1G2DC

Structure of a cys2his2 zinc finger/tata box complex (clone #2)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
b'MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGEKPFACDICGRKFATLHTRDRHTKIHLRQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3'
publication title Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1g2dC03
4R2QA 2YRHA 2EM6A 2YSOA 1JK2A 2MKNA 2CSHA 2HGHA 2YU5A 2EPXA 2ENCA 2E72A 2EMZA 2EORA 1A1GA 2EMBA 2EMWA 2R1FA 2I13A 2EPCA 2EMLA 3EPHA 2ADRA 3EPKA 2LO3A 2EN6A 2YRKA 2EM7A 2WCC3 1A1JA 1YUJA 1ZR9A 2J7JA 2MKDA 2YTQA 4R2RA 2EM4A 1G2DC 2EL5A 4R2PA 3MHSC 2YU8A 2WBUA 1TN9A 2EOZA 2ELZA 2EOIA 2EPPA 1TF3A 1NCSA 2EM8A 2YTDA 1X6HA 2LT7A 1LLMC 2EL6A 1A1LA 4FK5C 2YTNA 1ZU1A 2YTOA 1P47A 1X3CA 2M9AA 2YTEA 2DMIA 4IS1C 2ELYA 2EL4A 1JK1A 3VHTB 2GHFA 2CTDA 2DRPA 2RPCA 1AAYA 2EMAA 2LV2A 2EOMA 2EMYA 2EMGA 1B69A 1X5WA 2NABA 2DGCA 2EM3A 3M99B 3EPJA 2EPZA 4IJDA 4R2EA 2YTJA 1TF6A 2ENHA 2BB8A 2LCEA 1UBDC 2EPRA 2EOXA 5KL3A 2EOYA 2EN8A 2DLKA 2EN4A 1X6FA 2LVHA 1YSAC 2YRMA 4R2SA 1BBOA 2D9HA 1WJPA 5KL6A 2EM2A 2RSIA 2EOOA 3MHHC 2MDGA 2YTFA 4F2JC 1A1HA 2EQ3A 2YTIA 2ENAA 2EQ1A 5KL2A 3EPLA 2EN3A 1A1KA 2EM0A 1Z1BA 2EOQA 2EMKA 2EN2A 2EMIA 2VRDA 2PRTA 4R2CA 1DGCA 4R2AA 1BB8A 1KJKA 2EOEA 2EPAA 4WSGA 5KL5A 1UN6B 5KL7A 2GLIA 2WBTA 4R2DA 1A1FA 1X6EA 4F6NA 2EOJA 2DLQA 2EOFA 1A1IA 1G2FC 2EN1A 1MEYC 2EMFA 4F6MA 1YUIA 2JP9A 2CT1A 2EP3A 1F2IG 2EMCA 2EQ0A 3UK3C 4X9JA 2YTPA 2EMHA 2EJ4A 2EOSA 2EM9A 4M9VC 2EM5A 2EMXA 2EE8A 1ZAAC 5KL4A 4GZNC 2WBSA 1RMDA 2YTGA 2YSPA 2EPUA 2JPAA 2EN7A 2A25A 2EOHA
chains in the Genus database with same CATH superfamily
4LF5E 2YSOA 4ZYDA 1N36E 2V87A 2CSHA 2LUQA 4JI8E 2HGHA 2MKNA 2EPXA 3J80C 3L00A 2EMWA 4DR6E 2DSYA 2R1FA 3HPSA 2LRSA 1QU6A 2I13A 2EPCA 2EMLA 3HQ1A 5A6AA 4Q28A 3JU0A 3EPKA 3AV0A 1XMOE 2MDRA 1YUJA 2J7JA 2MKDA 2RQLA 1IBME 2YTQA 4MLVA 2EM4A 1UHZA 2EPOA 4WX9A 4R2PA 3MHSC 2DMYA 2EOIA 2EPPA 4BCAA 1NCSA 3ADIA 4LU9A 4NHRA 4BC7A 4X66E 4B3SE 2M9AA 2V83A 4JI5E 2YWQA 3HTXA 3ADLA 4P78A 2EMAA 2LV2A 1STUA 3ZOQB 4NXME 2FTXB 1EH7A 2V89A 2N3GA 4WYQB 1SFEA 2M7QA 3EPJA 2EPZA 2F8BA 2K7IA 4R2EA 3KZYA 2YTJA 1X49A 2F4VE 4JI0E 2EPMX 1UBDC 1T4LB 4JI1E 2EOYA 5AC5A 2JYAA 4JI6E 2LVHA 2ODRD 2YRMA 1IBLE 2LBSB 4M0VA 1WHQA 3MHHC 1T38A 4B3ME 2YTFA 2L2NA 1T39A 2UUCE 2UUBE 3EPLA 3BF2A 2L33A 3EQ1A 4L8NA 5A69A 1N32E 2EOEA 2EPAA 5KL5A 5AC4A 4WXDA 2NUEA 2MC6A 2DLQA 5LLQA 1A1IA 1G2FC 2EMFA 1X47A 2EP3A 3H09A 2LJUA 5FLXC 2EMCA 2EQ0A 4NZVA 5A2QC 2B7TA 1F2IG 1J26A 2YTPA 2EM9A 3DF6A 4M9VC 3THNA 4GKKE 3J7Yp 1UILA 1GQEA 3IWDA 1ZBTA 4DV7E 1PJSA 4HEIA 4DV4E 5IWAE 2EN7A 4M2ZA 2V85A 2B9DA 3BGHA 2EPNA 3BIDA 3JAMC 4DR7E 2YU5A 3HPZA 2EORA 2WZOA 2EMBA 2JOBA 2NUGA 1AH5A 1T4NA 1EH8A 4DKKA 4DR3E 2EM7A 4DV3E 3IWBA 1ZR9A 1GTKA 1HR0E 4DV2E 2EL5A 2YU8A 4ZYGA 1TF3A 1X6HA 1IQOA 1A1LA 2HC5A 4O43A 2DB2A 1WXRA 5DNYA 4Q35B 2YTEA 3THOB 4DUZE 2HHHE 2DMIA 4HTGA 4R8OA 5AE3A 1JK1A 4KHPE 4BMJA 2EOMA 2EMYA 2EMGA 5ADZA 4LF8E 1X5WA 3M99B 1WRJA 3LMLA 1PJTA 4IJDA 4DUYE 2ENHA 5IXMB 2EPRA 2EN8A 1YYWA 2EN4A 4TUIA 1X6FA 2KHXA 4R2SA 2D9HA 4M30A 1T4OA 3QG5C 2RSIA 2EOOA 2VF1A 4DV0E 2EQ3A 2V88A 3KWRA 2EZ6A 4MLQA 2EQ1A 3RMPA 1YFHA 5KL2A 2IHR1 4GEQB 1Z1BA 4R2AA 1IQSA 4DV1E 3VK6A 1N33E 2JOXA 1UN6B 3JTZA 2GLIA 2WBTA 2G7HA 2EOJA 2JP9A 2EN1A 4LFCE 4F54A 4BHBA 3P1XA 4BC9A 2EOSA 4NXNE 4JI2E 1DI2A 2EM5A 3TQMA 1ZAAC 4GZNC 1RMDA 1RC7A 1N3GA 2EPLX 4L5NC 3J81C 1J5EE 1MGTA 4R2QA 2YRHA 2CPNA 2EM6A 2LE2A 4F9CB 1XMQE 2BBGA 4LF6E 2ENCA 4OOGC 4YY3E 2E72A 1A1GA 3LLHA 2EWLA 2VE7C 5AE1A 3EPHA 2LO3A 2EN6A 4DV5E 1A1JA 1HNZE 4DR4E 5A6KA 2WBUA 2UXCE 1TN9A 4O24A 2RSMA 1YYKA 3OMLA 2EM8A 1QNTA 2YTDA 2YT4A 2YPNA 4N4RB 2GPIA 4J8ZA 1I94E 1XNRE 1LLMC 5A6JA 2ZM6E 5LMNE 1ZBQA 1ZU1A 2N3HA 1P47A 1X3CA 4JV5E 1X48A 2L2MA 2L92A 2HJJA 5A6BA 3C4TA 4WPYA 2RS7A 3F6GA 2CTDA 2DRPA 2RPCA 1L4SA 1RQ0A 4LF7E 4LFAE 2DGCA 1WHNA 2UU9E 1TF6A 2RS6A 3FIGA 5KL3A 2DLKA 2E5LE 4P7DA 4I8OA 1YSAC 1PJQA 2KOUA 4JI7E 4DR5E 3F6HA 2MDGA 4F2JC 1A1HA 2L3JA 1HNXE 3VYYA 1DQ3A 4KZSA 2ENAA 1IBKE 4ZYHA 4JI3E 2LMZA 1A1KA 2EM0A 2EOQA 2VRDA 1BB8A 2PRTA 5T6JA 4RH8A 4WSGA 2JY9A 4BHCA 3AUZA 4O5GA 5KL7A 4DV6E 4B3TE 1X6EA 1YUIA 4O4KA 4F6MA 4DMIA 5BR8E 1GZ6A 2CT1A 2Q8UA 3BBGA 4X9JA 1O0WA 2LTRA 4F9BB 5LMUE 4WFTA 3C4BA 2B3TB 2WBSA 4DR1E 4RHBB 4R03A 1SR9A 2V86A 2YTGA 2LTSA 3ADJA 5AE2A 4BBYA 2JXPA 2A25A 4BS9A 4LFBE 2EOHA 2JWOA 1JK2A 1PDAA 4X65E 2R76A 2L2KB 2EMZA 2M1SA 4WSPA 2UXDE 2ADRA 4OX9E 2YRKA 2WCC3 1BBGA 2N8XA 5CFFE 4R2RA 3ADGA 1G2DC 2MC5A 2DIXA 1YYOA 2EOZA 2ELZA 4LTYA 2H36X 2L3CA 2RTXA 4AQYE 1YZ9A 2FGGA 4X64E 2LT7A 3ECRA 2EL6A 2NA2A 4FK5C 2YTNA 2YTOA 1IMUA 1NEIA 5F3WA 3C6KA 5IV8B 4IS1C 2UUAE 2ELYA 2EL4A 1HNWE 4X62E 2JR1A 3VHTB 2GHFA 4TUGA 1AAYA 5IT9C 4JI4E 2LJHA 1B69A 2L8TA 2NABA 2EM3A 4X8WA 3HXLA 2BB8A 2LCEA 1XNQE 3J7AG 2EOXA 4F9AB 2L6MA 4WXCA 4JYAE 2K4VA 1KYQA 1WJPA 5KL6A 2EM2A 2ODRC 5A6BD 3K6QA 2VQEE 2JVAA 4YHHE 2YTIA 1YPNA 2V8QB 1FKAE 1PKPA 2EPKX 3MSWA 3DJWA 2KONA 4DR2E 2EN3A 2M4IA 3C6MA 5AASA 5LL6R 5TSEA 2EMKA 2EN2A 2EMIA 1DGCA 4R2CA 1KJKA 2YZTA 2B7VA 1EH6A 3VYXA 2I9IA 2VQFE 3T1HE 2UXBE 2E1MA 4R2DA 2FV4B 1A1FA 4KWYA 4F6NA 2EOFA 1MEYC 4K0KE 1EKZA 3UK3C 4B3RE 2EMHA 4ZYEA 2EJ4A 1FJGE 2EMXA 1N34E 2EE8A 3T1YE 5KL4A 2NUFA 4LF4E 2YSPA 4GKJE 4LF9E 3KZZA 2LUPB 3OTOE 2EPUA 2JPAA 1BBOA 3IWCA
chains in the Genus database with same CATH topology
4R2QA 2YRHA 2EM6A 2YSOA 1JK2A 2MKNA 2CSHA 2HGHA 2YU5A 2EPXA 2ENCA 2E72A 2EMZA 2EORA 1A1GA 2EMBA 2EMWA 2R1FA 2I13A 2EPCA 2EMLA 3EPHA 2ADRA 3EPKA 2LO3A 2EN6A 2YRKA 2EM7A 2WCC3 1A1JA 1YUJA 1ZR9A 2J7JA 2MKDA 2YTQA 4R2RA 2EM4A 1G2DC 2EL5A 4R2PA 3MHSC 2YU8A 2WBUA 1TN9A 2EOZA 2ELZA 2EOIA 2EPPA 1TF3A 1NCSA 2EM8A 2YTDA 1X6HA 2LT7A 1LLMC 2EL6A 1A1LA 4FK5C 2YTNA 1ZU1A 2YTOA 1P47A 1X3CA 2M9AA 2YTEA 2DMIA 4IS1C 2ELYA 2EL4A 1JK1A 3VHTB 2GHFA 2CTDA 2DRPA 2RPCA 1AAYA 2EMAA 2LV2A 2EOMA 2EMYA 2EMGA 1B69A 1X5WA 2NABA 2DGCA 2EM3A 3M99B 3EPJA 2EPZA 4IJDA 4R2EA 2YTJA 1TF6A 2ENHA 2BB8A 2LCEA 1UBDC 2EPRA 2EOXA 5KL3A 2EOYA 2EN8A 2DLKA 2EN4A 1X6FA 2LVHA 1YSAC 2YRMA 4R2SA 1BBOA 2D9HA 1WJPA 5KL6A 2EM2A 2RSIA 2EOOA 3MHHC 2MDGA 2YTFA 4F2JC 1A1HA 2EQ3A 2YTIA 2ENAA 2EQ1A 5KL2A 3EPLA 2EN3A 1A1KA 2EM0A 1Z1BA 2EOQA 2EMKA 2EN2A 2EMIA 2VRDA 2PRTA 4R2CA 1DGCA 4R2AA 1BB8A 1KJKA 2EOEA 2EPAA 4WSGA 5KL5A 1UN6B 5KL7A 2GLIA 2WBTA 4R2DA 1A1FA 1X6EA 4F6NA 2EOJA 2DLQA 2EOFA 1A1IA 1G2FC 2EN1A 1MEYC 2EMFA 4F6MA 1YUIA 2JP9A 2CT1A 2EP3A 1F2IG 2EMCA 2EQ0A 3UK3C 4X9JA 2YTPA 2EMHA 2EJ4A 2EOSA 2EM9A 4M9VC 2EM5A 2EMXA 2EE8A 1ZAAC 5KL4A 4GZNC 2WBSA 1RMDA 2YTGA 2YSPA 2EPUA 2JPAA 2EN7A 2A25A 2EOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2Q A;  2YRH A;  2EM6 A;  2YSO A;  1JK2 A;  2MKN A;  2CSH A;  2HGH A;  2YU5 A;  2EPX A;  2ENC A;  2E72 A;  2EMZ A;  2EOR A;  1A1G A;  2EMB A;  2EMW A;  2R1F A;  2I13 A;  2EPC A;  2EML A;  3EPH A;  2ADR A;  3EPK A;  2LO3 A;  2EN6 A;  2YRK A;  2EM7 A;  2WCC 3;  1A1J A;  1YUJ A;  1ZR9 A;  2J7J A;  2MKD A;  2YTQ A;  4R2R A;  2EM4 A;  1G2D C;  2EL5 A;  4R2P A;  3MHS C;  2YU8 A;  2WBU A;  1TN9 A;  2EOZ A;  2ELZ A;  2EOI A;  2EPP A;  1TF3 A;  1NCS A;  2EM8 A;  2YTD A;  1X6H A;  2LT7 A;  1LLM C;  2EL6 A;  1A1L A;  4FK5 C;  2YTN A;  1ZU1 A;  2YTO A;  1P47 A;  1X3C A;  2M9A A;  2YTE A;  2DMI A;  4IS1 C;  2ELY A;  2EL4 A;  1JK1 A;  3VHT B;  2GHF A;  2CTD A;  2DRP A;  2RPC A;  1AAY A;  2EMA A;  2LV2 A;  2EOM A;  2EMY A;  2EMG A;  1B69 A;  1X5W A;  2NAB A;  2DGC A;  2EM3 A;  3M99 B;  3EPJ A;  2EPZ A;  4IJD A;  4R2E A;  2YTJ A;  1TF6 A;  2ENH A;  2BB8 A;  2LCE A;  1UBD C;  2EPR A;  2EOX A;  5KL3 A;  2EOY A;  2EN8 A;  2DLK A;  2EN4 A;  1X6F A;  2LVH A;  1YSA C;  2YRM A;  4R2S A;  1BBO A;  2D9H A;  1WJP A;  5KL6 A;  2EM2 A;  2RSI A;  2EOO A;  3MHH C;  2MDG A;  2YTF A;  4F2J C;  1A1H A;  2EQ3 A;  2YTI A;  2ENA A;  2EQ1 A;  5KL2 A;  3EPL A;  2EN3 A;  1A1K A;  2EM0 A;  1Z1B A;  2EOQ A;  2EMK A;  2EN2 A;  2EMI A;  2VRD A;  2PRT A;  4R2C A;  1DGC A;  4R2A A;  1BB8 A;  1KJK A;  2EOE A;  2EPA A;  4WSG A;  5KL5 A;  1UN6 B;  5KL7 A;  2GLI A;  2WBT A;  4R2D A;  1A1F A;  1X6E A;  4F6N A;  2EOJ A;  2DLQ A;  2EOF A;  1A1I A;  1G2F C;  2EN1 A;  1MEY C;  2EMF A;  4F6M A;  1YUI A;  2JP9 A;  2CT1 A;  2EP3 A;  1F2I G;  2EMC A;  2EQ0 A;  3UK3 C;  4X9J A;  2YTP A;  2EMH A;  2EJ4 A;  2EOS A;  2EM9 A;  4M9V C;  2EM5 A;  2EMX A;  2EE8 A;  1ZAA C;  5KL4 A;  4GZN C;  2WBS A;  1RMD A;  2YTG A;  2YSP A;  2EPU A;  2JPA A;  2EN7 A;  2A25 A;  2EOH A; 
#chains in the Genus database with same CATH topology
 4LF5 E;  2YSO A;  4ZYD A;  1N36 E;  2V87 A;  2CSH A;  2LUQ A;  4JI8 E;  2HGH A;  2MKN A;  2EPX A;  3J80 C;  3L00 A;  2EMW A;  4DR6 E;  2DSY A;  2R1F A;  3HPS A;  2LRS A;  1QU6 A;  2I13 A;  2EPC A;  2EML A;  3HQ1 A;  5A6A A;  4Q28 A;  3JU0 A;  3EPK A;  3AV0 A;  1XMO E;  2MDR A;  1YUJ A;  2J7J A;  2MKD A;  2RQL A;  1IBM E;  2YTQ A;  4MLV A;  2EM4 A;  1UHZ A;  2EPO A;  4WX9 A;  4R2P A;  3MHS C;  2DMY A;  2EOI A;  2EPP A;  4BCA A;  1NCS A;  3ADI A;  4LU9 A;  4NHR A;  4BC7 A;  4X66 E;  4B3S E;  2M9A A;  2V83 A;  4JI5 E;  2YWQ A;  3HTX A;  3ADL A;  4P78 A;  2EMA A;  2LV2 A;  1STU A;  3ZOQ B;  4NXM E;  2FTX B;  1EH7 A;  2V89 A;  2N3G A;  4WYQ B;  1SFE A;  2M7Q A;  3EPJ A;  2EPZ A;  2F8B A;  2K7I A;  4R2E A;  3KZY A;  2YTJ A;  1X49 A;  2F4V E;  4JI0 E;  2EPM X;  1UBD C;  1T4L B;  4JI1 E;  2EOY A;  5AC5 A;  2JYA A;  4JI6 E;  2LVH A;  2ODR D;  2YRM A;  1IBL E;  2LBS B;  4M0V A;  1WHQ A;  3MHH C;  1T38 A;  4B3M E;  2YTF A;  2L2N A;  1T39 A;  2UUC E;  2UUB E;  3EPL A;  3BF2 A;  2L33 A;  3EQ1 A;  4L8N A;  5A69 A;  1N32 E;  2EOE A;  2EPA A;  5KL5 A;  5AC4 A;  4WXD A;  2NUE A;  2MC6 A;  2DLQ A;  5LLQ A;  1A1I A;  1G2F C;  2EMF A;  1X47 A;  2EP3 A;  3H09 A;  2LJU A;  5FLX C;  2EMC A;  2EQ0 A;  4NZV A;  5A2Q C;  2B7T A;  1F2I G;  1J26 A;  2YTP A;  2EM9 A;  3DF6 A;  4M9V C;  3THN A;  4GKK E;  3J7Y p;  1UIL A;  1GQE A;  3IWD A;  1ZBT A;  4DV7 E;  1PJS A;  4HEI A;  4DV4 E;  5IWA E;  2EN7 A;  4M2Z A;  2V85 A;  2B9D A;  3BGH A;  2EPN A;  3BID A;  3JAM C;  4DR7 E;  2YU5 A;  3HPZ A;  2EOR A;  2WZO A;  2EMB A;  2JOB A;  2NUG A;  1AH5 A;  1T4N A;  1EH8 A;  4DKK A;  4DR3 E;  2EM7 A;  4DV3 E;  3IWB A;  1ZR9 A;  1GTK A;  1HR0 E;  4DV2 E;  2EL5 A;  2YU8 A;  4ZYG A;  1TF3 A;  1X6H A;  1IQO A;  1A1L A;  2HC5 A;  4O43 A;  2DB2 A;  1WXR A;  5DNY A;  4Q35 B;  2YTE A;  3THO B;  4DUZ E;  2HHH E;  2DMI A;  4HTG A;  4R8O A;  5AE3 A;  1JK1 A;  4KHP E;  4BMJ A;  2EOM A;  2EMY A;  2EMG A;  5ADZ A;  4LF8 E;  1X5W A;  3M99 B;  1WRJ A;  3LML A;  1PJT A;  4IJD A;  4DUY E;  2ENH A;  5IXM B;  2EPR A;  2EN8 A;  1YYW A;  2EN4 A;  4TUI A;  1X6F A;  2KHX A;  4R2S A;  2D9H A;  4M30 A;  1T4O A;  3QG5 C;  2RSI A;  2EOO A;  2VF1 A;  4DV0 E;  2EQ3 A;  2V88 A;  3KWR A;  2EZ6 A;  4MLQ A;  2EQ1 A;  3RMP A;  1YFH A;  5KL2 A;  2IHR 1;  4GEQ B;  1Z1B A;  4R2A A;  1IQS A;  4DV1 E;  3VK6 A;  1N33 E;  2JOX A;  1UN6 B;  3JTZ A;  2GLI A;  2WBT A;  2G7H A;  2EOJ A;  2JP9 A;  2EN1 A;  4LFC E;  4F54 A;  4BHB A;  3P1X A;  4BC9 A;  2EOS A;  4NXN E;  4JI2 E;  1DI2 A;  2EM5 A;  3TQM A;  1ZAA C;  4GZN C;  1RMD A;  1RC7 A;  1N3G A;  2EPL X;  4L5N C;  3J81 C;  1J5E E;  1MGT A;  4R2Q A;  2YRH A;  2CPN A;  2EM6 A;  2LE2 A;  4F9C B;  1XMQ E;  2BBG A;  4LF6 E;  2ENC A;  4OOG C;  4YY3 E;  2E72 A;  1A1G A;  3LLH A;  2EWL A;  2VE7 C;  5AE1 A;  3EPH A;  2LO3 A;  2EN6 A;  4DV5 E;  1A1J A;  1HNZ E;  4DR4 E;  5A6K A;  2WBU A;  2UXC E;  1TN9 A;  4O24 A;  2RSM A;  1YYK A;  3OML A;  2EM8 A;  1QNT A;  2YTD A;  2YT4 A;  2YPN A;  4N4R B;  2GPI A;  4J8Z A;  1I94 E;  1XNR E;  1LLM C;  5A6J A;  2ZM6 E;  5LMN E;  1ZBQ A;  1ZU1 A;  2N3H A;  1P47 A;  1X3C A;  4JV5 E;  1X48 A;  2L2M A;  2L92 A;  2HJJ A;  5A6B A;  3C4T A;  4WPY A;  2RS7 A;  3F6G A;  2CTD A;  2DRP A;  2RPC A;  1L4S A;  1RQ0 A;  4LF7 E;  4LFA E;  2DGC A;  1WHN A;  2UU9 E;  1TF6 A;  2RS6 A;  3FIG A;  5KL3 A;  2DLK A;  2E5L E;  4P7D A;  4I8O A;  1YSA C;  1PJQ A;  2KOU A;  4JI7 E;  4DR5 E;  3F6H A;  2MDG A;  4F2J C;  1A1H A;  2L3J A;  1HNX E;  3VYY A;  1DQ3 A;  4KZS A;  2ENA A;  1IBK E;  4ZYH A;  4JI3 E;  2LMZ A;  1A1K A;  2EM0 A;  2EOQ A;  2VRD A;  1BB8 A;  2PRT A;  5T6J A;  4RH8 A;  4WSG A;  2JY9 A;  4BHC A;  3AUZ A;  4O5G A;  5KL7 A;  4DV6 E;  4B3T E;  1X6E A;  1YUI A;  4O4K A;  4F6M A;  4DMI A;  5BR8 E;  1GZ6 A;  2CT1 A;  2Q8U A;  3BBG A;  4X9J A;  1O0W A;  2LTR A;  4F9B B;  5LMU E;  4WFT A;  3C4B A;  2B3T B;  2WBS A;  4DR1 E;  4RHB B;  4R03 A;  1SR9 A;  2V86 A;  2YTG A;  2LTS A;  3ADJ A;  5AE2 A;  4BBY A;  2JXP A;  2A25 A;  4BS9 A;  4LFB E;  2EOH A;  2JWO A;  1JK2 A;  1PDA A;  4X65 E;  2R76 A;  2L2K B;  2EMZ A;  2M1S A;  4WSP A;  2UXD E;  2ADR A;  4OX9 E;  2YRK A;  2WCC 3;  1BBG A;  2N8X A;  5CFF E;  4R2R A;  3ADG A;  1G2D C;  2MC5 A;  2DIX A;  1YYO A;  2EOZ A;  2ELZ A;  4LTY A;  2H36 X;  2L3C A;  2RTX A;  4AQY E;  1YZ9 A;  2FGG A;  4X64 E;  2LT7 A;  3ECR A;  2EL6 A;  2NA2 A;  4FK5 C;  2YTN A;  2YTO A;  1IMU A;  1NEI A;  5F3W A;  3C6K A;  5IV8 B;  4IS1 C;  2UUA E;  2ELY A;  2EL4 A;  1HNW E;  4X62 E;  2JR1 A;  3VHT B;  2GHF A;  4TUG A;  1AAY A;  5IT9 C;  4JI4 E;  2LJH A;  1B69 A;  2L8T A;  2NAB A;  2EM3 A;  4X8W A;  3HXL A;  2BB8 A;  2LCE A;  1XNQ E;  3J7A G;  2EOX A;  4F9A B;  2L6M A;  4WXC A;  4JYA E;  2K4V A;  1KYQ A;  1WJP A;  5KL6 A;  2EM2 A;  2ODR C;  5A6B D;  3K6Q A;  2VQE E;  2JVA A;  4YHH E;  2YTI A;  1YPN A;  2V8Q B;  1FKA E;  1PKP A;  2EPK X;  3MSW A;  3DJW A;  2KON A;  4DR2 E;  2EN3 A;  2M4I A;  3C6M A;  5AAS A;  5LL6 R;  5TSE A;  2EMK A;  2EN2 A;  2EMI A;  1DGC A;  4R2C A;  1KJK A;  2YZT A;  2B7V A;  1EH6 A;  3VYX A;  2I9I A;  2VQF E;  3T1H E;  2UXB E;  2E1M A;  4R2D A;  2FV4 B;  1A1F A;  4KWY A;  4F6N A;  2EOF A;  1MEY C;  4K0K E;  1EKZ A;  3UK3 C;  4B3R E;  2EMH A;  4ZYE A;  2EJ4 A;  1FJG E;  2EMX A;  1N34 E;  2EE8 A;  3T1Y E;  5KL4 A;  2NUF A;  4LF4 E;  2YSP A;  4GKJ E;  4LF9 E;  3KZZ A;  2LUP B;  3OTO E;  2EPU A;  2JPA A;  1BBO A;  3IWC A; 
#chains in the Genus database with same CATH homology
 4R2Q A;  2YRH A;  2EM6 A;  2YSO A;  1JK2 A;  2MKN A;  2CSH A;  2HGH A;  2YU5 A;  2EPX A;  2ENC A;  2E72 A;  2EMZ A;  2EOR A;  1A1G A;  2EMB A;  2EMW A;  2R1F A;  2I13 A;  2EPC A;  2EML A;  3EPH A;  2ADR A;  3EPK A;  2LO3 A;  2EN6 A;  2YRK A;  2EM7 A;  2WCC 3;  1A1J A;  1YUJ A;  1ZR9 A;  2J7J A;  2MKD A;  2YTQ A;  4R2R A;  2EM4 A;  1G2D C;  2EL5 A;  4R2P A;  3MHS C;  2YU8 A;  2WBU A;  1TN9 A;  2EOZ A;  2ELZ A;  2EOI A;  2EPP A;  1TF3 A;  1NCS A;  2EM8 A;  2YTD A;  1X6H A;  2LT7 A;  1LLM C;  2EL6 A;  1A1L A;  4FK5 C;  2YTN A;  1ZU1 A;  2YTO A;  1P47 A;  1X3C A;  2M9A A;  2YTE A;  2DMI A;  4IS1 C;  2ELY A;  2EL4 A;  1JK1 A;  3VHT B;  2GHF A;  2CTD A;  2DRP A;  2RPC A;  1AAY A;  2EMA A;  2LV2 A;  2EOM A;  2EMY A;  2EMG A;  1B69 A;  1X5W A;  2NAB A;  2DGC A;  2EM3 A;  3M99 B;  3EPJ A;  2EPZ A;  4IJD A;  4R2E A;  2YTJ A;  1TF6 A;  2ENH A;  2BB8 A;  2LCE A;  1UBD C;  2EPR A;  2EOX A;  5KL3 A;  2EOY A;  2EN8 A;  2DLK A;  2EN4 A;  1X6F A;  2LVH A;  1YSA C;  2YRM A;  4R2S A;  1BBO A;  2D9H A;  1WJP A;  5KL6 A;  2EM2 A;  2RSI A;  2EOO A;  3MHH C;  2MDG A;  2YTF A;  4F2J C;  1A1H A;  2EQ3 A;  2YTI A;  2ENA A;  2EQ1 A;  5KL2 A;  3EPL A;  2EN3 A;  1A1K A;  2EM0 A;  1Z1B A;  2EOQ A;  2EMK A;  2EN2 A;  2EMI A;  2VRD A;  2PRT A;  4R2C A;  1DGC A;  4R2A A;  1BB8 A;  1KJK A;  2EOE A;  2EPA A;  4WSG A;  5KL5 A;  1UN6 B;  5KL7 A;  2GLI A;  2WBT A;  4R2D A;  1A1F A;  1X6E A;  4F6N A;  2EOJ A;  2DLQ A;  2EOF A;  1A1I A;  1G2F C;  2EN1 A;  1MEY C;  2EMF A;  4F6M A;  1YUI A;  2JP9 A;  2CT1 A;  2EP3 A;  1F2I G;  2EMC A;  2EQ0 A;  3UK3 C;  4X9J A;  2YTP A;  2EMH A;  2EJ4 A;  2EOS A;  2EM9 A;  4M9V C;  2EM5 A;  2EMX A;  2EE8 A;  1ZAA C;  5KL4 A;  4GZN C;  2WBS A;  1RMD A;  2YTG A;  2YSP A;  2EPU A;  2JPA A;  2EN7 A;  2A25 A;  2EOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...