4RH8A

Crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
133
Chain Sequence
QVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title Structural basis of lipopolysaccharide insertion into the bacterial outer membrane
rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 30
structure length 133
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4rh8A00
2JXPA 4RHBB 4Q35B 5IXMB 4N4RB 5TSEA 4KWYA 5IV8B 2N8XA 4NHRA 3BF2A 2R76A 4RH8A
chains in the Genus database with same CATH superfamily
3IWCA 4JI4E 3VHTB 1IQSA 2LUQA 2FGGA 4R03A 2DB2A 1BBGA 2A25A 5AE3A 4X62E 3VYXA 1A1GA 2M9AA 4R2RA 1X49A 2EMIA 2EM2A 1Z1BA 2WBUA 4F9CB 2EOZA 3T1YE 1XNRE 2RSIA 3C4BA 2ENHA 4WXCA 4WSPA 3BBGA 2MC5A 4KWYA 3BGHA 4DMIA 3VYYA 2WBSA 2ODRD 4IJDA 1PKPA 1EH6A 3JTZA 4GKJE 4Q28A 2E72A 1A1HA 1WRJA 1QU6A 2GPIA 2ELYA 2GLIA 4NHRA 3F6HA 5F3WA 4BS9A 2EOXA 4BHBA 1DI2A 2UU9E 2LBSB 4LU9A 2YTNA 4O24A 4RHBB 2RQLA 1NEIA 4LF6E 2RSMA 4P78A 2EOMA 1P47A 5A2QC 3MSWA 2VF1A 3L00A 2EMYA 1EH7A 3M99B 2M4IA 5A69A 4X64E 5A6AA 2E1MA 4DR5E 2JXPA 4LF4E 1YSAC 2YTFA 2CTDA 2RS6A 4YHHE 2EOJA 2HC5A 1WJPA 2YSOA 3EPJA 4N4RB 2DLQA 4YY3E 2V83A 2EOYA 1IBLE 2EN6A 4O43A 4Q35B 2B3TB 2EPNA 4JI3E 5LMUE 2D9HA 1STUA 2LTRA 1HNZE 1JK2A 3HPSA 2LV2A 2ENCA 2EM6A 1YYKA 3IWBA 2YRMA 2YTIA 2EOFA 2EMAA 2EPRA 5BR8E 2EOSA 2EOOA 2LJHA 2V86A 3LMLA 4WXDA 3MHHC 2KHXA 4LF9E 3ADGA 5AE2A 2EL4A 3ADJA 4BC9A 2UUAE 2IHR1 3MHSC 2EMLA 2WBTA 2PRTA 1A1KA 2EM3A 3OTOE 5AE1A 4B3RE 2V85A 2EN7A 2N3GA 3JU0A 2L8TA 1T4NA 2KONA 3K6QA 4DUYE 2EMCA 2EPKX 4GKKE 1TN9A 4F9AB 2EJ4A 2L2MA 4DV3E 2HHHE 2EP3A 4M9VC 3EPHA 1LLMC 2LTSA 2MDGA 2EMXA 2EM4A 2HGHA 4DR7E 3KZZA 4BMJA 1A1JA 4LFCE 2E5LE 3IWDA 1IQOA 4DV5E 2N8XA 2JYAA 1PDAA 4R2CA 1X6FA 2EORA 3HQ1A 1G2DC 3HTXA 2EOQA 2EQ3A 4BC7A 1RQ0A 2R1FA 2B7VA 1KJKA 2EPXA 1TF6A 1XNQE 2L3JA 2EWLA 5AC5A 2WCC3 2V88A 2L3CA 4R8OA 4BHCA 2L2KB 2EE8A 5LMNE 1YYWA 2EQ1A 2NUFA 4OOGC 2EPLX 2JPAA 2K4VA 2NABA 5KL6A 2LRSA 3ECRA 2B9DA 2VQEE 1XMOE 1AAYA 1HNXE 5KL2A 2R76A 2EM5A 4DV6E 3LLHA 2EM7A 4AQYE 3THOB 1A1LA 1YUIA 2DMYA 3VK6A 2F4VE 4KZSA 1X5WA 2H36X 2L33A 4ZYDA 4M0VA 2EPMX 3FIGA 4L5NC 3BIDA 1T39A 2EN4A 1N34E 3RMPA 4OX9E 4K0KE 2YPNA 3H09A 1X3CA 2MDRA 1ZR9A 4X65E 1FJGE 1J5EE 4R2SA 2LVHA 2YTQA 2G7HA 2JR1A 2EMFA 3ADLA 2EPOA 2JOXA 2M7QA 2N3HA 4R2QA 4DR6E 2CPNA 1T4OA 2EMHA 4R2AA 1BBOA 4RH8A 2YWQA 4M30A 4X66E 1GQEA 2V89A 5IV8B 4R2PA 1HNWE 5AASA 1PJQA 2I13A 2EQ0A 1IMUA 4LF5E 5A6BD 4JI6E 3HPZA 4M2ZA 1ZU1A 2EN8A 4F9BB 2YU5A 5CFFE 3HXLA 4DV7E 3C6MA 4BCAA 2EOEA 2ZM6E 1JK1A 4IS1C 2LO3A 4R2DA 5A6JA 3J7AG 2VE7C 4MLVA 4NZVA 1T38A 4ZYGA 1SR9A 2DMIA 4LTYA 2HJJA 4MLQA 2BBGA 1UHZA 2DSYA 3C6KA 4WX9A 2ADRA 2JVAA 2B7TA 2EZ6A 3BF2A 2YSPA 4P7DA 1UILA 2FV4B 2RTXA 5IT9C 4KHPE 2YTJA 1ZAAC 1T4LB 1DGCA 4ZYEA 1DQ3A 2L92A 1EKZA 1YZ9A 2DIXA 4B3TE 4JI0E 1KYQA 2J7JA 1F2IG 1N36E 1QNTA 2MC6A 2EN2A 4TUGA 2JWOA 4GZNC 1SFEA 4DV1E 1B69A 2EOIA 4X9JA 2CT1A 2UUBE 2EN1A 1YYOA 4DKKA 2EM9A 2L6MA 4FK5C 4F6NA 1O0WA 2L2NA 2LUPB 2EMWA 3J80C 3THNA 3T1HE 4B3ME 3ADIA 4WYQB 5IXMB 2DGCA 5AC4A 3KWRA 1X48A 5IWAE 2EPPA 2LMZA 1YFHA 5KL3A 4DV2E 3AV0A 1GTKA 2VRDA 4LFAE 2YU8A 4F54A 1A1FA 1RMDA 1WHQA 1X6EA 1GZ6A 2MKNA 4NXNE 2MKDA 4LF8E 1MEYC 4DR1E 5LL6R 2LJUA 2YTPA 3OMLA 1A1IA 4LFBE 4WSGA 4HEIA 4R2EA 3UK3C 4JI2E 2YRHA 3EQ1A 2ELZA 3J81C 1UBDC 2FTXB 3TQMA 3QG5C 4JI8E 4TUIA 1N3GA 3EPKA 2YZTA 1EH8A 2BB8A 2KOUA 4I8OA 1UN6B 4DR2E 2V87A 2YTOA 3C4TA 1RC7A 5A6BA 4JI1E 4WPYA 1PJSA 2EM0A 1N33E 1TF3A 4O4KA 2RPCA 2Q8UA 4DR4E 2V8QB 1ZBQA 5TSEA 1ZBTA 2YRKA 2LE2A 3JAMC 2YTDA 2VQFE 1YUJA 3J7Yp 4LF7E 2YT4A 4X8WA 2DRPA 4B3SE 2EMBA 5LLQA 2ODRC 4ZYHA 2NUGA 2CSHA 3DJWA 1L4SA 1X6HA 4F6MA 2RS7A 2NA2A 1PJTA 5KL4A 1MGTA 2EMGA 2JOBA 2EPCA 1FKAE 2YTGA 2ENAA 2K7IA 2DLKA 1XMQE 1AH5A 2EL5A 5T6JA 4NXME 4GEQB 2EM8A 1YPNA 2NUEA 1NCSA 2EOHA 2EPAA 4DV4E 3F6GA 1I94E 2LT7A 1BB8A 2JY9A 1X47A 2YTEA 2EPZA 3ZOQB 1J26A 1N32E 1HR0E 5KL7A 1IBME 2UXDE 4L8NA 4JYAE 1WHNA 4BBYA 4DUZE 4JV5E 4F2JC 4JI5E 4HTGA 2EMKA 4WFTA 1IBKE 1WXRA 2GHFA 5A6KA 2JP9A 5DNYA 2WZOA 5FLXC 4J8ZA 2LCEA 3KZYA 2EN3A 2EMZA 4DR3E 2UXCE 3P1XA 2M1SA 4JI7E 1G2FC 3EPLA 2EPUA 2UXBE 5ADZA 5KL5A 2UUCE 4DV0E 3AUZA 3DF6A 4O5GA 2EL6A 2I9IA 2F8BA
chains in the Genus database with same CATH topology
2JXPA 4RHBB 4Q35B 5IXMB 4N4RB 5TSEA 4KWYA 5IV8B 2N8XA 4NHRA 3BF2A 2R76A 4RH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXP A;  4RHB B;  4Q35 B;  5IXM B;  4N4R B;  5TSE A;  4KWY A;  5IV8 B;  2N8X A;  4NHR A;  3BF2 A;  2R76 A;  4RH8 A; 
#chains in the Genus database with same CATH topology
 3IWC A;  4JI4 E;  3VHT B;  1IQS A;  2LUQ A;  2FGG A;  4R03 A;  2DB2 A;  1BBG A;  2A25 A;  5AE3 A;  4X62 E;  3VYX A;  1A1G A;  2M9A A;  4R2R A;  1X49 A;  2EMI A;  2EM2 A;  1Z1B A;  2WBU A;  4F9C B;  2EOZ A;  3T1Y E;  1XNR E;  2RSI A;  3C4B A;  2ENH A;  4WXC A;  4WSP A;  3BBG A;  2MC5 A;  4KWY A;  3BGH A;  4DMI A;  3VYY A;  2WBS A;  2ODR D;  4IJD A;  1PKP A;  1EH6 A;  3JTZ A;  4GKJ E;  4Q28 A;  2E72 A;  1A1H A;  1WRJ A;  1QU6 A;  2GPI A;  2ELY A;  2GLI A;  4NHR A;  3F6H A;  5F3W A;  4BS9 A;  2EOX A;  4BHB A;  1DI2 A;  2UU9 E;  2LBS B;  4LU9 A;  2YTN A;  4O24 A;  4RHB B;  2RQL A;  1NEI A;  4LF6 E;  2RSM A;  4P78 A;  2EOM A;  1P47 A;  5A2Q C;  3MSW A;  2VF1 A;  3L00 A;  2EMY A;  1EH7 A;  3M99 B;  2M4I A;  5A69 A;  4X64 E;  5A6A A;  2E1M A;  4DR5 E;  2JXP A;  4LF4 E;  1YSA C;  2YTF A;  2CTD A;  2RS6 A;  4YHH E;  2EOJ A;  2HC5 A;  1WJP A;  2YSO A;  3EPJ A;  4N4R B;  2DLQ A;  4YY3 E;  2V83 A;  2EOY A;  1IBL E;  2EN6 A;  4O43 A;  4Q35 B;  2B3T B;  2EPN A;  4JI3 E;  5LMU E;  2D9H A;  1STU A;  2LTR A;  1HNZ E;  1JK2 A;  3HPS A;  2LV2 A;  2ENC A;  2EM6 A;  1YYK A;  3IWB A;  2YRM A;  2YTI A;  2EOF A;  2EMA A;  2EPR A;  5BR8 E;  2EOS A;  2EOO A;  2LJH A;  2V86 A;  3LML A;  4WXD A;  3MHH C;  2KHX A;  4LF9 E;  3ADG A;  5AE2 A;  2EL4 A;  3ADJ A;  4BC9 A;  2UUA E;  2IHR 1;  3MHS C;  2EML A;  2WBT A;  2PRT A;  1A1K A;  2EM3 A;  3OTO E;  5AE1 A;  4B3R E;  2V85 A;  2EN7 A;  2N3G A;  3JU0 A;  2L8T A;  1T4N A;  2KON A;  3K6Q A;  4DUY E;  2EMC A;  2EPK X;  4GKK E;  1TN9 A;  4F9A B;  2EJ4 A;  2L2M A;  4DV3 E;  2HHH E;  2EP3 A;  4M9V C;  3EPH A;  1LLM C;  2LTS A;  2MDG A;  2EMX A;  2EM4 A;  2HGH A;  4DR7 E;  3KZZ A;  4BMJ A;  1A1J A;  4LFC E;  2E5L E;  3IWD A;  1IQO A;  4DV5 E;  2N8X A;  2JYA A;  1PDA A;  4R2C A;  1X6F A;  2EOR A;  3HQ1 A;  1G2D C;  3HTX A;  2EOQ A;  2EQ3 A;  4BC7 A;  1RQ0 A;  2R1F A;  2B7V A;  1KJK A;  2EPX A;  1TF6 A;  1XNQ E;  2L3J A;  2EWL A;  5AC5 A;  2WCC 3;  2V88 A;  2L3C A;  4R8O A;  4BHC A;  2L2K B;  2EE8 A;  5LMN E;  1YYW A;  2EQ1 A;  2NUF A;  4OOG C;  2EPL X;  2JPA A;  2K4V A;  2NAB A;  5KL6 A;  2LRS A;  3ECR A;  2B9D A;  2VQE E;  1XMO E;  1AAY A;  1HNX E;  5KL2 A;  2R76 A;  2EM5 A;  4DV6 E;  3LLH A;  2EM7 A;  4AQY E;  3THO B;  1A1L A;  1YUI A;  2DMY A;  3VK6 A;  2F4V E;  4KZS A;  1X5W A;  2H36 X;  2L33 A;  4ZYD A;  4M0V A;  2EPM X;  3FIG A;  4L5N C;  3BID A;  1T39 A;  2EN4 A;  1N34 E;  3RMP A;  4OX9 E;  4K0K E;  2YPN A;  3H09 A;  1X3C A;  2MDR A;  1ZR9 A;  4X65 E;  1FJG E;  1J5E E;  4R2S A;  2LVH A;  2YTQ A;  2G7H A;  2JR1 A;  2EMF A;  3ADL A;  2EPO A;  2JOX A;  2M7Q A;  2N3H A;  4R2Q A;  4DR6 E;  2CPN A;  1T4O A;  2EMH A;  4R2A A;  1BBO A;  4RH8 A;  2YWQ A;  4M30 A;  4X66 E;  1GQE A;  2V89 A;  5IV8 B;  4R2P A;  1HNW E;  5AAS A;  1PJQ A;  2I13 A;  2EQ0 A;  1IMU A;  4LF5 E;  5A6B D;  4JI6 E;  3HPZ A;  4M2Z A;  1ZU1 A;  2EN8 A;  4F9B B;  2YU5 A;  5CFF E;  3HXL A;  4DV7 E;  3C6M A;  4BCA A;  2EOE A;  2ZM6 E;  1JK1 A;  4IS1 C;  2LO3 A;  4R2D A;  5A6J A;  3J7A G;  2VE7 C;  4MLV A;  4NZV A;  1T38 A;  4ZYG A;  1SR9 A;  2DMI A;  4LTY A;  2HJJ A;  4MLQ A;  2BBG A;  1UHZ A;  2DSY A;  3C6K A;  4WX9 A;  2ADR A;  2JVA A;  2B7T A;  2EZ6 A;  3BF2 A;  2YSP A;  4P7D A;  1UIL A;  2FV4 B;  2RTX A;  5IT9 C;  4KHP E;  2YTJ A;  1ZAA C;  1T4L B;  1DGC A;  4ZYE A;  1DQ3 A;  2L92 A;  1EKZ A;  1YZ9 A;  2DIX A;  4B3T E;  4JI0 E;  1KYQ A;  2J7J A;  1F2I G;  1N36 E;  1QNT A;  2MC6 A;  2EN2 A;  4TUG A;  2JWO A;  4GZN C;  1SFE A;  4DV1 E;  1B69 A;  2EOI A;  4X9J A;  2CT1 A;  2UUB E;  2EN1 A;  1YYO A;  4DKK A;  2EM9 A;  2L6M A;  4FK5 C;  4F6N A;  1O0W A;  2L2N A;  2LUP B;  2EMW A;  3J80 C;  3THN A;  3T1H E;  4B3M E;  3ADI A;  4WYQ B;  5IXM B;  2DGC A;  5AC4 A;  3KWR A;  1X48 A;  5IWA E;  2EPP A;  2LMZ A;  1YFH A;  5KL3 A;  4DV2 E;  3AV0 A;  1GTK A;  2VRD A;  4LFA E;  2YU8 A;  4F54 A;  1A1F A;  1RMD A;  1WHQ A;  1X6E A;  1GZ6 A;  2MKN A;  4NXN E;  2MKD A;  4LF8 E;  1MEY C;  4DR1 E;  5LL6 R;  2LJU A;  2YTP A;  3OML A;  1A1I A;  4LFB E;  4WSG A;  4HEI A;  4R2E A;  3UK3 C;  4JI2 E;  2YRH A;  3EQ1 A;  2ELZ A;  3J81 C;  1UBD C;  2FTX B;  3TQM A;  3QG5 C;  4JI8 E;  4TUI A;  1N3G A;  3EPK A;  2YZT A;  1EH8 A;  2BB8 A;  2KOU A;  4I8O A;  1UN6 B;  4DR2 E;  2V87 A;  2YTO A;  3C4T A;  1RC7 A;  5A6B A;  4JI1 E;  4WPY A;  1PJS A;  2EM0 A;  1N33 E;  1TF3 A;  4O4K A;  2RPC A;  2Q8U A;  4DR4 E;  2V8Q B;  1ZBQ A;  5TSE A;  1ZBT A;  2YRK A;  2LE2 A;  3JAM C;  2YTD A;  2VQF E;  1YUJ A;  3J7Y p;  4LF7 E;  2YT4 A;  4X8W A;  2DRP A;  4B3S E;  2EMB A;  5LLQ A;  2ODR C;  4ZYH A;  2NUG A;  2CSH A;  3DJW A;  1L4S A;  1X6H A;  4F6M A;  2RS7 A;  2NA2 A;  1PJT A;  5KL4 A;  1MGT A;  2EMG A;  2JOB A;  2EPC A;  1FKA E;  2YTG A;  2ENA A;  2K7I A;  2DLK A;  1XMQ E;  1AH5 A;  2EL5 A;  5T6J A;  4NXM E;  4GEQ B;  2EM8 A;  1YPN A;  2NUE A;  1NCS A;  2EOH A;  2EPA A;  4DV4 E;  3F6G A;  1I94 E;  2LT7 A;  1BB8 A;  2JY9 A;  1X47 A;  2YTE A;  2EPZ A;  3ZOQ B;  1J26 A;  1N32 E;  1HR0 E;  5KL7 A;  1IBM E;  2UXD E;  4L8N A;  4JYA E;  1WHN A;  4BBY A;  4DUZ E;  4JV5 E;  4F2J C;  4JI5 E;  4HTG A;  2EMK A;  4WFT A;  1IBK E;  1WXR A;  2GHF A;  5A6K A;  2JP9 A;  5DNY A;  2WZO A;  5FLX C;  4J8Z A;  2LCE A;  3KZY A;  2EN3 A;  2EMZ A;  4DR3 E;  2UXC E;  3P1X A;  2M1S A;  4JI7 E;  1G2F C;  3EPL A;  2EPU A;  2UXB E;  5ADZ A;  5KL5 A;  2UUC E;  4DV0 E;  3AUZ A;  3DF6 A;  4O5G A;  2EL6 A;  2I9I A;  2F8B A; 
#chains in the Genus database with same CATH homology
 2JXP A;  4RHB B;  4Q35 B;  5IXM B;  4N4R B;  5TSE A;  4KWY A;  5IV8 B;  2N8X A;  4NHR A;  3BF2 A;  2R76 A;  4RH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...