4RH8A

Crystal structure of the outer membrane lipopolysaccharide transport protein lpte (rlpb) from escherichia coli in the tetragonal crystal form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
143
structure length
133
Chain Sequence
QVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of lipopolysaccharide insertion into the bacterial outer membrane
rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
molecule keywords LPS-assembly lipoprotein LptE
total genus 30
structure length 133
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04390 LptE Lipopolysaccharide-assembly
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.150 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Lipoprotein like domain 4rh8A00
5TSEA 4NHRA 4RH8A 2R76A 4KWYA 5IV8B 2N8XA 2JXPA 3BF2A 5IXMB 4RHBB 4Q35B 4N4RB
chains in the Genus database with same CATH superfamily
2YTNA 4NXME 1UBDC 1X47A 2EOQA 3L00A 2UUAE 4M30A 4B3RE 1SR9A 1JK1A 2JOXA 4F9AB 1YZ9A 4R2PA 1MGTA 5KL6A 2L92A 3HTXA 2CTDA 4LF4E 3JU0A 3C6KA 4X62E 5AASA 1A1KA 2LRSA 4DV3E 4P7DA 4DR4E 1G2DC 2EOHA 4X65E 2EM5A 4LFBE 1IMUA 2RPCA 3IWBA 1A1HA 1STUA 2DLQA 3RMPA 2EN1A 2EP3A 1G2FC 2E5LE 4WSGA 4R2RA 2KOUA 2UXCE 3ZOQB 4IS1C 2EMCA 2YTFA 4LU9A 2DLKA 2CT1A 2YTOA 5AE2A 2L2KB 2E1MA 2YT4A 2L2MA 2YRKA 5A6BD 4DR3E 2EWLA 2EPLX 4F9BB 2EPKX 2R1FA 2MC6A 4JI0E 4JI6E 4GZNC 5AC5A 3OMLA 4F2JC 2A25A 3EPLA 1N32E 2EORA 4JI2E 3C4BA 5CFFE 2FV4B 3THNA 4DV2E 1GQEA 3ADIA 3IWDA 3QG5C 4L5NC 2RS6A 4MLQA 2KHXA 2VF1A 2JP9A 2EL6A 4GEQB 4LF7E 5AE3A 3IWCA 1T4NA 2EMKA 5F3WA 2L33A 2EPOA 1B69A 1YPNA 2ELZA 2EMBA 4DR7E 1PJQA 1YYWA 2LCEA 3ADLA 2YTDA 2M9AA 1MEYC 2L8TA 2YU5A 1GTKA 2PRTA 1UHZA 2ODRD 5TSEA 2YTIA 4R2EA 2EN2A 5IV8B 2F4VE 4R2DA 1P47A 1A1JA 2UUCE 4M9VC 4AQYE 2B9DA 1ZU1A 2EOFA 1ZBQA 4WXCA 1YYKA 2EN7A 2V87A 4JI7E 2EOMA 4OOGC 4DV7E 1DQ3A 3LMLA 1A1IA 4B3SE 2LJHA 2LTRA 2EPUA 3TQMA 3EPHA 2KONA 1NCSA 2WBSA 2EOOA 1FJGE 4M0VA 5A6AA 2ZM6E 2JPAA 4RH8A 2LE2A 1X49A 2MKDA 1WJPA 2EPCA 4WXDA 2EPNA 4O43A 2EM2A 2EN8A 1IBLE 1HR0E 4KHPE 4LTYA 3EPKA 2EQ1A 1BB8A 3ADJA 1BBGA 4JI5E 5KL4A 4DR2E 4DV1E 1RMDA 2JVAA 1TF6A 2EMGA 4HEIA 2M1SA 2LJUA 2EOIA 5A69A 2EOXA 1WRJA 1HNZE 4B3ME 1ZAAC 2VE7C 2F8BA 2EN6A 3ECRA 2LBSB 4F54A 2FTXB 1IBKE 4O5GA 4X8WA 2WCC3 1N36E 2EM8A 4M2ZA 1PJSA 1X5WA 1LLMC 2YTQA 4JI8E 1WHQA 2ENAA 2EMYA 2YRHA 5IXMB 1I94E 1J26A 3BIDA 2DMIA 1X6FA 4DV6E 4R2QA 4X9JA 4YY3E 1PJTA 4NHRA 2FGGA 2ENCA 2L6MA 2K7IA 5IWAE 2Q8UA 2YTPA 5IT9C 2WBUA 3MHHC 4DV4E 2M4IA 2MC5A 1SFEA 4I8OA 2N3GA 2WBTA 2EE8A 3K6QA 3J7Yp 1QU6A 2EJ4A 2EM9A 2JR1A 4ZYHA 4OX9E 2BBGA 2EOEA 2GPIA 2HC5A 5AC4A 2EM6A 2EPZA 1A1LA 5LMUE 2EPAA 1QNTA 4JYAE 2EMLA 2EMFA 2D9HA 1IQSA 2JWOA 2EMZA 2EM7A 1ZR9A 1L4SA 4Q35B 1TF3A 4JI1E 1AH5A 3BBGA 1T4LB 2VQEE 2V85A 5LLQA 1RQ0A 2WZOA 1XMOE 2NABA 2YSOA 2GLIA 3BF2A 1DI2A 2EN4A 1AAYA 2NUFA 5A2QC 1T38A 1IQOA 1ZBTA 4R03A 4HTGA 1Z1BA 4P78A 4F6NA 2HJJA 2LUPB 3DJWA 4BS9A 3VYXA 4LF8E 2YPNA 2V8QB 4JV5E 2EOJA 4KWYA 1KJKA 2CPNA 4GKKE 2YTJA 1T39A 2EMHA 4R2SA 4N4RB 4YHHE 3AUZA 4L8NA 3UK3C 4F9CB 1IBME 4R2CA 2DSYA 4WSPA 4MLVA 2JXPA 2J7JA 2N3HA 4J8ZA 1GZ6A 2ELYA 4DUZE 3HQ1A 3HXLA 2I9IA 3C6MA 2G7HA 3KWRA 1XMQE 2RS7A 4BCAA 4DMIA 1FKAE 2JY9A 3VK6A 3FIGA 1UN6B 4LF6E 2EQ3A 2N8XA 2YU8A 5ADZA 1X3CA 4WX9A 1PDAA 4DUYE 2ENHA 1YFHA 1T4OA 2ADRA 3T1HE 4O4KA 1EH6A 4Q28A 1TN9A 3THOB 3T1YE 5BR8E 1JK2A 4LF5E 1BBOA 4LF9E 1YYOA 1X6EA 4JI3E 2JOBA 4FK5C 1RC7A 1X48A 1DGCA 4R2AA 3F6GA 3EPJA 1XNRE 5A6KA 1HNWE 2VQFE 2EN3A 1NEIA 2DB2A 4R8OA 2L3JA 1UILA 2MDRA 4WYQB 2DGCA 2E72A 2EQ0A 2HGHA 1XNQE 2LMZA 2YZTA 1J5EE 2LV2A 4O24A 1YSAC 2LTSA 4JI4E 3KZZA 2MKNA 1N3GA 2UXBE 2V83A 4BMJA 4K0KE 4WPYA 2EPRA 2EMWA 1PKPA 3P1XA 2V89A 4DV5E 1WHNA 3HPSA 2RSIA 4BBYA 3F6HA 2LVHA 2V86A 2YSPA 3MHSC 4BHCA 3BGHA 2GHFA 4BHBA 3ADGA 3C4TA 3JTZA 2BB8A 5AE1A 1KYQA 2EMXA 3OTOE 2NUGA 4X64E 2UXDE 5T6JA 2RSMA 1X6HA 4GKJE 3DF6A 3VHTB 3MSWA 2RTXA 2UU9E 3M99B 2M7QA 4DR1E 2EOSA 3AV0A 2RQLA 3J7AG 5DNYA 5FLXC 4WFTA 2YRMA 2JYAA 4ZYGA 2EMAA 5A6BA 3EQ1A 2R76A 2B7TA 2LUQA 2YTGA 4F6MA 1O0WA 2EL5A 5LL6R 2B7VA 2NA2A 2NUEA 2DMYA 2EPPA 3HPZA 3VYYA 1HNXE 2EMIA 2ODRC 5KL2A 1EH8A 4NZVA 2DRPA 1F2IG 2B3TB 4DV0E 2LO3A 4LFAE 2DIXA 2EL4A 2EPXA 2YTEA 3LLHA 3J80C 4DKKA 5A6JA 5KL3A 2I13A 2EOYA 2EM0A 2LT7A 4LFCE 1YUIA 2VRDA 1N33E 2EOZA 1EKZA 5KL5A 2CSHA 2K4VA 3KZYA 2V88A 5KL7A 1EH7A 1N34E 2L3CA 2EPMX 4B3TE 1A1GA 3JAMC 3J81C 4KZSA 4TUGA 2L2NA 2H36X 1A1FA 4BC9A 5LMNE 4DR5E 4ZYDA 4BC7A 4DR6E 1WXRA 1YUJA 4NXNE 4TUIA 2EZ6A 4ZYEA 3H09A 4IJDA 2EM3A 2HHHE 2UUBE 4X66E 2IHR1 2MDGA 2EM4A 4RHBB 2YWQA
chains in the Genus database with same CATH topology
5TSEA 4NHRA 4RH8A 2R76A 4KWYA 5IV8B 2N8XA 2JXPA 3BF2A 5IXMB 4RHBB 4Q35B 4N4RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSE A;  4NHR A;  4RH8 A;  2R76 A;  4KWY A;  5IV8 B;  2N8X A;  2JXP A;  3BF2 A;  5IXM B;  4RHB B;  4Q35 B;  4N4R B; 
#chains in the Genus database with same CATH topology
 2YTN A;  4NXM E;  1UBD C;  1X47 A;  2EOQ A;  3L00 A;  2UUA E;  4M30 A;  4B3R E;  1SR9 A;  1JK1 A;  2JOX A;  4F9A B;  1YZ9 A;  4R2P A;  1MGT A;  5KL6 A;  2L92 A;  3HTX A;  2CTD A;  4LF4 E;  3JU0 A;  3C6K A;  4X62 E;  5AAS A;  1A1K A;  2LRS A;  4DV3 E;  4P7D A;  4DR4 E;  1G2D C;  2EOH A;  4X65 E;  2EM5 A;  4LFB E;  1IMU A;  2RPC A;  3IWB A;  1A1H A;  1STU A;  2DLQ A;  3RMP A;  2EN1 A;  2EP3 A;  1G2F C;  2E5L E;  4WSG A;  4R2R A;  2KOU A;  2UXC E;  3ZOQ B;  4IS1 C;  2EMC A;  2YTF A;  4LU9 A;  2DLK A;  2CT1 A;  2YTO A;  5AE2 A;  2L2K B;  2E1M A;  2YT4 A;  2L2M A;  2YRK A;  5A6B D;  4DR3 E;  2EWL A;  2EPL X;  4F9B B;  2EPK X;  2R1F A;  2MC6 A;  4JI0 E;  4JI6 E;  4GZN C;  5AC5 A;  3OML A;  4F2J C;  2A25 A;  3EPL A;  1N32 E;  2EOR A;  4JI2 E;  3C4B A;  5CFF E;  2FV4 B;  3THN A;  4DV2 E;  1GQE A;  3ADI A;  3IWD A;  3QG5 C;  4L5N C;  2RS6 A;  4MLQ A;  2KHX A;  2VF1 A;  2JP9 A;  2EL6 A;  4GEQ B;  4LF7 E;  5AE3 A;  3IWC A;  1T4N A;  2EMK A;  5F3W A;  2L33 A;  2EPO A;  1B69 A;  1YPN A;  2ELZ A;  2EMB A;  4DR7 E;  1PJQ A;  1YYW A;  2LCE A;  3ADL A;  2YTD A;  2M9A A;  1MEY C;  2L8T A;  2YU5 A;  1GTK A;  2PRT A;  1UHZ A;  2ODR D;  5TSE A;  2YTI A;  4R2E A;  2EN2 A;  5IV8 B;  2F4V E;  4R2D A;  1P47 A;  1A1J A;  2UUC E;  4M9V C;  4AQY E;  2B9D A;  1ZU1 A;  2EOF A;  1ZBQ A;  4WXC A;  1YYK A;  2EN7 A;  2V87 A;  4JI7 E;  2EOM A;  4OOG C;  4DV7 E;  1DQ3 A;  3LML A;  1A1I A;  4B3S E;  2LJH A;  2LTR A;  2EPU A;  3TQM A;  3EPH A;  2KON A;  1NCS A;  2WBS A;  2EOO A;  1FJG E;  4M0V A;  5A6A A;  2ZM6 E;  2JPA A;  4RH8 A;  2LE2 A;  1X49 A;  2MKD A;  1WJP A;  2EPC A;  4WXD A;  2EPN A;  4O43 A;  2EM2 A;  2EN8 A;  1IBL E;  1HR0 E;  4KHP E;  4LTY A;  3EPK A;  2EQ1 A;  1BB8 A;  3ADJ A;  1BBG A;  4JI5 E;  5KL4 A;  4DR2 E;  4DV1 E;  1RMD A;  2JVA A;  1TF6 A;  2EMG A;  4HEI A;  2M1S A;  2LJU A;  2EOI A;  5A69 A;  2EOX A;  1WRJ A;  1HNZ E;  4B3M E;  1ZAA C;  2VE7 C;  2F8B A;  2EN6 A;  3ECR A;  2LBS B;  4F54 A;  2FTX B;  1IBK E;  4O5G A;  4X8W A;  2WCC 3;  1N36 E;  2EM8 A;  4M2Z A;  1PJS A;  1X5W A;  1LLM C;  2YTQ A;  4JI8 E;  1WHQ A;  2ENA A;  2EMY A;  2YRH A;  5IXM B;  1I94 E;  1J26 A;  3BID A;  2DMI A;  1X6F A;  4DV6 E;  4R2Q A;  4X9J A;  4YY3 E;  1PJT A;  4NHR A;  2FGG A;  2ENC A;  2L6M A;  2K7I A;  5IWA E;  2Q8U A;  2YTP A;  5IT9 C;  2WBU A;  3MHH C;  4DV4 E;  2M4I A;  2MC5 A;  1SFE A;  4I8O A;  2N3G A;  2WBT A;  2EE8 A;  3K6Q A;  3J7Y p;  1QU6 A;  2EJ4 A;  2EM9 A;  2JR1 A;  4ZYH A;  4OX9 E;  2BBG A;  2EOE A;  2GPI A;  2HC5 A;  5AC4 A;  2EM6 A;  2EPZ A;  1A1L A;  5LMU E;  2EPA A;  1QNT A;  4JYA E;  2EML A;  2EMF A;  2D9H A;  1IQS A;  2JWO A;  2EMZ A;  2EM7 A;  1ZR9 A;  1L4S A;  4Q35 B;  1TF3 A;  4JI1 E;  1AH5 A;  3BBG A;  1T4L B;  2VQE E;  2V85 A;  5LLQ A;  1RQ0 A;  2WZO A;  1XMO E;  2NAB A;  2YSO A;  2GLI A;  3BF2 A;  1DI2 A;  2EN4 A;  1AAY A;  2NUF A;  5A2Q C;  1T38 A;  1IQO A;  1ZBT A;  4R03 A;  4HTG A;  1Z1B A;  4P78 A;  4F6N A;  2HJJ A;  2LUP B;  3DJW A;  4BS9 A;  3VYX A;  4LF8 E;  2YPN A;  2V8Q B;  4JV5 E;  2EOJ A;  4KWY A;  1KJK A;  2CPN A;  4GKK E;  2YTJ A;  1T39 A;  2EMH A;  4R2S A;  4N4R B;  4YHH E;  3AUZ A;  4L8N A;  3UK3 C;  4F9C B;  1IBM E;  4R2C A;  2DSY A;  4WSP A;  4MLV A;  2JXP A;  2J7J A;  2N3H A;  4J8Z A;  1GZ6 A;  2ELY A;  4DUZ E;  3HQ1 A;  3HXL A;  2I9I A;  3C6M A;  2G7H A;  3KWR A;  1XMQ E;  2RS7 A;  4BCA A;  4DMI A;  1FKA E;  2JY9 A;  3VK6 A;  3FIG A;  1UN6 B;  4LF6 E;  2EQ3 A;  2N8X A;  2YU8 A;  5ADZ A;  1X3C A;  4WX9 A;  1PDA A;  4DUY E;  2ENH A;  1YFH A;  1T4O A;  2ADR A;  3T1H E;  4O4K A;  1EH6 A;  4Q28 A;  1TN9 A;  3THO B;  3T1Y E;  5BR8 E;  1JK2 A;  4LF5 E;  1BBO A;  4LF9 E;  1YYO A;  1X6E A;  4JI3 E;  2JOB A;  4FK5 C;  1RC7 A;  1X48 A;  1DGC A;  4R2A A;  3F6G A;  3EPJ A;  1XNR E;  5A6K A;  1HNW E;  2VQF E;  2EN3 A;  1NEI A;  2DB2 A;  4R8O A;  2L3J A;  1UIL A;  2MDR A;  4WYQ B;  2DGC A;  2E72 A;  2EQ0 A;  2HGH A;  1XNQ E;  2LMZ A;  2YZT A;  1J5E E;  2LV2 A;  4O24 A;  1YSA C;  2LTS A;  4JI4 E;  3KZZ A;  2MKN A;  1N3G A;  2UXB E;  2V83 A;  4BMJ A;  4K0K E;  4WPY A;  2EPR A;  2EMW A;  1PKP A;  3P1X A;  2V89 A;  4DV5 E;  1WHN A;  3HPS A;  2RSI A;  4BBY A;  3F6H A;  2LVH A;  2V86 A;  2YSP A;  3MHS C;  4BHC A;  3BGH A;  2GHF A;  4BHB A;  3ADG A;  3C4T A;  3JTZ A;  2BB8 A;  5AE1 A;  1KYQ A;  2EMX A;  3OTO E;  2NUG A;  4X64 E;  2UXD E;  5T6J A;  2RSM A;  1X6H A;  4GKJ E;  3DF6 A;  3VHT B;  3MSW A;  2RTX A;  2UU9 E;  3M99 B;  2M7Q A;  4DR1 E;  2EOS A;  3AV0 A;  2RQL A;  3J7A G;  5DNY A;  5FLX C;  4WFT A;  2YRM A;  2JYA A;  4ZYG A;  2EMA A;  5A6B A;  3EQ1 A;  2R76 A;  2B7T A;  2LUQ A;  2YTG A;  4F6M A;  1O0W A;  2EL5 A;  5LL6 R;  2B7V A;  2NA2 A;  2NUE A;  2DMY A;  2EPP A;  3HPZ A;  3VYY A;  1HNX E;  2EMI A;  2ODR C;  5KL2 A;  1EH8 A;  4NZV A;  2DRP A;  1F2I G;  2B3T B;  4DV0 E;  2LO3 A;  4LFA E;  2DIX A;  2EL4 A;  2EPX A;  2YTE A;  3LLH A;  3J80 C;  4DKK A;  5A6J A;  5KL3 A;  2I13 A;  2EOY A;  2EM0 A;  2LT7 A;  4LFC E;  1YUI A;  2VRD A;  1N33 E;  2EOZ A;  1EKZ A;  5KL5 A;  2CSH A;  2K4V A;  3KZY A;  2V88 A;  5KL7 A;  1EH7 A;  1N34 E;  2L3C A;  2EPM X;  4B3T E;  1A1G A;  3JAM C;  3J81 C;  4KZS A;  4TUG A;  2L2N A;  2H36 X;  1A1F A;  4BC9 A;  5LMN E;  4DR5 E;  4ZYD A;  4BC7 A;  4DR6 E;  1WXR A;  1YUJ A;  4NXN E;  4TUI A;  2EZ6 A;  4ZYE A;  3H09 A;  4IJD A;  2EM3 A;  2HHH E;  2UUB E;  4X66 E;  2IHR 1;  2MDG A;  2EM4 A;  4RHB B;  2YWQ A; 
#chains in the Genus database with same CATH homology
 5TSE A;  4NHR A;  4RH8 A;  2R76 A;  4KWY A;  5IV8 B;  2N8X A;  2JXP A;  3BF2 A;  5IXM B;  4RHB B;  4Q35 B;  4N4R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...