4RH8A

Crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
133
Chain Sequence
QVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPS-assembly lipoprotein LptE
publication title Structural basis of lipopolysaccharide insertion into the bacterial outer membrane
rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 30
structure length 133
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4rh8A00
4NHRA 5IV8B 3BF2A 5TSEA 2R76A 4N4RB 4RH8A 5IXMB 4Q35B 2N8XA 4KWYA 4RHBB 2JXPA
chains in the Genus database with same CATH superfamily
2EM6A 1X3CA 2EN3A 3BF2A 1QNTA 2EORA 2YRMA 4BBYA 2EOHA 4NHRA 1XMOE 4BMJA 3JU0A 2Q8UA 1KJKA 2FGGA 3KWRA 2N3HA 2NUEA 4J8ZA 2FTXB 3VYXA 2JVAA 4Q28A 2LTRA 2CSHA 2EM2A 2YTPA 2E5LE 2YTQA 4BHBA 3ADGA 4LF8E 2IHR1 2V8QB 2EN1A 2BB8A 4O4KA 1IBLE 2YU8A 1YUJA 1IBKE 1YYWA 2MKDA 1DI2A 2M7QA 2V85A 2DIXA 2VRDA 4K0KE 2V87A 3FIGA 3J7AG 2RSIA 2LVHA 1X5WA 2L2NA 5KL5A 1X48A 2EOMA 2YU5A 4P78A 4DV2E 1A1IA 2L3CA 2JOBA 5A2QC 2EMZA 2A25A 2WBTA 1N36E 2YTGA 2FV4B 1YZ9A 3H09A 2CPNA 5KL6A 1ZBQA 4RHBB 2YRKA 3J81C 5T6JA 2YRHA 3IWDA 1YYKA 3HTXA 3C6MA 5A6AA 4X64E 3ADIA 4YHHE 2UUCE 4B3TE 3BIDA 3OMLA 5AE1A 2CT1A 4KWYA 4FK5C 3F6HA 1NEIA 4R2DA 1PKPA 2YTOA 3EQ1A 1A1GA 1UN6B 5A69A 4ZYDA 2E72A 4DV0E 4ZYEA 2EMFA 2EPCA 2EL6A 3THNA 2EMWA 5CFFE 4JV5E 5LMNE 1I94E 2EPUA 1X6HA 2JWOA 1A1HA 1ZU1A 4DR1E 1DGCA 1XNQE 2EQ0A 4R2SA 1WRJA 4AQYE 4LTYA 1EH6A 1A1KA 2LJUA 5BR8E 4JI8E 1T4LB 4LF4E 1PJQA 2JR1A 4KZSA 1XMQE 1F2IG 2R76A 3ADJA 1T4NA 1PDAA 2J7JA 2B7TA 2EOYA 2UUBE 2EMBA 4O5GA 1PJTA 2M1SA 1IMUA 2HJJA 3HPZA 1TF6A 4WPYA 3J80C 1X49A 2EOJA 2EOFA 2KOUA 4JI4E 4X66E 2EPKX 2N8XA 1J26A 2EMLA 1DQ3A 2EPMX 1HNZE 2EOSA 4TUGA 2PRTA 1T4OA 2EN4A 3ZOQB 1YYOA 2B9DA 4R8OA 5AC5A 4DR4E 4O24A 4B3RE 2CTDA 4DR2E 2UUAE 4WXDA 4M30A 4F9CB 4LFCE 2D9HA 2GPIA 4WXCA 2NA2A 1YSAC 4O43A 4X65E 1N33E 4DV7E 2DMIA 2EM8A 2EM5A 5ADZA 1NCSA 4LF5E 2DLKA 5AE2A 4IS1C 2M9AA 2YTNA 2EOEA 3MHSC 2LRSA 2VQEE 1RC7A 3ECRA 3IWBA 3BBGA 2LTSA 2V88A 2L8TA 3KZZA 3C6KA 3C4BA 3JTZA 3UK3C 4B3SE 4OOGC 4LU9A 3P1XA 3HPSA 2ODRC 2V86A 1ZR9A 1WHNA 1IBME 2HHHE 4LFBE 4MLVA 2LUPB 2ENCA 2N3GA 3LMLA 1X6EA 3EPJA 4Q35B 4LF6E 2EWLA 2GHFA 2LUQA 2RPCA 3K6QA 1JK2A 4DV1E 4DV4E 3MHHC 5AE3A 2LE2A 4ZYGA 1LLMC 3TQMA 2EMAA 4R03A 2EJ4A 3OTOE 2L33A 2EPZA 5IV8B 5A6KA 1HR0E 1YUIA 2EM9A 3ADLA 4F54A 2UXBE 4BC7A 1STUA 5FLXC 4L8NA 4JI0E 4GZNC 2EMXA 2YTIA 2EN8A 1MGTA 1HNXE 4I8OA 4HTGA 4WSPA 5LLQA 2EPPA 4N4RB 2ELZA 1YFHA 3LLHA 1FJGE 4TUIA 4JI6E 3DF6A 2K4VA 1X47A 1IQOA 5KL3A 4NXME 1EH8A 2R1FA 5IXMB 1ZBTA 2JPAA 1T39A 1G2DC 5AASA 2V83A 2EOZA 2JY9A 2VF1A 1G2FC 2EM0A 2YSPA 4BCAA 4F6NA 4NZVA 2JXPA 3VK6A 1BB8A 2KHXA 2VE7C 2ENAA 3KZYA 2DGCA 1GQEA 2GLIA 1RQ0A 2ELYA 2EOQA 3J7Yp 4L5NC 2I13A 2EM3A 2NABA 2B7VA 3BGHA 2DSYA 2EN2A 2DLQA 3T1YE 1IQSA 2L2MA 2L6MA 2EZ6A 2MC5A 2EMKA 1A1JA 2HGHA 4JI2E 4DUZE 2YTEA 2EN6A 1KYQA 5IT9C 5IWAE 2M4IA 1AAYA 1JK1A 4ZYHA 2KONA 2UU9E 4X62E 3F6GA 4JYAE 1RMDA 3HXLA 4F9BB 2EMYA 2LCEA 1Z1BA 1YPNA 1UBDC 2YZTA 4R2AA 1B69A 1BBOA 2EPLX 4X9JA 2F8BA 1N3GA 2LMZA 2RTXA 2UXCE 2B3TB 2EMGA 2YPNA 2DMYA 1UHZA 2EQ3A 1T38A 1MEYC 5KL2A 3EPKA 4WSGA 2EPRA 4R2QA 4NXNE 2EN7A 3HQ1A 2ZM6E 2YTJA 2EMIA 2E1MA 2EQ1A 5KL4A 4R2PA 1A1FA 4OX9E 2ENHA 2LV2A 3DJWA 2EOOA 2V89A 2MKNA 2RSMA 1N34E 1WJPA 4M2ZA 4JI3E 2YT4A 2JP9A 2DRPA 4BHCA 4WYQB 4LF9E 1N32E 1FKAE 1XNRE 2YTFA 2EP3A 2YSOA 1TN9A 2L2KB 2BBGA 2ODRD 1GTKA 3EPHA 4BC9A 4B3ME 3QG5C 2VQFE 3JAMC 5DNYA 2EMCA 1ZAAC 2G7HA 4DV3E 3EPLA 4DV5E 2EOIA 1J5EE 3THOB 5KL7A 2I9IA 5AC4A 4R2RA 4DKKA 1SR9A 4F2JC 1EKZA 5A6BA 2ADRA 3T1HE 4JI5E 1GZ6A 1A1LA 4GKKE 2JOXA 3VHTB 1WXRA 2EE8A 2EL5A 2MDGA 4R2CA 4DR7E 1AH5A 4LF7E 3MSWA 3AUZA 2LT7A 1UILA 4DR3E 4M0VA 2WZOA 1WHQA 4R2EA 4YY3E 2LJHA 2EOXA 2JYAA 4KHPE 2L3JA 4MLQA 4JI1E 2WBSA 5A6BD 1X6FA 1EH7A 2HC5A 5A6JA 1L4SA 4F6MA 2MDRA 4M9VC 2K7IA 1P47A 1PJSA 3RMPA 4X8WA 2LBSB 2WBUA 3L00A 3IWCA 4DR5E 2YTDA 3M99B 4DMIA 4F9AB 3VYYA 1QU6A 4BS9A 2NUFA 2H36X 2YWQA 4GKJE 5LMUE 2RS6A 4RH8A 1TF3A 2EPNA 2EPOA 2EPXA 4WX9A 4DR6E 2DB2A 3C4TA 2EM7A 2MC6A 2LO3A 2EL4A 2RS7A 5F3WA 1SFEA 2UXDE 4HEIA 2WCC3 2EPAA 4GEQB 4IJDA 2EMHA 4LFAE 4DUYE 5TSEA 2EM4A 4WFTA 1HNWE 1O0WA 3AV0A 2NUGA 5LL6R 2L92A 2F4VE 4JI7E 4P7DA 1BBGA 4DV6E 2RQLA
chains in the Genus database with same CATH topology
4NHRA 5IV8B 3BF2A 5TSEA 2R76A 4N4RB 4RH8A 5IXMB 4Q35B 2N8XA 4KWYA 4RHBB 2JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHR A;  5IV8 B;  3BF2 A;  5TSE A;  2R76 A;  4N4R B;  4RH8 A;  5IXM B;  4Q35 B;  2N8X A;  4KWY A;  4RHB B;  2JXP A; 
#chains in the Genus database with same CATH topology
 2EM6 A;  1X3C A;  2EN3 A;  3BF2 A;  1QNT A;  2EOR A;  2YRM A;  4BBY A;  2EOH A;  4NHR A;  1XMO E;  4BMJ A;  3JU0 A;  2Q8U A;  1KJK A;  2FGG A;  3KWR A;  2N3H A;  2NUE A;  4J8Z A;  2FTX B;  3VYX A;  2JVA A;  4Q28 A;  2LTR A;  2CSH A;  2EM2 A;  2YTP A;  2E5L E;  2YTQ A;  4BHB A;  3ADG A;  4LF8 E;  2IHR 1;  2V8Q B;  2EN1 A;  2BB8 A;  4O4K A;  1IBL E;  2YU8 A;  1YUJ A;  1IBK E;  1YYW A;  2MKD A;  1DI2 A;  2M7Q A;  2V85 A;  2DIX A;  2VRD A;  4K0K E;  2V87 A;  3FIG A;  3J7A G;  2RSI A;  2LVH A;  1X5W A;  2L2N A;  5KL5 A;  1X48 A;  2EOM A;  2YU5 A;  4P78 A;  4DV2 E;  1A1I A;  2L3C A;  2JOB A;  5A2Q C;  2EMZ A;  2A25 A;  2WBT A;  1N36 E;  2YTG A;  2FV4 B;  1YZ9 A;  3H09 A;  2CPN A;  5KL6 A;  1ZBQ A;  4RHB B;  2YRK A;  3J81 C;  5T6J A;  2YRH A;  3IWD A;  1YYK A;  3HTX A;  3C6M A;  5A6A A;  4X64 E;  3ADI A;  4YHH E;  2UUC E;  4B3T E;  3BID A;  3OML A;  5AE1 A;  2CT1 A;  4KWY A;  4FK5 C;  3F6H A;  1NEI A;  4R2D A;  1PKP A;  2YTO A;  3EQ1 A;  1A1G A;  1UN6 B;  5A69 A;  4ZYD A;  2E72 A;  4DV0 E;  4ZYE A;  2EMF A;  2EPC A;  2EL6 A;  3THN A;  2EMW A;  5CFF E;  4JV5 E;  5LMN E;  1I94 E;  2EPU A;  1X6H A;  2JWO A;  1A1H A;  1ZU1 A;  4DR1 E;  1DGC A;  1XNQ E;  2EQ0 A;  4R2S A;  1WRJ A;  4AQY E;  4LTY A;  1EH6 A;  1A1K A;  2LJU A;  5BR8 E;  4JI8 E;  1T4L B;  4LF4 E;  1PJQ A;  2JR1 A;  4KZS A;  1XMQ E;  1F2I G;  2R76 A;  3ADJ A;  1T4N A;  1PDA A;  2J7J A;  2B7T A;  2EOY A;  2UUB E;  2EMB A;  4O5G A;  1PJT A;  2M1S A;  1IMU A;  2HJJ A;  3HPZ A;  1TF6 A;  4WPY A;  3J80 C;  1X49 A;  2EOJ A;  2EOF A;  2KOU A;  4JI4 E;  4X66 E;  2EPK X;  2N8X A;  1J26 A;  2EML A;  1DQ3 A;  2EPM X;  1HNZ E;  2EOS A;  4TUG A;  2PRT A;  1T4O A;  2EN4 A;  3ZOQ B;  1YYO A;  2B9D A;  4R8O A;  5AC5 A;  4DR4 E;  4O24 A;  4B3R E;  2CTD A;  4DR2 E;  2UUA E;  4WXD A;  4M30 A;  4F9C B;  4LFC E;  2D9H A;  2GPI A;  4WXC A;  2NA2 A;  1YSA C;  4O43 A;  4X65 E;  1N33 E;  4DV7 E;  2DMI A;  2EM8 A;  2EM5 A;  5ADZ A;  1NCS A;  4LF5 E;  2DLK A;  5AE2 A;  4IS1 C;  2M9A A;  2YTN A;  2EOE A;  3MHS C;  2LRS A;  2VQE E;  1RC7 A;  3ECR A;  3IWB A;  3BBG A;  2LTS A;  2V88 A;  2L8T A;  3KZZ A;  3C6K A;  3C4B A;  3JTZ A;  3UK3 C;  4B3S E;  4OOG C;  4LU9 A;  3P1X A;  3HPS A;  2ODR C;  2V86 A;  1ZR9 A;  1WHN A;  1IBM E;  2HHH E;  4LFB E;  4MLV A;  2LUP B;  2ENC A;  2N3G A;  3LML A;  1X6E A;  3EPJ A;  4Q35 B;  4LF6 E;  2EWL A;  2GHF A;  2LUQ A;  2RPC A;  3K6Q A;  1JK2 A;  4DV1 E;  4DV4 E;  3MHH C;  5AE3 A;  2LE2 A;  4ZYG A;  1LLM C;  3TQM A;  2EMA A;  4R03 A;  2EJ4 A;  3OTO E;  2L33 A;  2EPZ A;  5IV8 B;  5A6K A;  1HR0 E;  1YUI A;  2EM9 A;  3ADL A;  4F54 A;  2UXB E;  4BC7 A;  1STU A;  5FLX C;  4L8N A;  4JI0 E;  4GZN C;  2EMX A;  2YTI A;  2EN8 A;  1MGT A;  1HNX E;  4I8O A;  4HTG A;  4WSP A;  5LLQ A;  2EPP A;  4N4R B;  2ELZ A;  1YFH A;  3LLH A;  1FJG E;  4TUI A;  4JI6 E;  3DF6 A;  2K4V A;  1X47 A;  1IQO A;  5KL3 A;  4NXM E;  1EH8 A;  2R1F A;  5IXM B;  1ZBT A;  2JPA A;  1T39 A;  1G2D C;  5AAS A;  2V83 A;  2EOZ A;  2JY9 A;  2VF1 A;  1G2F C;  2EM0 A;  2YSP A;  4BCA A;  4F6N A;  4NZV A;  2JXP A;  3VK6 A;  1BB8 A;  2KHX A;  2VE7 C;  2ENA A;  3KZY A;  2DGC A;  1GQE A;  2GLI A;  1RQ0 A;  2ELY A;  2EOQ A;  3J7Y p;  4L5N C;  2I13 A;  2EM3 A;  2NAB A;  2B7V A;  3BGH A;  2DSY A;  2EN2 A;  2DLQ A;  3T1Y E;  1IQS A;  2L2M A;  2L6M A;  2EZ6 A;  2MC5 A;  2EMK A;  1A1J A;  2HGH A;  4JI2 E;  4DUZ E;  2YTE A;  2EN6 A;  1KYQ A;  5IT9 C;  5IWA E;  2M4I A;  1AAY A;  1JK1 A;  4ZYH A;  2KON A;  2UU9 E;  4X62 E;  3F6G A;  4JYA E;  1RMD A;  3HXL A;  4F9B B;  2EMY A;  2LCE A;  1Z1B A;  1YPN A;  1UBD C;  2YZT A;  4R2A A;  1B69 A;  1BBO A;  2EPL X;  4X9J A;  2F8B A;  1N3G A;  2LMZ A;  2RTX A;  2UXC E;  2B3T B;  2EMG A;  2YPN A;  2DMY A;  1UHZ A;  2EQ3 A;  1T38 A;  1MEY C;  5KL2 A;  3EPK A;  4WSG A;  2EPR A;  4R2Q A;  4NXN E;  2EN7 A;  3HQ1 A;  2ZM6 E;  2YTJ A;  2EMI A;  2E1M A;  2EQ1 A;  5KL4 A;  4R2P A;  1A1F A;  4OX9 E;  2ENH A;  2LV2 A;  3DJW A;  2EOO A;  2V89 A;  2MKN A;  2RSM A;  1N34 E;  1WJP A;  4M2Z A;  4JI3 E;  2YT4 A;  2JP9 A;  2DRP A;  4BHC A;  4WYQ B;  4LF9 E;  1N32 E;  1FKA E;  1XNR E;  2YTF A;  2EP3 A;  2YSO A;  1TN9 A;  2L2K B;  2BBG A;  2ODR D;  1GTK A;  3EPH A;  4BC9 A;  4B3M E;  3QG5 C;  2VQF E;  3JAM C;  5DNY A;  2EMC A;  1ZAA C;  2G7H A;  4DV3 E;  3EPL A;  4DV5 E;  2EOI A;  1J5E E;  3THO B;  5KL7 A;  2I9I A;  5AC4 A;  4R2R A;  4DKK A;  1SR9 A;  4F2J C;  1EKZ A;  5A6B A;  2ADR A;  3T1H E;  4JI5 E;  1GZ6 A;  1A1L A;  4GKK E;  2JOX A;  3VHT B;  1WXR A;  2EE8 A;  2EL5 A;  2MDG A;  4R2C A;  4DR7 E;  1AH5 A;  4LF7 E;  3MSW A;  3AUZ A;  2LT7 A;  1UIL A;  4DR3 E;  4M0V A;  2WZO A;  1WHQ A;  4R2E A;  4YY3 E;  2LJH A;  2EOX A;  2JYA A;  4KHP E;  2L3J A;  4MLQ A;  4JI1 E;  2WBS A;  5A6B D;  1X6F A;  1EH7 A;  2HC5 A;  5A6J A;  1L4S A;  4F6M A;  2MDR A;  4M9V C;  2K7I A;  1P47 A;  1PJS A;  3RMP A;  4X8W A;  2LBS B;  2WBU A;  3L00 A;  3IWC A;  4DR5 E;  2YTD A;  3M99 B;  4DMI A;  4F9A B;  3VYY A;  1QU6 A;  4BS9 A;  2NUF A;  2H36 X;  2YWQ A;  4GKJ E;  5LMU E;  2RS6 A;  4RH8 A;  1TF3 A;  2EPN A;  2EPO A;  2EPX A;  4WX9 A;  4DR6 E;  2DB2 A;  3C4T A;  2EM7 A;  2MC6 A;  2LO3 A;  2EL4 A;  2RS7 A;  5F3W A;  1SFE A;  2UXD E;  4HEI A;  2WCC 3;  2EPA A;  4GEQ B;  4IJD A;  2EMH A;  4LFA E;  4DUY E;  5TSE A;  2EM4 A;  4WFT A;  1HNW E;  1O0W A;  3AV0 A;  2NUG A;  5LL6 R;  2L92 A;  2F4V E;  4JI7 E;  4P7D A;  1BBG A;  4DV6 E;  2RQL A; 
#chains in the Genus database with same CATH homology
 4NHR A;  5IV8 B;  3BF2 A;  5TSE A;  2R76 A;  4N4R B;  4RH8 A;  5IXM B;  4Q35 B;  2N8X A;  4KWY A;  4RHB B;  2JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...