1HE 4WSGA 1L4SA 4JI8E 2YTQA 1J26A 5LMNE 4R2RA 1EH6A 4JI7E 3J80C 3VYYA 1B69A 3ADLA 2F8BA 3VK6A 4ZYDA 2EM4A 2YPNA 2EN1A 2E1MA 1SR9A 3KZZA 2EOSA 2V88A 4WX9A 4HEIA 5IWAE 1WJPA 4DR4E 1PDAA 1X5WA 1T39A 2EMYA 4X66E 5KL3A 4F9BB 3UK3C 2EM2A 4DV2E 2EOQA 4I8OA 2B7TA 4O4KA 4MLQA 2L92A 2EPLX 4WPYA 2BB8A 1GQEA 2YTPA 2CTDA 2EMWA 1J5EE 4KHPE 5AE3A 2L33A 4LF8E 2EN8A 2EM9A 1RMDA 2LTRA 4TUGA 2M7QA 4B3RE 3JTZA 1A1LA 4DR7E 2ELZA 2JVAA 2MDRA 5IV8B 2DGCA 2I9IA 1A1GA 4F9CB 2WBSA 2R1FA 5KL4A 4LF9E 1FJGE 2MDGA 2EOXA 3L00A 4WSPA 3OTOE 3KWRA 2L2MA 3EPJA 2EQ3A 2HJJA 2JR1A 2EM0A 1N36E 2EMCA 3EQ1A 4LFBE 2EM5A 1XMQE 2G7HA 3QG5C 5LLQA 2J7JA 4JI4E 2UUCE 1QNTA 1X6EA 2EOOA 2EN2A 4BHBA 4DV4E 2UXBE 2LTSA 1DQ3A 1WRJA 5TSEA 2EMFA 2EPNA 2EM7A 2UXDE 4O24A 2GLIA 1UBDC 1RQ0A 1GTKA 2R76A 2V8QB 3BGHA 2JOBA 1IMUA 1STUA 2YTGA 4HTGA 4DV3E 4NXNE 4BC9A 1G2FC 3IWCA 1P47A 3K6QA 5A6JA 4LTYA 1XNRE 1IQOA 4DR5E 4M30A 4BCAA 4R2AA 2L2KB 3EPKA 3EPLA 2V85A 4O43A 3VHTB 2MKNA 5A6KA 3IWBA 2EN4A 3M99B 1T4OA 2WCC3 4DR2E 2PRTA 4X65E 4F2JC 4DUZE 2ADRA 4AQYE 3HQ1A 1N33E 2V83A 4NXME 2LRSA 1HNXE 1IBKE 2YU8A 2EQ1A 2EOYA 3KZYA 2YTNA 3F6HA 1WHQA 5KL2A 2GPIA 4OX9E 2DLKA 1UILA 3C4TA 1ZBTA 4JYAE 2VRDA 1TF3A 1MEYC 2EM3A 4YY3E 4DR3E 2MC6A 1BBGA 4RHBB 2K4VA 2EPZA 4BHCA 2WBUA 4NHRA 4JI2E 2K7IA 4LU9A 5AE2A 1G2DC 3EPHA 3AV0A 5A6BD 2HHHE 2I13A 2LJHA 3RMPA 1NCSA 1A1HA 4B3SE 3LLHA 2ENHA 2N8XA 2LT7A 5IT9C 2EOJA 4LFCE 1BB8A 1N32E 3C6KA 4ZYGA 1TF6A 1QU6A 2FTXB 1YYWA 1XNQE 4JV5E 2JXPA 2M1SA 5BR8E 2B3TB 1XMOE 4F54A 4R2SA 2RQLA 2DMIA 4K0KE 2CSHA 2EMZA 4JI0E 1X6HA 4N4RB 2B7VA 2EQ0A 2DMYA 4BS9A 2EL6A 2EORA 2YTJA 1YZ9A 2EMKA 4O5GA 1PJTA 2L8TA 4R2EA 2KOUA 2EM6A 2YTDA 4P78A 1ZU1A 3THOB 2DSYA 1IBME 2EMXA 4LF6E 3ADIA 3THNA 2EOHA 1A1IA 2EMGA 4X64E 2KHXA 4L5NC 4R03A 4WXDA 1WXRA 4R2QA 4LF5E 3ADJA 5CFFE 2A25A 2ELYA 2YZTA 2CPNA 2YRMA 2DRPA 2KONA 2JY9A 2EMIA 3HXLA 2EWLA 1A1JA 2EPCA 1UHZA 2EE8A 2WZOA 5KL6A 2YWQA 3C4BA 3BF2A 4B3ME 1DGCA 2JYAA 1PJSA 2ZM6E 3DF6A 2RSMA 2NUFA 2EM8A 2EOFA 1JK2A 3HTXA 3LMLA 4IJDA 2LJUA 2EMLA 1EKZA 2NABA 4X62E 2EMBA 1YPNA 1F2IG 1X49A 2DLQA 2YU5A 4DV1E 2EPKX 2EJ4A 1KYQA 2H36X 5A6BA 2IHR1 3J81C 1YYKA 2EPPA 4JI5E 2LE2A 4DKKA 4GZNC 2EL4A 1MGTA 2LO3A 4JI6E 2VF1A 1YYOA 5F3WA 2EMHA 1PJQA 5IXMB 2LUQA 2YTEA 4R2CA 2LVHA 4BMJA 5AASA 1NEIA 2JP9A 4ZYEA 2V89A 2YTIA 2EZ6A 2N3GA 5A69A 2VQEE 2YTFA 3C6MA 3BIDA 5AC5A 2E5LE 4JI1E 2DIXA 4F6MA 2MC5A 2RS6A 5DNYA 1AAYA 4GKKE 4GEQB 5T6JA 3J7Yp 2B9DA 2V86A 2GHFA 4M2ZA 5LMUE 1A1KA 4TUIA 4M0VA 1IBLE 1HNWE 1RC7A 2EPRA 3MHHC 3FIGA 2L2NA 1KJKA 2LUPB 5LL6R 2ODRC 1IQSA 2NA2A 4BBYA 4P7DA 4WFTA 1TN9A 3J7AG 5AC4A 2L6MA 1GZ6A 1A1FA 1YUJA 1X6FA 2VQFE 5KL7A 2NUGA 4DR1E 1ZAAC 4J8ZA 2M4IA 2LBSB 3ECRA 3JAMC 1N34E 2ODRD 4X9JA 2EOZA 4R2PA 2DB2A 1N3GA 1EH7A 2EN7A 2HGHA 2E72A 4JI3E 2NUEA 2YRKA 4ZYHA 2EL5A 2UUAE 2RTXA 2F4VE 2UU9E 2V87A 1WHNA 2L3CA 4MLVA 4LF7E 3MSWA 2YT4A 3ZOQB 4IS1C 5KL5A 3AUZA 4B3TE 3HPZA 2EPOA 2YRHA 4Q35B 4DV7E 1T4LB 2WBTA 2YSOA 2JOXA 4LF4E 2ENAA 5FLXC 2EPXA 3TQMA 5AE1A 1DI2A 2LV2A 1ZBQA 4KZSA 2RS7A 3OMLA
chains in the Genus database with same CATH topology
2EMWA 2EL4A 2LO3A 4M9VC 2D9HA 2EOMA 2LCEA 2MKDA 2EPZA 1ZR9A 2WBUA 2EMHA 2EOIA 2EPAA 2ENCA 2EN3A 2EN8A 2YTEA 4R2CA 2LVHA 2EM9A 1G2DC 3EPHA 1RMDA 2JP9A 1A1LA 2YTIA 1UN6B 2I13A 2ELZA 1NCSA 4R2DA 2EOEA 1A1HA 2YTFA 2DGCA 1A1GA 2ENHA 2WBSA 1JK1A 2EN6A 2R1FA 5KL4A 2LT7A 4F6MA 2EOJA 2RPCA 1BB8A 2MDGA 1AAYA 2EOXA 2YSPA 1TF6A 3EPJA 1YSAC 2EQ3A 2GHFA 2EM0A 1A1KA 2CT1A 1LLMC 2EMCA 3MHSC 4R2SA 1BBOA 2DMIA 2EM5A 2EPRA 3MHHC 2JPAA 1Z1BA 2CSHA 2EMZA 2J7JA 1X6HA 1KJKA 2EQ0A 1X3CA 1X6EA 2EL6A 2EORA 2EOOA 2EN2A 2YTJA 2EMKA 2YTOA 4FK5C 4R2EA 2M9AA 1TN9A 2EMFA 2EM6A 2YTDA 1ZU1A 2EM7A 2EMXA 2YTPA 1UBDC 1A1FA 2GLIA 1YUJA 1X6FA 4F6NA 2EOHA 5KL7A 1A1IA 2EMGA 1ZAAC 2YTGA 2EPUA 1G2FC 4R2QA 1P47A 2RSIA 2EP3A 4X9JA 2EMAA 1YUIA 2EOZA 4R2PA 2A25A 4R2AA 2ELYA 3EPKA 4WSGA 2YRMA 3EPLA 2DRPA 2EN7A 2YTQA 2HGHA 2E72A 3VHTB 2MKNA 2EMIA 2YRKA 4R2RA 1A1JA 1B69A 2EPCA 2EN4A 3M99B 2EL5A 2WCC3 2EE8A 2EM4A 5KL6A 1MEYC 2PRTA 4F2JC 2EN1A 2ADRA 2EOSA 1DGCA 4IS1C 5KL5A 1WJPA 2YRHA 2EM8A 2EOFA 1JK2A 2YU8A 4IJDA 2WBTA 1X5WA 2EMLA 2EOYA 2EQ1A 2YSOA 2EMYA 2YTNA 5KL3A 5KL2A 2NABA 3UK3C 2EMBA 2EM2A 2ENAA 1F2IG 2EOQA 2DLQA 2YU5A 2DLKA 2EPXA 2EJ4A 2LV2A 2VRDA 1TF3A 2BB8A 2EPPA 2CTDA 2EM3A 4GZNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMW A;  2EL4 A;  2LO3 A;  4M9V C;  2D9H A;  2EOM A;  2LCE A;  2MKD A;  2EPZ A;  1ZR9 A;  2WBU A;  2EMH A;  2EOI A;  2EPA A;  2ENC A;  2EN3 A;  2EN8 A;  2YTE A;  4R2C A;  2LVH A;  2EM9 A;  1G2D C;  3EPH A;  1RMD A;  2JP9 A;  1A1L A;  2YTI A;  1UN6 B;  2I13 A;  2ELZ A;  1NCS A;  4R2D A;  2EOE A;  1A1H A;  2YTF A;  2DGC A;  1A1G A;  2ENH A;  2WBS A;  1JK1 A;  2EN6 A;  2R1F A;  5KL4 A;  2LT7 A;  4F6M A;  2EOJ A;  2RPC A;  1BB8 A;  2MDG A;  1AAY A;  2EOX A;  2YSP A;  1TF6 A;  3EPJ A;  1YSA C;  2EQ3 A;  2GHF A;  2EM0 A;  1A1K A;  2CT1 A;  1LLM C;  2EMC A;  3MHS C;  4R2S A;  1BBO A;  2DMI A;  2EM5 A;  2EPR A;  3MHH C;  2JPA A;  1Z1B A;  2CSH A;  2EMZ A;  2J7J A;  1X6H A;  1KJK A;  2EQ0 A;  1X3C A;  1X6E A;  2EL6 A;  2EOR A;  2EOO A;  2EN2 A;  2YTJ A;  2EMK A;  2YTO A;  4FK5 C;  4R2E A;  2M9A A;  1TN9 A;  2EMF A;  2EM6 A;  2YTD A;  1ZU1 A;  2EM7 A;  2EMX A;  2YTP A;  1UBD C;  1A1F A;  2GLI A;  1YUJ A;  1X6F A;  4F6N A;  2EOH A;  5KL7 A;  1A1I A;  2EMG A;  1ZAA C;  2YTG A;  2EPU A;  1G2F C;  4R2Q A;  1P47 A;  2RSI A;  2EP3 A;  4X9J A;  2EMA A;  1YUI A;  2EOZ A;  4R2P A;  2A25 A;  4R2A A;  2ELY A;  3EPK A;  4WSG A;  2YRM A;  3EPL A;  2DRP A;  2EN7 A;  2YTQ A;  2HGH A;  2E72 A;  3VHT B;  2MKN A;  2EMI A;  2YRK A;  4R2R A;  1A1J A;  1B69 A;  2EPC A;  2EN4 A;  3M99 B;  2EL5 A;  2WCC 3;  2EE8 A;  2EM4 A;  5KL6 A;  1MEY C;  2PRT A;  4F2J C;  2EN1 A;  2ADR A;  2EOS A;  1DGC A;  4IS1 C;  5KL5 A;  1WJP A;  2YRH A;  2EM8 A;  2EOF A;  1JK2 A;  2YU8 A;  4IJD A;  2WBT A;  1X5W A;  2EML A;  2EOY A;  2EQ1 A;  2YSO A;  2EMY A;  2YTN A;  5KL3 A;  5KL2 A;  2NAB A;  3UK3 C;  2EMB A;  2EM2 A;  2ENA A;  1F2I G;  2EOQ A;  2DLQ A;  2YU5 A;  2DLK A;  2EPX A;  2EJ4 A;  2LV2 A;  2VRD A;  1TF3 A;  2BB8 A;  2EPP A;  2CTD A;  2EM3 A;  4GZN C; 
#chains in the Genus database with same CATH topology
 1AH5 A;  4DV0 E;  2BBG A;  4M9V C;  2D9H A;  2EOM A;  2LCE A;  4Q28 A;  2HC5 A;  2MKD A;  1ZR9 A;  2EOI A;  2EPA A;  2ENC A;  2EN3 A;  4OOG C;  4F9A B;  1X48 A;  2N3H A;  3BBG A;  4WYQ B;  1UN6 B;  1T38 A;  3IWD A;  4R2D A;  2EOE A;  5A2Q C;  3ADG A;  3T1Y E;  5A6A A;  1HNZ E;  2UXC E;  3H09 A;  1JK1 A;  1HR0 E;  2EN6 A;  2FV4 B;  3F6G A;  1X47 A;  2RPC A;  2YSP A;  1SFE A;  1YSA C;  1PKP A;  4DV6 E;  2EPM X;  2FGG A;  2UUB E;  1FKA E;  4RH8 A;  2CT1 A;  1LLM C;  4DR6 E;  3MHS C;  1BBO A;  3P1X A;  4WXC A;  1O0W A;  2JPA A;  1Z1B A;  5ADZ A;  2VE7 C;  4DV5 E;  4GKJ E;  4L8N A;  1X3C A;  3VYX A;  1I94 E;  3JU0 A;  4R8O A;  4DMI A;  2YTO A;  4FK5 C;  2M9A A;  4NZV A;  4YHH E;  1T4N A;  4F6N A;  4DUY E;  2JWO A;  2L3J A;  1EH8 A;  4KWY A;  2EPU A;  4LFA E;  2Q8U A;  2RSI A;  2EP3 A;  3DJW A;  3HPS A;  2EMA A;  2LMZ A;  1YUI A;  4X8W A;  1YFH A;  4BC7 A;  3T1H E;  4WSG A;  1L4S A;  4JI8 E;  2YTQ A;  1J26 A;  5LMN E;  4R2R A;  1EH6 A;  4JI7 E;  3J80 C;  3VYY A;  1B69 A;  3ADL A;  2F8B A;  3VK6 A;  4ZYD A;  2EM4 A;  2YPN A;  2EN1 A;  2E1M A;  1SR9 A;  3KZZ A;  2EOS A;  2V88 A;  4WX9 A;  4HEI A;  5IWA E;  1WJP A;  4DR4 E;  1PDA A;  1X5W A;  1T39 A;  2EMY A;  4X66 E;  5KL3 A;  4F9B B;  3UK3 C;  2EM2 A;  4DV2 E;  2EOQ A;  4I8O A;  2B7T A;  4O4K A;  4MLQ A;  2L92 A;  2EPL X;  4WPY A;  2BB8 A;  1GQE A;  2YTP A;  2CTD A;  2EMW A;  1J5E E;  4KHP E;  5AE3 A;  2L33 A;  4LF8 E;  2EN8 A;  2EM9 A;  1RMD A;  2LTR A;  4TUG A;  2M7Q A;  4B3R E;  3JTZ A;  1A1L A;  4DR7 E;  2ELZ A;  2JVA A;  2MDR A;  5IV8 B;  2DGC A;  2I9I A;  1A1G A;  4F9C B;  2WBS A;  2R1F A;  5KL4 A;  4LF9 E;  1FJG E;  2MDG A;  2EOX A;  3L00 A;  4WSP A;  3OTO E;  3KWR A;  2L2M A;  3EPJ A;  2EQ3 A;  2HJJ A;  2JR1 A;  2EM0 A;  1N36 E;  2EMC A;  3EQ1 A;  4LFB E;  2EM5 A;  1XMQ E;  2G7H A;  3QG5 C;  5LLQ A;  2J7J A;  4JI4 E;  2UUC E;  1QNT A;  1X6E A;  2EOO A;  2EN2 A;  4BHB A;  4DV4 E;  2UXB E;  2LTS A;  1DQ3 A;  1WRJ A;  5TSE A;  2EMF A;  2EPN A;  2EM7 A;  2UXD E;  4O24 A;  2GLI A;  1UBD C;  1RQ0 A;  1GTK A;  2R76 A;  2V8Q B;  3BGH A;  2JOB A;  1IMU A;  1STU A;  2YTG A;  4HTG A;  4DV3 E;  4NXN E;  4BC9 A;  1G2F C;  3IWC A;  1P47 A;  3K6Q A;  5A6J A;  4LTY A;  1XNR E;  1IQO A;  4DR5 E;  4M30 A;  4BCA A;  4R2A A;  2L2K B;  3EPK A;  3EPL A;  2V85 A;  4O43 A;  3VHT B;  2MKN A;  5A6K A;  3IWB A;  2EN4 A;  3M99 B;  1T4O A;  2WCC 3;  4DR2 E;  2PRT A;  4X65 E;  4F2J C;  4DUZ E;  2ADR A;  4AQY E;  3HQ1 A;  1N33 E;  2V83 A;  4NXM E;  2LRS A;  1HNX E;  1IBK E;  2YU8 A;  2EQ1 A;  2EOY A;  3KZY A;  2YTN A;  3F6H A;  1WHQ A;  5KL2 A;  2GPI A;  4OX9 E;  2DLK A;  1UIL A;  3C4T A;  1ZBT A;  4JYA E;  2VRD A;  1TF3 A;  1MEY C;  2EM3 A;  4YY3 E;  4DR3 E;  2MC6 A;  1BBG A;  4RHB B;  2K4V A;  2EPZ A;  4BHC A;  2WBU A;  4NHR A;  4JI2 E;  2K7I A;  4LU9 A;  5AE2 A;  1G2D C;  3EPH A;  3AV0 A;  5A6B D;  2HHH E;  2I13 A;  2LJH A;  3RMP A;  1NCS A;  1A1H A;  4B3S E;  3LLH A;  2ENH A;  2N8X A;  2LT7 A;  5IT9 C;  2EOJ A;  4LFC E;  1BB8 A;  1N32 E;  3C6K A;  4ZYG A;  1TF6 A;  1QU6 A;  2FTX B;  1YYW A;  1XNQ E;  4JV5 E;  2JXP A;  2M1S A;  5BR8 E;  2B3T B;  1XMO E;  4F54 A;  4R2S A;  2RQL A;  2DMI A;  4K0K E;  2CSH A;  2EMZ A;  4JI0 E;  1X6H A;  4N4R B;  2B7V A;  2EQ0 A;  2DMY A;  4BS9 A;  2EL6 A;  2EOR A;  2YTJ A;  1YZ9 A;  2EMK A;  4O5G A;  1PJT A;  2L8T A;  4R2E A;  2KOU A;  2EM6 A;  2YTD A;  4P78 A;  1ZU1 A;  3THO B;  2DSY A;  1IBM E;  2EMX A;  4LF6 E;  3ADI A;  3THN A;  2EOH A;  1A1I A;  2EMG A;  4X64 E;  2KHX A;  4L5N C;  4R03 A;  4WXD A;  1WXR A;  4R2Q A;  4LF5 E;  3ADJ A;  5CFF E;  2A25 A;  2ELY A;  2YZT A;  2CPN A;  2YRM A;  2DRP A;  2KON A;  2JY9 A;  2EMI A;  3HXL A;  2EWL A;  1A1J A;  2EPC A;  1UHZ A;  2EE8 A;  2WZO A;  5KL6 A;  2YWQ A;  3C4B A;  3BF2 A;  4B3M E;  1DGC A;  2JYA A;  1PJS A;  2ZM6 E;  3DF6 A;  2RSM A;  2NUF A;  2EM8 A;  2EOF A;  1JK2 A;  3HTX A;  3LML A;  4IJD A;  2LJU A;  2EML A;  1EKZ A;  2NAB A;  4X62 E;  2EMB A;  1YPN A;  1F2I G;  1X49 A;  2DLQ A;  2YU5 A;  4DV1 E;  2EPK X;  2EJ4 A;  1KYQ A;  2H36 X;  5A6B A;  2IHR 1;  3J81 C;  1YYK A;  2EPP A;  4JI5 E;  2LE2 A;  4DKK A;  4GZN C;  2EL4 A;  1MGT A;  2LO3 A;  4JI6 E;  2VF1 A;  1YYO A;  5F3W A;  2EMH A;  1PJQ A;  5IXM B;  2LUQ A;  2YTE A;  4R2C A;  2LVH A;  4BMJ A;  5AAS A;  1NEI A;  2JP9 A;  4ZYE A;  2V89 A;  2YTI A;  2EZ6 A;  2N3G A;  5A69 A;  2VQE E;  2YTF A;  3C6M A;  3BID A;  5AC5 A;  2E5L E;  4JI1 E;  2DIX A;  4F6M A;  2MC5 A;  2RS6 A;  5DNY A;  1AAY A;  4GKK E;  4GEQ B;  5T6J A;  3J7Y p;  2B9D A;  2V86 A;  2GHF A;  4M2Z A;  5LMU E;  1A1K A;  4TUI A;  4M0V A;  1IBL E;  1HNW E;  1RC7 A;  2EPR A;  3MHH C;  3FIG A;  2L2N A;  1KJK A;  2LUP B;  5LL6 R;  2ODR C;  1IQS A;  2NA2 A;  4BBY A;  4P7D A;  4WFT A;  1TN9 A;  3J7A G;  5AC4 A;  2L6M A;  1GZ6 A;  1A1F A;  1YUJ A;  1X6F A;  2VQF E;  5KL7 A;  2NUG A;  4DR1 E;  1ZAA C;  4J8Z A;  2M4I A;  2LBS B;  3ECR A;  3JAM C;  1N34 E;  2ODR D;  4X9J A;  2EOZ A;  4R2P A;  2DB2 A;  1N3G A;  1EH7 A;  2EN7 A;  2HGH A;  2E72 A;  4JI3 E;  2NUE A;  2YRK A;  4ZYH A;  2EL5 A;  2UUA E;  2RTX A;  2F4V E;  2UU9 E;  2V87 A;  1WHN A;  2L3C A;  4MLV A;  4LF7 E;  3MSW A;  2YT4 A;  3ZOQ B;  4IS1 C;  5KL5 A;  3AUZ A;  4B3T E;  3HPZ A;  2EPO A;  2YRH A;  4Q35 B;  4DV7 E;  1T4L B;  2WBT A;  2YSO A;  2JOX A;  4LF4 E;  2ENA A;  5FLX C;  2EPX A;  3TQM A;  5AE1 A;  1DI2 A;  2LV2 A;  1ZBQ A;  4KZS A;  2RS7 A;  3OML A; 
#chains in the Genus database with same CATH homology
 2EMW A;  2EL4 A;  2LO3 A;  4M9V C;  2D9H A;  2EOM A;  2LCE A;  2MKD A;  2EPZ A;  1ZR9 A;  2WBU A;  2EMH A;  2EOI A;  2EPA A;  2ENC A;  2EN3 A;  2EN8 A;  2YTE A;  4R2C A;  2LVH A;  2EM9 A;  1G2D C;  3EPH A;  1RMD A;  2JP9 A;  1A1L A;  2YTI A;  1UN6 B;  2I13 A;  2ELZ A;  1NCS A;  4R2D A;  2EOE A;  1A1H A;  2YTF A;  2DGC A;  1A1G A;  2ENH A;  2WBS A;  1JK1 A;  2EN6 A;  2R1F A;  5KL4 A;  2LT7 A;  4F6M A;  2EOJ A;  2RPC A;  1BB8 A;  2MDG A;  1AAY A;  2EOX A;  2YSP A;  1TF6 A;  3EPJ A;  1YSA C;  2EQ3 A;  2GHF A;  2EM0 A;  1A1K A;  2CT1 A;  1LLM C;  2EMC A;  3MHS C;  4R2S A;  1BBO A;  2DMI A;  2EM5 A;  2EPR A;  3MHH C;  2JPA A;  1Z1B A;  2CSH A;  2EMZ A;  2J7J A;  1X6H A;  1KJK A;  2EQ0 A;  1X3C A;  1X6E A;  2EL6 A;  2EOR A;  2EOO A;  2EN2 A;  2YTJ A;  2EMK A;  2YTO A;  4FK5 C;  4R2E A;  2M9A A;  1TN9 A;  2EMF A;  2EM6 A;  2YTD A;  1ZU1 A;  2EM7 A;  2EMX A;  2YTP A;  1UBD C;  1A1F A;  2GLI A;  1YUJ A;  1X6F A;  4F6N A;  2EOH A;  5KL7 A;  1A1I A;  2EMG A;  1ZAA C;  2YTG A;  2EPU A;  1G2F C;  4R2Q A;  1P47 A;  2RSI A;  2EP3 A;  4X9J A;  2EMA A;  1YUI A;  2EOZ A;  4R2P A;  2A25 A;  4R2A A;  2ELY A;  3EPK A;  4WSG A;  2YRM A;  3EPL A;  2DRP A;  2EN7 A;  2YTQ A;  2HGH A;  2E72 A;  3VHT B;  2MKN A;  2EMI A;  2YRK A;  4R2R A;  1A1J A;  1B69 A;  2EPC A;  2EN4 A;  3M99 B;  2EL5 A;  2WCC 3;  2EE8 A;  2EM4 A;  5KL6 A;  1MEY C;  2PRT A;  4F2J C;  2EN1 A;  2ADR A;  2EOS A;  1DGC A;  4IS1 C;  5KL5 A;  1WJP A;  2YRH A;  2EM8 A;  2EOF A;  1JK2 A;  2YU8 A;  4IJD A;  2WBT A;  1X5W A;  2EML A;  2EOY A;  2EQ1 A;  2YSO A;  2EMY A;  2YTN A;  5KL3 A;  5KL2 A;  2NAB A;  3UK3 C;  2EMB A;  2EM2 A;  2ENA A;  1F2I G;  2EOQ A;  2DLQ A;  2YU5 A;  2DLK A;  2EPX A;  2EJ4 A;  2LV2 A;  2VRD A;  1TF3 A;  2BB8 A;  2EPP A;  2CTD A;  2EM3 A;  4GZN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...