1G2DC

Structure of a cys2his2 zinc finger/tata box complex (clone #2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGEKPFACDICGRKFATLHTRDRHTKIHLRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3'
publication title Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC03
1Z1BA 2GHFA 2EM7A 2EMGA 2RSIA 4F6NA 2EMZA 2WBUA 4X9JA 3EPJA 4F2JC 2BB8A 4R2CA 2E72A 4WSGA 2EPAA 2EOHA 2R1FA 1UN6B 1AAYA 2LV2A 2EPUA 4GZNC 2EOEA 1TF6A 2I13A 2YSOA 2EP3A 2CTDA 2LO3A 2LT7A 2WBTA 2EMWA 1B69A 2JPAA 1X3CA 3M99B 2ENAA 4R2SA 1TF3A 1BBOA 2MKDA 2DMIA 2EL4A 2EOYA 2WCC3 4R2QA 1X6EA 2EOQA 2ADRA 2EMKA 4R2EA 1DGCA 4IS1C 4R2RA 2YSPA 2ENCA 2A25A 1X5WA 1LLMC 3UK3C 1NCSA 2EMXA 2EMYA 2EMLA 2EPXA 1RMDA 2YRKA 2PRTA 4F6MA 2EOFA 2RPCA 3EPHA 2M9AA 2EMFA 2GLIA 2EQ1A 2ELZA 2EN6A 2WBSA 2EMCA 1JK2A 2EOSA 2EN1A 2VRDA 2EN8A 1A1LA 2EM2A 4M9VC 3VHTB 2CSHA 2EN7A 2YTQA 2J7JA 1TN9A 2EQ0A 1A1HA 2EORA 3MHHC 1BB8A 2EMBA 2EPCA 2NABA 2CT1A 1ZR9A 2EOIA 1KJKA 5KL2A 2YTEA 1X6HA 1P47A 2EM8A 1JK1A 2EJ4A 2MDGA 1MEYC 1YUJA 2DRPA 2EN3A 2YTFA 4R2AA 2EOOA 1YSAC 1A1FA 2EN4A 1G2DC 1ZU1A 2YTOA 2EMHA 2LVHA 1WJPA 2EMIA 5KL4A 2EM6A 2YTGA 2YTJA 2HGHA 1G2FC 2YTIA 2ELYA 2YTPA 1A1IA 2EQ3A 2DLQA 4R2DA 1ZAAC 2YU5A 2YU8A 2DLKA 2EM4A 2EL6A 5KL6A 2YRMA 5KL7A 5KL3A 3EPLA 2EOXA 2JP9A 2MKNA 1F2IG 5KL5A 2EM0A 2EPRA 2YTDA 4R2PA 2EM5A 2YTNA 2LCEA 2EMAA 1UBDC 2EOZA 4IJDA 1A1KA 3EPKA 2EM9A 2EM3A 3MHSC 2EN2A 4FK5C 2DGCA 1X6FA 2EPZA 2D9HA 2EOMA 2ENHA 2EE8A 2YRHA 1A1JA 1A1GA 2EPPA 2EL5A 1YUIA 2EOJA
chains in the Genus database with same CATH superfamily
2VF1A 4JI3E 4F6NA 5AASA 3OMLA 2DMYA 1XNRE 2DSYA 2RS6A 4F2JC 4DUYE 4R2CA 2E72A 2JWOA 4WSGA 2E5LE 2YWQA 2EPAA 2MC5A 1UN6B 1MGTA 1AAYA 4BC9A 4JI1E 5LLQA 2WBTA 3ADJA 2MDRA 1B69A 5A6AA 2ENAA 5IWAE 2E1MA 1SR9A 2MKDA 2YZTA 3EQ1A 2N3GA 4R2QA 4R2EA 4JI5E 4IS1C 4R2RA 2YSPA 1X5WA 2V83A 4DV0E 2V85A 3ECRA 2UXCE 4LU9A 1WHNA 4R03A 5A69A 3C6MA 4ZYDA 2PRTA 5TSEA 5LMUE 4JV5E 2RPCA 2KOUA 2EMFA 4LF8E 4J8ZA 2ELZA 2UUCE 2MC6A 2RTXA 3DJWA 3KZYA 1JK2A 2EN1A 3DF6A 2JYAA 3VK6A 3ZOQB 2EM2A 2CSHA 4ZYGA 2YTQA 2J7JA 1HNXE 4BHBA 1BB8A 5ADZA 4F9CB 1BBGA 3C6KA 2NUGA 4DR6E 4O43A 3KWRA 1HNZE 1P47A 3THOB 1JK1A 4WFTA 3BIDA 1MEYC 2EN3A 2JVAA 3C4BA 1N3GA 4R2AA 3VYXA 1PJTA 2K4VA 4DR5E 2EN4A 2LUQA 5A6BD 1GTKA 2G7HA 2L3CA 2EWLA 2IHR1 4JI6E 2VQEE 4DR3E 5AE2A 1SFEA 2YTIA 1G2FC 1A1IA 2DLQA 4I8OA 2YU8A 2EL6A 2YRMA 1WXRA 2EZ6A 2YTDA 4N4RB 4R2PA 2EM5A 2YTNA 1YZ9A 4ZYHA 4K0KE 2EOZA 4JI8E 2L33A 3L00A 4X8WA 2EM3A 2LJUA 4NXME 1UHZA 5IT9C 1HNWE 4M2ZA 4BCAA 2V86A 3AV0A 2LE2A 2EL5A 1YUIA 2EOJA 4DV7E 3JTZA 2EMGA 2YPNA 2L6MA 2L3JA 4LF9E 4LF7E 2Q8UA 4DV2E 3IWBA 2ODRC 2R1FA 4Q35B 1IMUA 2LTRA 4GZNC 1PDAA 1TF6A 1EH8A 2YSOA 2B9DA 4JI2E 1TF3A 1STUA 1QNTA 1BBOA 2ODRD 4RH8A 2EOYA 2NUEA 1X6EA 2ADRA 2EMKA 4LFCE 4YY3E 3BF2A 1LLMC 4O4KA 4B3ME 2KHXA 2EMLA 3ADGA 2HJJA 1RMDA 4F6MA 4DR1E 2UUAE 2GLIA 4ZYEA 2EQ1A 3ADIA 2BBGA 1ZBQA 3VHTB 5BR8E 5FLXC 1TN9A 1PJSA 3MHHC 4DKKA 2NABA 4NXNE 2F4VE 2JXPA 3RMPA 2JOBA 5A6KA 4O5GA 4HEIA 2L2NA 4OOGC 2YTFA 4F54A 4AQYE 4WSPA 1X49A 2EOOA 1YSAC 1A1FA 4R8OA 2B7TA 4MLQA 3C4TA 4Q28A 1IQSA 2EM6A 2YTJA 1IQOA 3J80C 3MSWA 2JOXA 2YTPA 4R2DA 2LJHA 1ZAAC 2DLKA 2EM4A 4JI4E 2CPNA 3EPLA 5KL3A 2JP9A 1X47A 1XNQE 4KZSA 2EPRA 2LTSA 4BHCA 2EMAA 1EKZA 4WX9A 4JYAE 1A1KA 4F9AB 2EM9A 4LTYA 1XMQE 2LUPB 3QG5C 5LMNE 3HXLA 1IBLE 5AE3A 5A6JA 4LF6E 2DGCA 2D9HA 2ENHA 2EE8A 4B3SE 3K6QA 2RSIA 2EM7A 2NA2A 4X9JA 3EPJA 1T4NA 1WHQA 2EOHA 3THNA 2EPUA 2EOEA 1FKAE 2LO3A 2M1SA 5A6BA 2LT7A 1IBME 2HHHE 2EMWA 1YYWA 1X3CA 3M99B 4R2SA 2VQFE 4GKJE 4BBYA 2DMIA 2EL4A 4WYQB 4O24A 3HPZA 2F8BA 2ENCA 2JY9A 2YT4A 3LLHA 4GEQB 1T39A 5IV8B 4BS9A 1NCSA 1N32E 5CFFE 2HC5A 1GQEA 2R76A 4X64E 2EMYA 2EPXA 4YHHE 2YRKA 3EPHA 2EOFA 2I9IA 2M9AA 1T4LB 1QU6A 2K7IA 4KWYA 3HQ1A 4BMJA 4DV1E 1FJGE 2EMCA 2EOSA 1NEIA 2VRDA 2EN8A 4LFAE 2EN7A 4DMIA 2UUBE 4WPYA 2LRSA 2LBSB 2EOIA 5KL2A 2YTEA 4P78A 2EJ4A 3LMLA 2MDGA 2DRPA 1O0WA 4DR7E 1YFHA 3T1YE 1RC7A 2N8XA 4DV5E 2RQLA 3AUZA 1G2DC 3P1XA 5LL6R 2V87A 4F9BB 2YTOA 2EMHA 2LVHA 4DV3E 4MLVA 1XMOE 2YTGA 4X65E 2HGHA 1YPNA 2M7QA 4B3TE 2EQ3A 2YU5A 3F6GA 5A2QC 5KL6A 5KL7A 2FV4B 2MKNA 1F2IG 3FIGA 2B3TB 1DI2A 2M4IA 4L8NA 4KHPE 4X66E 4IJDA 2DB2A 4WXCA 1YYOA 1RQ0A 4DV4E 4LF4E 4M0VA 4HTGA 2GPIA 4FK5C 1X6FA 2EPZA 2VE7C 2EOMA 2LMZA 1KYQA 2YRHA 4WXDA 4JI7E 1A1JA 3J7Yp 2FTXB 1EH7A 2EM8A 1Z1BA 1N33E 1AH5A 2GHFA 1DQ3A 2EMZA 2L2KB 2WBUA 4LF5E 2BB8A 3J7AG 4M30A 2LV2A 4DUZE 2I13A 2EP3A 2CTDA 2EPKX 4NHRA 4DV6E 2JPAA 1EH6A 3OTOE 3JAMC 3JU0A 5T6JA 4X62E 2WCC3 2EOQA 2V89A 1DGCA 4DR2E 4L5NC 2UU9E 2A25A 3UK3C 5AE1A 1YYKA 3ADLA 2UXBE 2ZM6E 2EMXA 3IWCA 1GZ6A 3BGHA 2RSMA 5AC4A 3BBGA 3J81C 4JI0E 4TUGA 2UXDE 2EPMX 2V88A 2FGGA 4B3RE 5DNYA 2EN6A 2WZOA 1UILA 2WBSA 3F6HA 1A1LA 1PJQA 4M9VC 4OX9E 1IBKE 1T38A 2EQ0A 1A1HA 2EORA 4GKKE 2B7VA 2EMBA 2EPCA 4NZVA 2CT1A 1ZR9A 2EPNA 1KJKA 1X48A 1L4SA 1X6HA 2DIXA 2V8QB 1ZBTA 1N34E 1T4OA 5IXMB 2L2MA 4BC7A 3HPSA 1YUJA 1WRJA 4TUIA 2N3HA 2KONA 3VYYA 2L8TA 4RHBB 1ZU1A 4DR4E 1WJPA 2EMIA 5KL4A 5F3WA 2H36X 3IWDA 1HR0E 1PKPA 2ELYA 4P7DA 2NUFA 3KZZA 2EOXA 3TQMA 2JR1A 2L92A 5KL5A 2EM0A 5AC5A 1J5EE 3HTXA 3H09A 2LCEA 1UBDC 1I94E 2RS7A 4LFBE 3EPKA 1J26A 1N36E 3MHSC 2EPLX 2EN2A 1A1GA 2EPPA 3T1HE 2EPOA
chains in the Genus database with same CATH topology
1Z1BA 2GHFA 2EM7A 2EMGA 2RSIA 4F6NA 2EMZA 2WBUA 4X9JA 3EPJA 4F2JC 2BB8A 4R2CA 2E72A 4WSGA 2EPAA 2EOHA 2R1FA 1UN6B 1AAYA 2LV2A 2EPUA 4GZNC 2EOEA 1TF6A 2I13A 2YSOA 2EP3A 2CTDA 2LO3A 2LT7A 2WBTA 2EMWA 1B69A 2JPAA 1X3CA 3M99B 2ENAA 4R2SA 1TF3A 1BBOA 2MKDA 2DMIA 2EL4A 2EOYA 2WCC3 4R2QA 1X6EA 2EOQA 2ADRA 2EMKA 4R2EA 1DGCA 4IS1C 4R2RA 2YSPA 2ENCA 2A25A 1X5WA 1LLMC 3UK3C 1NCSA 2EMXA 2EMYA 2EMLA 2EPXA 1RMDA 2YRKA 2PRTA 4F6MA 2EOFA 2RPCA 3EPHA 2M9AA 2EMFA 2GLIA 2EQ1A 2ELZA 2EN6A 2WBSA 2EMCA 1JK2A 2EOSA 2EN1A 2VRDA 2EN8A 1A1LA 2EM2A 4M9VC 3VHTB 2CSHA 2EN7A 2YTQA 2J7JA 1TN9A 2EQ0A 1A1HA 2EORA 3MHHC 1BB8A 2EMBA 2EPCA 2NABA 2CT1A 1ZR9A 2EOIA 1KJKA 5KL2A 2YTEA 1X6HA 1P47A 2EM8A 1JK1A 2EJ4A 2MDGA 1MEYC 1YUJA 2DRPA 2EN3A 2YTFA 4R2AA 2EOOA 1YSAC 1A1FA 2EN4A 1G2DC 1ZU1A 2YTOA 2EMHA 2LVHA 1WJPA 2EMIA 5KL4A 2EM6A 2YTGA 2YTJA 2HGHA 1G2FC 2YTIA 2ELYA 2YTPA 1A1IA 2EQ3A 2DLQA 4R2DA 1ZAAC 2YU5A 2YU8A 2DLKA 2EM4A 2EL6A 5KL6A 2YRMA 5KL7A 5KL3A 3EPLA 2EOXA 2JP9A 2MKNA 1F2IG 5KL5A 2EM0A 2EPRA 2YTDA 4R2PA 2EM5A 2YTNA 2LCEA 2EMAA 1UBDC 2EOZA 4IJDA 1A1KA 3EPKA 2EM9A 2EM3A 3MHSC 2EN2A 4FK5C 2DGCA 1X6FA 2EPZA 2D9HA 2EOMA 2ENHA 2EE8A 2YRHA 1A1JA 1A1GA 2EPPA 2EL5A 1YUIA 2EOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  2GHF A;  2EM7 A;  2EMG A;  2RSI A;  4F6N A;  2EMZ A;  2WBU A;  4X9J A;  3EPJ A;  4F2J C;  2BB8 A;  4R2C A;  2E72 A;  4WSG A;  2EPA A;  2EOH A;  2R1F A;  1UN6 B;  1AAY A;  2LV2 A;  2EPU A;  4GZN C;  2EOE A;  1TF6 A;  2I13 A;  2YSO A;  2EP3 A;  2CTD A;  2LO3 A;  2LT7 A;  2WBT A;  2EMW A;  1B69 A;  2JPA A;  1X3C A;  3M99 B;  2ENA A;  4R2S A;  1TF3 A;  1BBO A;  2MKD A;  2DMI A;  2EL4 A;  2EOY A;  2WCC 3;  4R2Q A;  1X6E A;  2EOQ A;  2ADR A;  2EMK A;  4R2E A;  1DGC A;  4IS1 C;  4R2R A;  2YSP A;  2ENC A;  2A25 A;  1X5W A;  1LLM C;  3UK3 C;  1NCS A;  2EMX A;  2EMY A;  2EML A;  2EPX A;  1RMD A;  2YRK A;  2PRT A;  4F6M A;  2EOF A;  2RPC A;  3EPH A;  2M9A A;  2EMF A;  2GLI A;  2EQ1 A;  2ELZ A;  2EN6 A;  2WBS A;  2EMC A;  1JK2 A;  2EOS A;  2EN1 A;  2VRD A;  2EN8 A;  1A1L A;  2EM2 A;  4M9V C;  3VHT B;  2CSH A;  2EN7 A;  2YTQ A;  2J7J A;  1TN9 A;  2EQ0 A;  1A1H A;  2EOR A;  3MHH C;  1BB8 A;  2EMB A;  2EPC A;  2NAB A;  2CT1 A;  1ZR9 A;  2EOI A;  1KJK A;  5KL2 A;  2YTE A;  1X6H A;  1P47 A;  2EM8 A;  1JK1 A;  2EJ4 A;  2MDG A;  1MEY C;  1YUJ A;  2DRP A;  2EN3 A;  2YTF A;  4R2A A;  2EOO A;  1YSA C;  1A1F A;  2EN4 A;  1G2D C;  1ZU1 A;  2YTO A;  2EMH A;  2LVH A;  1WJP A;  2EMI A;  5KL4 A;  2EM6 A;  2YTG A;  2YTJ A;  2HGH A;  1G2F C;  2YTI A;  2ELY A;  2YTP A;  1A1I A;  2EQ3 A;  2DLQ A;  4R2D A;  1ZAA C;  2YU5 A;  2YU8 A;  2DLK A;  2EM4 A;  2EL6 A;  5KL6 A;  2YRM A;  5KL7 A;  5KL3 A;  3EPL A;  2EOX A;  2JP9 A;  2MKN A;  1F2I G;  5KL5 A;  2EM0 A;  2EPR A;  2YTD A;  4R2P A;  2EM5 A;  2YTN A;  2LCE A;  2EMA A;  1UBD C;  2EOZ A;  4IJD A;  1A1K A;  3EPK A;  2EM9 A;  2EM3 A;  3MHS C;  2EN2 A;  4FK5 C;  2DGC A;  1X6F A;  2EPZ A;  2D9H A;  2EOM A;  2ENH A;  2EE8 A;  2YRH A;  1A1J A;  1A1G A;  2EPP A;  2EL5 A;  1YUI A;  2EOJ A; 
#chains in the Genus database with same CATH topology
 2VF1 A;  4JI3 E;  4F6N A;  5AAS A;  3OML A;  2DMY A;  1XNR E;  2DSY A;  2RS6 A;  4F2J C;  4DUY E;  4R2C A;  2E72 A;  2JWO A;  4WSG A;  2E5L E;  2YWQ A;  2EPA A;  2MC5 A;  1UN6 B;  1MGT A;  1AAY A;  4BC9 A;  4JI1 E;  5LLQ A;  2WBT A;  3ADJ A;  2MDR A;  1B69 A;  5A6A A;  2ENA A;  5IWA E;  2E1M A;  1SR9 A;  2MKD A;  2YZT A;  3EQ1 A;  2N3G A;  4R2Q A;  4R2E A;  4JI5 E;  4IS1 C;  4R2R A;  2YSP A;  1X5W A;  2V83 A;  4DV0 E;  2V85 A;  3ECR A;  2UXC E;  4LU9 A;  1WHN A;  4R03 A;  5A69 A;  3C6M A;  4ZYD A;  2PRT A;  5TSE A;  5LMU E;  4JV5 E;  2RPC A;  2KOU A;  2EMF A;  4LF8 E;  4J8Z A;  2ELZ A;  2UUC E;  2MC6 A;  2RTX A;  3DJW A;  3KZY A;  1JK2 A;  2EN1 A;  3DF6 A;  2JYA A;  3VK6 A;  3ZOQ B;  2EM2 A;  2CSH A;  4ZYG A;  2YTQ A;  2J7J A;  1HNX E;  4BHB A;  1BB8 A;  5ADZ A;  4F9C B;  1BBG A;  3C6K A;  2NUG A;  4DR6 E;  4O43 A;  3KWR A;  1HNZ E;  1P47 A;  3THO B;  1JK1 A;  4WFT A;  3BID A;  1MEY C;  2EN3 A;  2JVA A;  3C4B A;  1N3G A;  4R2A A;  3VYX A;  1PJT A;  2K4V A;  4DR5 E;  2EN4 A;  2LUQ A;  5A6B D;  1GTK A;  2G7H A;  2L3C A;  2EWL A;  2IHR 1;  4JI6 E;  2VQE E;  4DR3 E;  5AE2 A;  1SFE A;  2YTI A;  1G2F C;  1A1I A;  2DLQ A;  4I8O A;  2YU8 A;  2EL6 A;  2YRM A;  1WXR A;  2EZ6 A;  2YTD A;  4N4R B;  4R2P A;  2EM5 A;  2YTN A;  1YZ9 A;  4ZYH A;  4K0K E;  2EOZ A;  4JI8 E;  2L33 A;  3L00 A;  4X8W A;  2EM3 A;  2LJU A;  4NXM E;  1UHZ A;  5IT9 C;  1HNW E;  4M2Z A;  4BCA A;  2V86 A;  3AV0 A;  2LE2 A;  2EL5 A;  1YUI A;  2EOJ A;  4DV7 E;  3JTZ A;  2EMG A;  2YPN A;  2L6M A;  2L3J A;  4LF9 E;  4LF7 E;  2Q8U A;  4DV2 E;  3IWB A;  2ODR C;  2R1F A;  4Q35 B;  1IMU A;  2LTR A;  4GZN C;  1PDA A;  1TF6 A;  1EH8 A;  2YSO A;  2B9D A;  4JI2 E;  1TF3 A;  1STU A;  1QNT A;  1BBO A;  2ODR D;  4RH8 A;  2EOY A;  2NUE A;  1X6E A;  2ADR A;  2EMK A;  4LFC E;  4YY3 E;  3BF2 A;  1LLM C;  4O4K A;  4B3M E;  2KHX A;  2EML A;  3ADG A;  2HJJ A;  1RMD A;  4F6M A;  4DR1 E;  2UUA E;  2GLI A;  4ZYE A;  2EQ1 A;  3ADI A;  2BBG A;  1ZBQ A;  3VHT B;  5BR8 E;  5FLX C;  1TN9 A;  1PJS A;  3MHH C;  4DKK A;  2NAB A;  4NXN E;  2F4V E;  2JXP A;  3RMP A;  2JOB A;  5A6K A;  4O5G A;  4HEI A;  2L2N A;  4OOG C;  2YTF A;  4F54 A;  4AQY E;  4WSP A;  1X49 A;  2EOO A;  1YSA C;  1A1F A;  4R8O A;  2B7T A;  4MLQ A;  3C4T A;  4Q28 A;  1IQS A;  2EM6 A;  2YTJ A;  1IQO A;  3J80 C;  3MSW A;  2JOX A;  2YTP A;  4R2D A;  2LJH A;  1ZAA C;  2DLK A;  2EM4 A;  4JI4 E;  2CPN A;  3EPL A;  5KL3 A;  2JP9 A;  1X47 A;  1XNQ E;  4KZS A;  2EPR A;  2LTS A;  4BHC A;  2EMA A;  1EKZ A;  4WX9 A;  4JYA E;  1A1K A;  4F9A B;  2EM9 A;  4LTY A;  1XMQ E;  2LUP B;  3QG5 C;  5LMN E;  3HXL A;  1IBL E;  5AE3 A;  5A6J A;  4LF6 E;  2DGC A;  2D9H A;  2ENH A;  2EE8 A;  4B3S E;  3K6Q A;  2RSI A;  2EM7 A;  2NA2 A;  4X9J A;  3EPJ A;  1T4N A;  1WHQ A;  2EOH A;  3THN A;  2EPU A;  2EOE A;  1FKA E;  2LO3 A;  2M1S A;  5A6B A;  2LT7 A;  1IBM E;  2HHH E;  2EMW A;  1YYW A;  1X3C A;  3M99 B;  4R2S A;  2VQF E;  4GKJ E;  4BBY A;  2DMI A;  2EL4 A;  4WYQ B;  4O24 A;  3HPZ A;  2F8B A;  2ENC A;  2JY9 A;  2YT4 A;  3LLH A;  4GEQ B;  1T39 A;  5IV8 B;  4BS9 A;  1NCS A;  1N32 E;  5CFF E;  2HC5 A;  1GQE A;  2R76 A;  4X64 E;  2EMY A;  2EPX A;  4YHH E;  2YRK A;  3EPH A;  2EOF A;  2I9I A;  2M9A A;  1T4L B;  1QU6 A;  2K7I A;  4KWY A;  3HQ1 A;  4BMJ A;  4DV1 E;  1FJG E;  2EMC A;  2EOS A;  1NEI A;  2VRD A;  2EN8 A;  4LFA E;  2EN7 A;  4DMI A;  2UUB E;  4WPY A;  2LRS A;  2LBS B;  2EOI A;  5KL2 A;  2YTE A;  4P78 A;  2EJ4 A;  3LML A;  2MDG A;  2DRP A;  1O0W A;  4DR7 E;  1YFH A;  3T1Y E;  1RC7 A;  2N8X A;  4DV5 E;  2RQL A;  3AUZ A;  1G2D C;  3P1X A;  5LL6 R;  2V87 A;  4F9B B;  2YTO A;  2EMH A;  2LVH A;  4DV3 E;  4MLV A;  1XMO E;  2YTG A;  4X65 E;  2HGH A;  1YPN A;  2M7Q A;  4B3T E;  2EQ3 A;  2YU5 A;  3F6G A;  5A2Q C;  5KL6 A;  5KL7 A;  2FV4 B;  2MKN A;  1F2I G;  3FIG A;  2B3T B;  1DI2 A;  2M4I A;  4L8N A;  4KHP E;  4X66 E;  4IJD A;  2DB2 A;  4WXC A;  1YYO A;  1RQ0 A;  4DV4 E;  4LF4 E;  4M0V A;  4HTG A;  2GPI A;  4FK5 C;  1X6F A;  2EPZ A;  2VE7 C;  2EOM A;  2LMZ A;  1KYQ A;  2YRH A;  4WXD A;  4JI7 E;  1A1J A;  3J7Y p;  2FTX B;  1EH7 A;  2EM8 A;  1Z1B A;  1N33 E;  1AH5 A;  2GHF A;  1DQ3 A;  2EMZ A;  2L2K B;  2WBU A;  4LF5 E;  2BB8 A;  3J7A G;  4M30 A;  2LV2 A;  4DUZ E;  2I13 A;  2EP3 A;  2CTD A;  2EPK X;  4NHR A;  4DV6 E;  2JPA A;  1EH6 A;  3OTO E;  3JAM C;  3JU0 A;  5T6J A;  4X62 E;  2WCC 3;  2EOQ A;  2V89 A;  1DGC A;  4DR2 E;  4L5N C;  2UU9 E;  2A25 A;  3UK3 C;  5AE1 A;  1YYK A;  3ADL A;  2UXB E;  2ZM6 E;  2EMX A;  3IWC A;  1GZ6 A;  3BGH A;  2RSM A;  5AC4 A;  3BBG A;  3J81 C;  4JI0 E;  4TUG A;  2UXD E;  2EPM X;  2V88 A;  2FGG A;  4B3R E;  5DNY A;  2EN6 A;  2WZO A;  1UIL A;  2WBS A;  3F6H A;  1A1L A;  1PJQ A;  4M9V C;  4OX9 E;  1IBK E;  1T38 A;  2EQ0 A;  1A1H A;  2EOR A;  4GKK E;  2B7V A;  2EMB A;  2EPC A;  4NZV A;  2CT1 A;  1ZR9 A;  2EPN A;  1KJK A;  1X48 A;  1L4S A;  1X6H A;  2DIX A;  2V8Q B;  1ZBT A;  1N34 E;  1T4O A;  5IXM B;  2L2M A;  4BC7 A;  3HPS A;  1YUJ A;  1WRJ A;  4TUI A;  2N3H A;  2KON A;  3VYY A;  2L8T A;  4RHB B;  1ZU1 A;  4DR4 E;  1WJP A;  2EMI A;  5KL4 A;  5F3W A;  2H36 X;  3IWD A;  1HR0 E;  1PKP A;  2ELY A;  4P7D A;  2NUF A;  3KZZ A;  2EOX A;  3TQM A;  2JR1 A;  2L92 A;  5KL5 A;  2EM0 A;  5AC5 A;  1J5E E;  3HTX A;  3H09 A;  2LCE A;  1UBD C;  1I94 E;  2RS7 A;  4LFB E;  3EPK A;  1J26 A;  1N36 E;  3MHS C;  2EPL X;  2EN2 A;  1A1G A;  2EPP A;  3T1H E;  2EPO A; 
#chains in the Genus database with same CATH homology
 1Z1B A;  2GHF A;  2EM7 A;  2EMG A;  2RSI A;  4F6N A;  2EMZ A;  2WBU A;  4X9J A;  3EPJ A;  4F2J C;  2BB8 A;  4R2C A;  2E72 A;  4WSG A;  2EPA A;  2EOH A;  2R1F A;  1UN6 B;  1AAY A;  2LV2 A;  2EPU A;  4GZN C;  2EOE A;  1TF6 A;  2I13 A;  2YSO A;  2EP3 A;  2CTD A;  2LO3 A;  2LT7 A;  2WBT A;  2EMW A;  1B69 A;  2JPA A;  1X3C A;  3M99 B;  2ENA A;  4R2S A;  1TF3 A;  1BBO A;  2MKD A;  2DMI A;  2EL4 A;  2EOY A;  2WCC 3;  4R2Q A;  1X6E A;  2EOQ A;  2ADR A;  2EMK A;  4R2E A;  1DGC A;  4IS1 C;  4R2R A;  2YSP A;  2ENC A;  2A25 A;  1X5W A;  1LLM C;  3UK3 C;  1NCS A;  2EMX A;  2EMY A;  2EML A;  2EPX A;  1RMD A;  2YRK A;  2PRT A;  4F6M A;  2EOF A;  2RPC A;  3EPH A;  2M9A A;  2EMF A;  2GLI A;  2EQ1 A;  2ELZ A;  2EN6 A;  2WBS A;  2EMC A;  1JK2 A;  2EOS A;  2EN1 A;  2VRD A;  2EN8 A;  1A1L A;  2EM2 A;  4M9V C;  3VHT B;  2CSH A;  2EN7 A;  2YTQ A;  2J7J A;  1TN9 A;  2EQ0 A;  1A1H A;  2EOR A;  3MHH C;  1BB8 A;  2EMB A;  2EPC A;  2NAB A;  2CT1 A;  1ZR9 A;  2EOI A;  1KJK A;  5KL2 A;  2YTE A;  1X6H A;  1P47 A;  2EM8 A;  1JK1 A;  2EJ4 A;  2MDG A;  1MEY C;  1YUJ A;  2DRP A;  2EN3 A;  2YTF A;  4R2A A;  2EOO A;  1YSA C;  1A1F A;  2EN4 A;  1G2D C;  1ZU1 A;  2YTO A;  2EMH A;  2LVH A;  1WJP A;  2EMI A;  5KL4 A;  2EM6 A;  2YTG A;  2YTJ A;  2HGH A;  1G2F C;  2YTI A;  2ELY A;  2YTP A;  1A1I A;  2EQ3 A;  2DLQ A;  4R2D A;  1ZAA C;  2YU5 A;  2YU8 A;  2DLK A;  2EM4 A;  2EL6 A;  5KL6 A;  2YRM A;  5KL7 A;  5KL3 A;  3EPL A;  2EOX A;  2JP9 A;  2MKN A;  1F2I G;  5KL5 A;  2EM0 A;  2EPR A;  2YTD A;  4R2P A;  2EM5 A;  2YTN A;  2LCE A;  2EMA A;  1UBD C;  2EOZ A;  4IJD A;  1A1K A;  3EPK A;  2EM9 A;  2EM3 A;  3MHS C;  2EN2 A;  4FK5 C;  2DGC A;  1X6F A;  2EPZ A;  2D9H A;  2EOM A;  2ENH A;  2EE8 A;  2YRH A;  1A1J A;  1A1G A;  2EPP A;  2EL5 A;  1YUI A;  2EOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...