4RH8A

Crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
133
Chain Sequence
b'QVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title Structural basis of lipopolysaccharide insertion into the bacterial outer membrane
rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 30
structure length 133
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4rh8A00
5IXMB 2N8XA 5IV8B 4NHRA 5TSEA 2R76A 4RH8A 4RHBB 4Q35B 3BF2A 4N4RB 2JXPA 4KWYA
chains in the Genus database with same CATH superfamily
4R03A 4DR3E 2DB2A 4BS9A 2LUPB 2RQLA 1TF6A 4WFTA 1XNQE 4LFBE 2EPAA 2EQ3A 3C6MA 4HTGA 1Z1BA 2HGHA 2EPPA 3KZYA 4BC7A 2ELZA 2NUFA 3KZZA 1KYQA 4DV6E 1IBME 1B69A 2K4VA 2KOUA 2HC5A 4LFCE 3EPHA 2EE8A 1EH6A 3HXLA 1TN9A 2G7HA 2EP3A 2MC5A 5KL7A 2LVHA 4F9AB 4ZYEA 2EOMA 2LT7A 4DR4E 2EM2A 4F9BB 1N33E 4KZSA 2EMHA 4R2AA 5TSEA 1ZBQA 1YSAC 3BGHA 2D9HA 4TUIA 1HNWE 3KWRA 1YUIA 2I13A 3M99B 2RS7A 2FV4B 1YYWA 2EPXA 3EPJA 2ADRA 3EQ1A 3LMLA 3J81C 2L3CA 2L2NA 2LO3A 4WYQB 3THOB 4B3RE 4X9JA 4R2DA 2EM0A 2MDGA 2GLIA 4BBYA 2EL4A 1FKAE 1UBDC 4NXNE 1IQOA 3ADJA 4WSGA 1N3GA 1RQ0A 2E1MA 3HPZA 4BMJA 4JI2E 4DV7E 2UXDE 2BB8A 4JI7E 3F6GA 1HR0E 3HTXA 2EM6A 2YRHA 2NUEA 5A6BA 2FTXB 5AE2A 1BBOA 2JVAA 1XNRE 2R76A 2LUQA 3MHHC 2YTOA 4OOGC 4WXCA 2YRKA 3IWDA 2DLQA 2JOXA 1AH5A 2ENHA 3OMLA 4JYAE 4DV2E 5AC4A 2BBGA 4F2JC 2GPIA 4DUZE 2LE2A 2EMWA 2UUAE 2YTFA 2L2MA 1EH7A 3RMPA 1DQ3A 2VRDA 2ELYA 4O5GA 3BIDA 2ENAA 2EPOA 2A25A 2I9IA 3ECRA 4LF8E 1YYKA 2LTRA 1EH8A 4IS1C 5CFFE 4YHHE 2EOZA 1QNTA 1XMQE 4LF4E 4IJDA 2H36X 2RPCA 4LF9E 5A6AA 4L8NA 3VYYA 2EMFA 5AC5A 2YPNA 1X47A 1JK2A 2MC6A 3J7AG 3T1YE 4BC9A 2YT4A 1YUJA 2YTNA 5F3WA 1NCSA 1IBLE 4O4KA 1G2DC 2V86A 2EPKX 1AAYA 2EL5A 4RH8A 5KL3A 2V87A 5IWAE 2HHHE 2E5LE 1BB8A 2JY9A 2EPMX 4NZVA 4LF7E 1A1IA 4JV5E 4MLQA 1A1GA 1T38A 2CSHA 5A6JA 3AV0A 2ENCA 4J8ZA 1MEYC 2VF1A 2EMBA 2EMIA 1FJGE 1KJKA 1BBGA 1A1KA 1DI2A 4X62E 2V8QB 2EMYA 4KWYA 2EM4A 2YTEA 1JK1A 2LBSB 3J7Yp 2EOHA 2L2KB 2NUGA 2YTIA 4DUYE 1A1LA 4F6NA 2LMZA 2WBUA 2DLKA 2EL6A 4HEIA 5AE1A 2YZTA 1YFHA 4NXME 4DR6E 2EOSA 2LTSA 2NA2A 3C6KA 4O24A 4RHBB 1WHQA 2JP9A 1L4SA 2WBTA 4LFAE 1UN6B 2CTDA 2M4IA 4R2EA 2DIXA 2EMZA 4DKKA 1RMDA 4DV4E 4NHRA 3EPLA 2L92A 4R2RA 1GZ6A 5ADZA 2JWOA 3ZOQB 1TF3A 2WBSA 4DMIA 3OTOE 2F4VE 4ZYHA 4R8OA 3UK3C 2EOEA 2B3TB 2RSIA 2R1FA 3AUZA 2EMAA 2N8XA 1IQSA 2F8BA 2JR1A 2L6MA 3T1HE 4LF6E 4WX9A 5DNYA 3C4BA 1PJQA 5IV8B 1WJPA 1O0WA 1SR9A 3ADIA 2VQFE 4B3SE 2KHXA 3JU0A 4P78A 1RC7A 1STUA 2LJUA 2L3JA 2YTDA 5KL5A 1A1FA 2IHR1 2ZM6E 4KHPE 2EMLA 1PJSA 4GEQB 2EPCA 3K6QA 3ADLA 2M1SA 2B7TA 1UHZA 4GKJE 4P7DA 5A69A 2EN2A 1WRJA 2EJ4A 2LCEA 5BR8E 1X3CA 2EOOA 2YRMA 5IT9C 5KL2A 2EN3A 3FIGA 4GZNC 4WXDA 4O43A 2YWQA 2LRSA 1ZBTA 1EKZA 2EWLA 4BHBA 2EOJA 4R2PA 4M9VC 4WSPA 2EORA 2EZ6A 1X6FA 2NABA 1T4LB 3VHTB 4X64E 1F2IG 1G2FC 2EMXA 2EQ0A 2YTGA 2M7QA 4BHCA 2RSMA 2YSPA 2YTJA 1N36E 4I8OA 1HNXE 2V83A 2EN1A 1DGCA 4TUGA 5LMNE 4LU9A 2EPLX 1X6HA 2YTQA 2EOXA 3L00A 2JOBA 2CPNA 2EN8A 5A2QC 2UUBE 2YSOA 2EN7A 3P1XA 4M30A 4DV5E 4N4RB 2MKNA 4OX9E 2DMIA 2L8TA 3J80C 2UXCE 1IBKE 2EMCA 2KONA 2DSYA 3QG5C 4Q35B 1QU6A 2EM3A 1SFEA 2K7IA 4JI6E 4L5NC 2EOIA 2Q8UA 3ADGA 5LL6R 4R2SA 3C4TA 1PJTA 2EOYA 2UUCE 4DV3E 2YU5A 1XMOE 5FLXC 2V89A 1N34E 4JI5E 1PKPA 2YU8A 3VYXA 2WZOA 2LJHA 2ODRD 3THNA 1ZU1A 3MSWA 2RS6A 1J26A 1T4NA 1WHNA 1PDAA 4GKKE 2EMGA 4F6MA 1A1JA 2RTXA 5LMUE 4B3TE 3IWBA 2B9DA 1LLMC 1X49A 1I94E 1T4OA 1YPNA 4R2QA 5LLQA 1X48A 2HJJA 2M9AA 2JXPA 1UILA 3BBGA 5KL4A 2EPRA 2FGGA 2LV2A 4JI8E 4JI0E 2JPAA 4R2CA 3HPSA 3F6HA 3TQMA 3JAMC 2N3GA 3IWCA 1A1HA 5KL6A 1IMUA 1X6EA 2EN6A 4DR7E 2V85A 2EPUA 2MDRA 2VQEE 3LLHA 4LTYA 3H09A 4JI3E 4DR1E 1YYOA 4X65E 4K0KE 5AE3A 5A6KA 2EOQA 4DR2E 2EM5A 5IXMB 4LF5E 2E72A 4Q28A 3JTZA 3BF2A 4MLVA 4M2ZA 1GQEA 2EPZA 3EPKA 4BCAA 4B3ME 2EQ1A 4WPYA 2DMYA 3DJWA 4M0VA 2J7JA 2EM9A 1MGTA 2GHFA 1ZAAC 2WCC3 1T39A 5AASA 3MHSC 4DV0E 2VE7C 1N32E 3HQ1A 2UXBE 4X66E 1J5EE 2MKDA 1NEIA 2EM7A 2CT1A 2EOFA 5A6BD 1GTKA 4DV1E 4ZYGA 3VK6A 2DRPA 2EPNA 2EN4A 1X5WA 2UU9E 5T6JA 4JI1E 4AQYE 4X8WA 1ZR9A 4FK5C 2PRTA 1HNZE 2N3HA 2B7VA 2V88A 4YY3E 3DF6A 4JI4E 2ODRC 4F9CB 2EMKA 1YZ9A 1P47A 2DGCA 2YTPA 2EM8A 1WXRA 2L33A 4ZYDA 2JYAA 4DR5E 4F54A
chains in the Genus database with same CATH topology
5IXMB 2N8XA 5IV8B 4NHRA 5TSEA 2R76A 4RH8A 4RHBB 4Q35B 3BF2A 4N4RB 2JXPA 4KWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IXM B;  2N8X A;  5IV8 B;  4NHR A;  5TSE A;  2R76 A;  4RH8 A;  4RHB B;  4Q35 B;  3BF2 A;  4N4R B;  2JXP A;  4KWY A; 
#chains in the Genus database with same CATH topology
 4R03 A;  4DR3 E;  2DB2 A;  4BS9 A;  2LUP B;  2RQL A;  1TF6 A;  4WFT A;  1XNQ E;  4LFB E;  2EPA A;  2EQ3 A;  3C6M A;  4HTG A;  1Z1B A;  2HGH A;  2EPP A;  3KZY A;  4BC7 A;  2ELZ A;  2NUF A;  3KZZ A;  1KYQ A;  4DV6 E;  1IBM E;  1B69 A;  2K4V A;  2KOU A;  2HC5 A;  4LFC E;  3EPH A;  2EE8 A;  1EH6 A;  3HXL A;  1TN9 A;  2G7H A;  2EP3 A;  2MC5 A;  5KL7 A;  2LVH A;  4F9A B;  4ZYE A;  2EOM A;  2LT7 A;  4DR4 E;  2EM2 A;  4F9B B;  1N33 E;  4KZS A;  2EMH A;  4R2A A;  5TSE A;  1ZBQ A;  1YSA C;  3BGH A;  2D9H A;  4TUI A;  1HNW E;  3KWR A;  1YUI A;  2I13 A;  3M99 B;  2RS7 A;  2FV4 B;  1YYW A;  2EPX A;  3EPJ A;  2ADR A;  3EQ1 A;  3LML A;  3J81 C;  2L3C A;  2L2N A;  2LO3 A;  4WYQ B;  3THO B;  4B3R E;  4X9J A;  4R2D A;  2EM0 A;  2MDG A;  2GLI A;  4BBY A;  2EL4 A;  1FKA E;  1UBD C;  4NXN E;  1IQO A;  3ADJ A;  4WSG A;  1N3G A;  1RQ0 A;  2E1M A;  3HPZ A;  4BMJ A;  4JI2 E;  4DV7 E;  2UXD E;  2BB8 A;  4JI7 E;  3F6G A;  1HR0 E;  3HTX A;  2EM6 A;  2YRH A;  2NUE A;  5A6B A;  2FTX B;  5AE2 A;  1BBO A;  2JVA A;  1XNR E;  2R76 A;  2LUQ A;  3MHH C;  2YTO A;  4OOG C;  4WXC A;  2YRK A;  3IWD A;  2DLQ A;  2JOX A;  1AH5 A;  2ENH A;  3OML A;  4JYA E;  4DV2 E;  5AC4 A;  2BBG A;  4F2J C;  2GPI A;  4DUZ E;  2LE2 A;  2EMW A;  2UUA E;  2YTF A;  2L2M A;  1EH7 A;  3RMP A;  1DQ3 A;  2VRD A;  2ELY A;  4O5G A;  3BID A;  2ENA A;  2EPO A;  2A25 A;  2I9I A;  3ECR A;  4LF8 E;  1YYK A;  2LTR A;  1EH8 A;  4IS1 C;  5CFF E;  4YHH E;  2EOZ A;  1QNT A;  1XMQ E;  4LF4 E;  4IJD A;  2H36 X;  2RPC A;  4LF9 E;  5A6A A;  4L8N A;  3VYY A;  2EMF A;  5AC5 A;  2YPN A;  1X47 A;  1JK2 A;  2MC6 A;  3J7A G;  3T1Y E;  4BC9 A;  2YT4 A;  1YUJ A;  2YTN A;  5F3W A;  1NCS A;  1IBL E;  4O4K A;  1G2D C;  2V86 A;  2EPK X;  1AAY A;  2EL5 A;  4RH8 A;  5KL3 A;  2V87 A;  5IWA E;  2HHH E;  2E5L E;  1BB8 A;  2JY9 A;  2EPM X;  4NZV A;  4LF7 E;  1A1I A;  4JV5 E;  4MLQ A;  1A1G A;  1T38 A;  2CSH A;  5A6J A;  3AV0 A;  2ENC A;  4J8Z A;  1MEY C;  2VF1 A;  2EMB A;  2EMI A;  1FJG E;  1KJK A;  1BBG A;  1A1K A;  1DI2 A;  4X62 E;  2V8Q B;  2EMY A;  4KWY A;  2EM4 A;  2YTE A;  1JK1 A;  2LBS B;  3J7Y p;  2EOH A;  2L2K B;  2NUG A;  2YTI A;  4DUY E;  1A1L A;  4F6N A;  2LMZ A;  2WBU A;  2DLK A;  2EL6 A;  4HEI A;  5AE1 A;  2YZT A;  1YFH A;  4NXM E;  4DR6 E;  2EOS A;  2LTS A;  2NA2 A;  3C6K A;  4O24 A;  4RHB B;  1WHQ A;  2JP9 A;  1L4S A;  2WBT A;  4LFA E;  1UN6 B;  2CTD A;  2M4I A;  4R2E A;  2DIX A;  2EMZ A;  4DKK A;  1RMD A;  4DV4 E;  4NHR A;  3EPL A;  2L92 A;  4R2R A;  1GZ6 A;  5ADZ A;  2JWO A;  3ZOQ B;  1TF3 A;  2WBS A;  4DMI A;  3OTO E;  2F4V E;  4ZYH A;  4R8O A;  3UK3 C;  2EOE A;  2B3T B;  2RSI A;  2R1F A;  3AUZ A;  2EMA A;  2N8X A;  1IQS A;  2F8B A;  2JR1 A;  2L6M A;  3T1H E;  4LF6 E;  4WX9 A;  5DNY A;  3C4B A;  1PJQ A;  5IV8 B;  1WJP A;  1O0W A;  1SR9 A;  3ADI A;  2VQF E;  4B3S E;  2KHX A;  3JU0 A;  4P78 A;  1RC7 A;  1STU A;  2LJU A;  2L3J A;  2YTD A;  5KL5 A;  1A1F A;  2IHR 1;  2ZM6 E;  4KHP E;  2EML A;  1PJS A;  4GEQ B;  2EPC A;  3K6Q A;  3ADL A;  2M1S A;  2B7T A;  1UHZ A;  4GKJ E;  4P7D A;  5A69 A;  2EN2 A;  1WRJ A;  2EJ4 A;  2LCE A;  5BR8 E;  1X3C A;  2EOO A;  2YRM A;  5IT9 C;  5KL2 A;  2EN3 A;  3FIG A;  4GZN C;  4WXD A;  4O43 A;  2YWQ A;  2LRS A;  1ZBT A;  1EKZ A;  2EWL A;  4BHB A;  2EOJ A;  4R2P A;  4M9V C;  4WSP A;  2EOR A;  2EZ6 A;  1X6F A;  2NAB A;  1T4L B;  3VHT B;  4X64 E;  1F2I G;  1G2F C;  2EMX A;  2EQ0 A;  2YTG A;  2M7Q A;  4BHC A;  2RSM A;  2YSP A;  2YTJ A;  1N36 E;  4I8O A;  1HNX E;  2V83 A;  2EN1 A;  1DGC A;  4TUG A;  5LMN E;  4LU9 A;  2EPL X;  1X6H A;  2YTQ A;  2EOX A;  3L00 A;  2JOB A;  2CPN A;  2EN8 A;  5A2Q C;  2UUB E;  2YSO A;  2EN7 A;  3P1X A;  4M30 A;  4DV5 E;  4N4R B;  2MKN A;  4OX9 E;  2DMI A;  2L8T A;  3J80 C;  2UXC E;  1IBK E;  2EMC A;  2KON A;  2DSY A;  3QG5 C;  4Q35 B;  1QU6 A;  2EM3 A;  1SFE A;  2K7I A;  4JI6 E;  4L5N C;  2EOI A;  2Q8U A;  3ADG A;  5LL6 R;  4R2S A;  3C4T A;  1PJT A;  2EOY A;  2UUC E;  4DV3 E;  2YU5 A;  1XMO E;  5FLX C;  2V89 A;  1N34 E;  4JI5 E;  1PKP A;  2YU8 A;  3VYX A;  2WZO A;  2LJH A;  2ODR D;  3THN A;  1ZU1 A;  3MSW A;  2RS6 A;  1J26 A;  1T4N A;  1WHN A;  1PDA A;  4GKK E;  2EMG A;  4F6M A;  1A1J A;  2RTX A;  5LMU E;  4B3T E;  3IWB A;  2B9D A;  1LLM C;  1X49 A;  1I94 E;  1T4O A;  1YPN A;  4R2Q A;  5LLQ A;  1X48 A;  2HJJ A;  2M9A A;  2JXP A;  1UIL A;  3BBG A;  5KL4 A;  2EPR A;  2FGG A;  2LV2 A;  4JI8 E;  4JI0 E;  2JPA A;  4R2C A;  3HPS A;  3F6H A;  3TQM A;  3JAM C;  2N3G A;  3IWC A;  1A1H A;  5KL6 A;  1IMU A;  1X6E A;  2EN6 A;  4DR7 E;  2V85 A;  2EPU A;  2MDR A;  2VQE E;  3LLH A;  4LTY A;  3H09 A;  4JI3 E;  4DR1 E;  1YYO A;  4X65 E;  4K0K E;  5AE3 A;  5A6K A;  2EOQ A;  4DR2 E;  2EM5 A;  5IXM B;  4LF5 E;  2E72 A;  4Q28 A;  3JTZ A;  3BF2 A;  4MLV A;  4M2Z A;  1GQE A;  2EPZ A;  3EPK A;  4BCA A;  4B3M E;  2EQ1 A;  4WPY A;  2DMY A;  3DJW A;  4M0V A;  2J7J A;  2EM9 A;  1MGT A;  2GHF A;  1ZAA C;  2WCC 3;  1T39 A;  5AAS A;  3MHS C;  4DV0 E;  2VE7 C;  1N32 E;  3HQ1 A;  2UXB E;  4X66 E;  1J5E E;  2MKD A;  1NEI A;  2EM7 A;  2CT1 A;  2EOF A;  5A6B D;  1GTK A;  4DV1 E;  4ZYG A;  3VK6 A;  2DRP A;  2EPN A;  2EN4 A;  1X5W A;  2UU9 E;  5T6J A;  4JI1 E;  4AQY E;  4X8W A;  1ZR9 A;  4FK5 C;  2PRT A;  1HNZ E;  2N3H A;  2B7V A;  2V88 A;  4YY3 E;  3DF6 A;  4JI4 E;  2ODR C;  4F9C B;  2EMK A;  1YZ9 A;  1P47 A;  2DGC A;  2YTP A;  2EM8 A;  1WXR A;  2L33 A;  4ZYD A;  2JYA A;  4DR5 E;  4F54 A; 
#chains in the Genus database with same CATH homology
 5IXM B;  2N8X A;  5IV8 B;  4NHR A;  5TSE A;  2R76 A;  4RH8 A;  4RHB B;  4Q35 B;  3BF2 A;  4N4R B;  2JXP A;  4KWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...